5II2A

Crystal structure of the fifth bromodomain of human polybromo (pb1) in complex with 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4h-chromen-4-one
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Discovery and Optimization of a Selective Ligand for the Switch/Sucrose Nonfermenting-Related Bromodomains of Polybromo Protein-1 by the Use of Virtual Screening and Hydration Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ii2A00
5ENFA 4HBYA 4X2IA 4CL9A 5E0RA 5DKCA 3JVLA 5DYUA 5LJ0A 5FE3A 5I88A 5HRXA 5FB1A 5EI4A 5HQ5A 5KO4A 4CUUA 4QSWA 4UYFB 4CLBA 4OUFA 5FE9A 4LDFA 1JM4B 4HXSA 4FLPA 4NS5A 4NYVA 2YDWA 4IORA 4KCXA 3NXBA 5ENBA 4N4FA 5ETDA 4YBMA 5FDZA 5HQ7A 3HMEA 3O36A 2OSSA 5CPEA 4HXPA 4QSVA 5CU8A 4A9EA 4Z6IA 5D3HA 4IOQA 4BW1A 2YEMA 5G4SA 5J0DA 4A9OA 4NXJA 4ZW1A 5DX4A 2I8NA 4O76A 3UVWA 3UV5A 4O78A 3O34A 3QZTA 4UIWA 5HLSA 3HMFA 5F3AA 4DONA 5EK9A 4NRCA 5IG6A 2OO1A 4MR5A 5I80A 2LSPB 4YC9A 5I7YA 4ALHA 5E73A 4O7FA 4O71A 4KV1A 5DFCA 5CZGA 5G4RA 4YY4A 5C7NA 4BW4A 4N3WA 5CQ7A 2RFJA 4XUBA 3AADA 3UW9A 4YYNA 4Z1SA 3MULA 4Q0NA 5KHMA 3LJWA 4C67A 4PCEA 4NR8A 4XYAA 5CTLA 5D25A 4YYDA 5C87A 5CQAA 4QB3A 5I29A 2KTBB 4YYKA 2DVRA 5DFBA 4QC1A 5ENEA 4TQNA 4NUCA 5HFQA 4TU4A 3MUKA 1N72A 5ENIA 5EWDA 4QY4A 4LYSA 5EISA 5FE4A 4HXNA 5I86A 4UYDA 3LQHA 5FFWA 5E3DA 5FFVA 3DWYA 3O35A 4NUEA 4YK0A 1ZS5A 2N9GA 4J1PA 5CFWA 4XY8A 5A83A 2DWWA 4MEPA 5D26A 5E7DA 5EWWA 2E7NA 3D7CA 5EA1A 4O70A 4BW2A 2DVQA 5HQ6A 5I83A 2YELA 5E9YA 5DW2A 5ACYA 5EWHA 4PS5A 5HEMA 3JVJA 4PTBA 3IU5A 5E9KA 3LQJA 5A5PA 1X0JA 3IU6A 4NRBA 3U5PA 4A9HA 2GRCA 5CY9A 4KV4A 2RNYA 5CQ6A 4UIUA 4RVRA 4QC3A 4UIXA 4O7BA 5EVAA 5D0CA 2YEKA 5EWCA 2RI7A 4ZQLA 5KTWA 3JVKA 4ZC9A 4QBMA 4N4IA 5FBXA 4UIYA 5AD2A 5EICA 5D3JA 3UVXA 5D3NA 4O75A 5KTXA 4LR6A 4QR4A 5DYAA 2DATA 5TCMA 5D3SA 3U5JA 3MB3A 4A9LA 5K29A 4LZ2A 4QSSA 3Q2EA 5DLZA 4NR9A 5CUGA 1WUMA 5LVRA 4LC2A 5FG6A 5F2PA 4TS8A 3DAIA 4N4GA 4A9JA 3ZYUA 5ETBA 5FH6A 3U5MA 1E6IA 4LZSA 4QSUA 4TZ8A 5EWVA 5F5ZA 5TB6A 2R0YA 4UYEA 5CQ8A 5CUDA 4YABA 5CS8A 4YADA 5CQTA 4QSRA 5E9VA 4HXLA 4CURA 2L5EA 5LJ2A 4NQMA 5FE5A 2L85A 4TYLA 5II1A 5I89A 5DKDA 5F1LA 2F6NA 4TT2A 4NQNA 4OGJA 5A5NA 5I40A 3I3JA 5IBNA 5EPRA 5ENJA 4O7EA 2DKWA 5CQ4A 5FE1A 4OGIA 2YW5A 4BJXA 4YYGA 5CQ5A 4HBWA 5DY7A 2E3KA 5EPBA 4PKLA 2MJVB 4F3IA 5HRWA 5KU3A 1JSPB 3QZVA 5CRZA 4GPJA 5L99A 3TLPA 4A9NA 3Q2FA 4UIZA 3U5LA 3ONIA 5EPSA 3AQAA 4NUDA 4MR4A 5IGMA 4A9IA 5H85A 5EGUA 4NYXA 4O7CA 4J0RA 5L97A 2D82A 5FFYA 4A9MA 5IGNA 4BHWA 1EQFA 4YH3A 5FE2A 3P1DA 5CUEA 5E74A 5FG4A 2I7KA 5F36A 4QSQA 5ENGA 4XUAA 2R0VA 5IIDA 4YH4A 5AMFA 4LYIA 4J3IA 3LQIA 5I1QA 4QYDA 5EM3A 3UVYA 5DW1A 3FKMX 4NR7A 4HXKA 5C4QA 5F25A 2RNXA 4YBTA 4QSPA 5HFRA 1F68A 2L84A 4MEOA 4QEVA 5DFDA 5IGKA 5I7XA 5LKTA 3UVDA 5BT5A 4C66A 4IR5A 3K2JA 4CFLA 4NRAA 5L8TA 4CUTA 4YYMA 4NR6A 2OUOA 4BW3A 5EU1A 5LUUA 4UITA 4LZRA 2R10A 4TT4A 4QYLA 4A9FA 5DYXA 3MB4A 4HBXA 4WHUA 4HXMA 4YAXA 5F61A 3HMHA 5A82A 5FE8A 5CGPA 5DBMA 3O37A 4HBVA 5EV9A 5A5RA 3S91A 5D3LA 3UV4A 2E7OA 4AKNA 5A5OA 4NR5A 5F1HA 5COIA 4LYWA 4Z1QA 5DKHA 5EQ1A 5LKZA 3MXFA 2WP2A 5H1UA 3SVGA 4CUQA 4CUPA 5C89A 4MEQA 4MR6A 4PY6A 4Y03A 4IOOA 5FE0A 2F6JA 4LRGA 3O33A 4YYJA 5CUCA 4TU6A 4TZ2A 4Z93A 4QUTA 5A85A 5F63A 4O72A 5FH8A 3LXJA 5HENA 5F60A 2H60A 4WHWA 5E9LA 5II2A 5FG5A 3U5NA 5A5SA 2G4AA 5FE6A 2R0SA 2YQDA 3MQMA 4HXRA 4NR4A 2RO1A 5CUAA 5CRMA 4O7AA 4UYFA 5JWMA 4YBSA 4QEUA 3G0LA 3P1EA 3U5KA 3GG3A 5C8GA 2WP1A 4IR4A 4XY9A 5A81A 4CUSA 3JVMA 3P1CA 4QSXA 4YY6A 5AD3A 5FH7A 3SVHA 4O77A 5LVQA 2RS9B 4NYWA 5A5QA 5CUBA 4QEWA 5HRVA 1WUGA 3P1FA 5HJCA 4N4HA 5BT3A 5HELA 3RCWA 3U5OA 4QNSA 5LKXA 2NXBA 5E9MA 4QR3A 4Z6HA 4UYGA 5C85A 2DVVA 3QZSA 5E3GA 4IR3A 5FE7A 5FB0A 5AMEA 5KTUA 2FSAA 5LKUA 2RNWA 5D24A 4HXOA 5IGLA 4WIVA 5D7XA 5LJ1A 3G0JA 5HCLA 5A7CA 4UYHA 4YYHA 5H1VA 4MENA 4UIVA 4YYIA 5DYCA 2D9EA 5ENCA 4ALGA 5L8UA 3SVFA 5H1TA 5DLXA 5HM0A 5D3RA 5JI8A 4PCIA 4QR5A 4YATA 5E9IA 5L96A 2DVSA 4J0SA 5F62A 4O74A 5D3TA 4QUUA 5CP5A 4Q0OA 3S92A 4MR3A 2YYNA 4TT6A 3UV2A 4A9KA 4TTEA 5D3PA 4CFKA 4QSTA 5EP7A 4IR6A 5CQ3A 5BT4A 3P5OA 5ENHA 5L98A 4E96A 4QZSA
chains in the Genus database with same CATH superfamily
5ENFA 4HBYA 4X2IA 4CL9A 5E0RA 5DKCA 3JVLA 5DYUA 5LJ0A 5FE3A 5I88A 5HRXA 5FB1A 5EI4A 5HQ5A 5KO4A 4CUUA 4QSWA 4UYFB 4CLBA 4OUFA 5FE9A 4LDFA 1JM4B 4HXSA 4FLPA 4NS5A 4NYVA 2YDWA 4IORA 4KCXA 3NXBA 5ENBA 4N4FA 5ETDA 4YBMA 5FDZA 5HQ7A 3HMEA 3O36A 2OSSA 5CPEA 4HXPA 4QSVA 5CU8A 4A9EA 4Z6IA 5D3HA 4IOQA 4BW1A 2YEMA 5G4SA 5J0DA 4A9OA 4NXJA 4ZW1A 5DX4A 2I8NA 4O76A 3UVWA 3UV5A 4O78A 3O34A 3QZTA 4UIWA 5HLSA 3HMFA 5F3AA 4DONA 5EK9A 4NRCA 5IG6A 2OO1A 4MR5A 5I80A 2LSPB 4YC9A 5I7YA 4ALHA 5E73A 4O7FA 4O71A 4KV1A 5DFCA 5CZGA 5G4RA 4YY4A 5C7NA 4BW4A 4N3WA 5CQ7A 2RFJA 4XUBA 3AADA 3UW9A 4YYNA 4Z1SA 3MULA 4Q0NA 5KHMA 3LJWA 4C67A 4PCEA 4NR8A 4XYAA 5CTLA 5D25A 4YYDA 5C87A 5CQAA 4QB3A 5I29A 2KTBB 4YYKA 2DVRA 5DFBA 4QC1A 5ENEA 4TQNA 4NUCA 5HFQA 4TU4A 3MUKA 1N72A 5ENIA 5EWDA 4QY4A 4LYSA 5EISA 5FE4A 4HXNA 5I86A 4UYDA 3LQHA 5FFWA 5E3DA 5FFVA 3DWYA 3O35A 4NUEA 4YK0A 1ZS5A 2N9GA 4J1PA 5CFWA 4XY8A 5A83A 2DWWA 4MEPA 5D26A 5E7DA 5EWWA 2E7NA 3D7CA 5EA1A 3VKGA 4O70A 4BW2A 2DVQA 5HQ6A 5I83A 2YELA 5E9YA 5DW2A 5ACYA 5EWHA 4PS5A 5HEMA 3JVJA 4PTBA 3IU5A 5E9KA 3LQJA 5A5PA 1X0JA 3IU6A 4NRBA 3U5PA 4A9HA 2GRCA 5CY9A 4KV4A 2RNYA 5CQ6A 4UIUA 4RVRA 4QC3A 4UIXA 4O7BA 5EVAA 5D0CA 2YEKA 5EWCA 2RI7A 4ZQLA 5KTWA 3JVKA 4ZC9A 4QBMA 4N4IA 5FBXA 4UIYA 5AD2A 5EICA 5D3JA 3UVXA 5D3NA 4O75A 5KTXA 4LR6A 4QR4A 5DYAA 2DATA 5TCMA 5D3SA 3U5JA 3MB3A 4A9LA 5K29A 4LZ2A 4QSSA 3Q2EA 5DLZA 4NR9A 5CUGA 1WUMA 5LVRA 4LC2A 5FG6A 5F2PA 4TS8A 3DAIA 4N4GA 4A9JA 3ZYUA 5ETBA 5FH6A 3U5MA 1E6IA 4LZSA 4QSUA 4TZ8A 5EWVA 5F5ZA 5TB6A 2R0YA 4UYEA 5CQ8A 5CUDA 4YABA 5CS8A 4YADA 5CQTA 4QSRA 5E9VA 4HXLA 4CURA 2L5EA 5LJ2A 4NQMA 5FE5A 2L85A 4TYLA 5II1A 5I89A 5DKDA 5F1LA 2F6NA 4TT2A 4NQNA 4OGJA 5A5NA 5I40A 3I3JA 5IBNA 5EPRA 5ENJA 4O7EA 2DKWA 5CQ4A 5FE1A 4OGIA 2YW5A 4BJXA 4YYGA 5CQ5A 4HBWA 5DY7A 2E3KA 5EPBA 4PKLA 2MJVB 4F3IA 5HRWA 5KU3A 1JSPB 3QZVA 5CRZA 3D1BA 4GPJA 5L99A 3TLPA 4A9NA 3Q2FA 4UIZA 3U5LA 3ONIA 5EPSA 3AQAA 4NUDA 4MR4A 5IGMA 4A9IA 5H85A 4AKHA 5EGUA 4NYXA 4O7CA 4J0RA 5L97A 2D82A 5FFYA 4A9MA 5IGNA 4BHWA 1EQFA 4YH3A 5FE2A 3P1DA 5CUEA 5E74A 5FG4A 2I7KA 5F36A 4QSQA 5ENGA 4XUAA 2R0VA 5IIDA 4YH4A 5AMFA 4LYIA 3D1DA 4J3IA 3LQIA 5I1QA 4QYDA 5EM3A 3UVYA 5DW1A 3FKMX 4NR7A 4HXKA 5C4QA 5F25A 2RNXA 4YBTA 4QSPA 5HFRA 1F68A 2L84A 4MEOA 4QEVA 5DFDA 5IGKA 5I7XA 5LKTA 3UVDA 5BT5A 4C66A 4IR5A 3K2JA 4CFLA 4NRAA 5L8TA 4CUTA 4YYMA 4NR6A 2OUOA 4BW3A 5EU1A 5LUUA 4UITA 4LZRA 2R10A 4TT4A 4QYLA 4A9FA 5DYXA 3MB4A 4HBXA 4WHUA 4HXMA 3ERRA 4YAXA 5F61A 3HMHA 5A82A 5FE8A 5CGPA 5DBMA 3O37A 4HBVA 5EV9A 5A5RA 3S91A 5D3LA 3UV4A 2E7OA 4AKNA 5A5OA 4NR5A 5F1HA 5COIA 4LYWA 4Z1QA 5DKHA 5EQ1A 5LKZA 3MXFA 2WP2A 5H1UA 3SVGA 2EJNA 4CUQA 4CUPA 5C89A 4MEQA 4MR6A 4PY6A 4Y03A 4IOOA 5FE0A 4AKIA 2F6JA 4LRGA 3O33A 4YYJA 5CUCA 4AKGA 4TU6A 4TZ2A 1ZKRA 4Z93A 4QUTA 5A85A 5F63A 1PUOA 4O72A 5FH8A 3LXJA 5HENA 5F60A 2H60A 4WHWA 5E9LA 5II2A 5FG5A 3U5NA 5A5SA 2G4AA 5FE6A 2R0SA 2YQDA 3MQMA 4HXRA 4NR4A 2RO1A 5CUAA 5CRMA 4O7AA 4UYFA 5JWMA 4YBSA 4QEUA 3G0LA 3P1EA 3U5KA 3GG3A 5C8GA 2WP1A 4IR4A 4XY9A 5A81A 4CUSA 3JVMA 3P1CA 4AI6A 4QSXA 4YY6A 5AD3A 5FH7A 3SVHA 4O77A 5LVQA 2RS9B 4NYWA 5A5QA 5CUBA 4QEWA 5HRVA 1WUGA 3P1FA 5HJCA 4N4HA 5BT3A 5HELA 3RCWA 3U5OA 4QNSA 5LKXA 2NXBA 5E9MA 4QR3A 4Z6HA 4UYGA 5C85A 2DVVA 3QZSA 5E3GA 4IR3A 5FE7A 5FB0A 5AMEA 5KTUA 2FSAA 5LKUA 2RNWA 5D24A 4HXOA 5IGLA 4WIVA 5D7XA 5LJ1A 3G0JA 5HCLA 5A7CA 4UYHA 4YYHA 5H1VA 4MENA 4UIVA 4YYIA 5DYCA 2D9EA 5ENCA 4ALGA 5L8UA 3SVFA 5H1TA 3VKHA 5DLXA 5HM0A 5D3RA 5JI8A 4PCIA 4QR5A 4YATA 5E9IA 5L96A 2DVSA 4J0SA 5F62A 4O74A 5D3TA 4QUUA 5CP5A 4Q0OA 3S92A 4MR3A 2YYNA 4TT6A 3UV2A 4A9KA 4TTEA 5D3PA 4CFKA 4QSTA 5EP7A 4IR6A 5CQ3A 5BT4A 3P5OA 5ENHA 5L98A 4E96A 4QZSA
chains in the Genus database with same CATH topology
5ENFA 4HBYA 4X2IA 4CL9A 5E0RA 5DKCA 3JVLA 5DYUA 5LJ0A 5FE3A 5I88A 5HRXA 5FB1A 5EI4A 5HQ5A 5KO4A 4CUUA 4QSWA 4UYFB 4CLBA 4OUFA 5FE9A 4LDFA 1JM4B 4HXSA 4FLPA 4NS5A 4NYVA 2YDWA 4IORA 4KCXA 3NXBA 5ENBA 4N4FA 5ETDA 4YBMA 5FDZA 5HQ7A 3HMEA 3O36A 2OSSA 5CPEA 4HXPA 4QSVA 5CU8A 4A9EA 4Z6IA 5D3HA 4IOQA 4BW1A 2YEMA 5G4SA 5J0DA 4A9OA 4NXJA 4ZW1A 5DX4A 2I8NA 4O76A 3UVWA 3UV5A 4O78A 3O34A 3QZTA 4UIWA 5HLSA 3HMFA 5F3AA 4DONA 5EK9A 4NRCA 5IG6A 2OO1A 4MR5A 5I80A 2LSPB 4YC9A 5I7YA 4ALHA 5E73A 4O7FA 4O71A 4KV1A 5DFCA 5CZGA 5G4RA 4YY4A 5C7NA 4BW4A 4N3WA 5CQ7A 2RFJA 4XUBA 3AADA 3UW9A 4YYNA 4Z1SA 3MULA 4Q0NA 5KHMA 3LJWA 4C67A 4PCEA 4NR8A 4XYAA 5CTLA 5D25A 4YYDA 5C87A 5CQAA 4QB3A 5I29A 2KTBB 4YYKA 2DVRA 5DFBA 4QC1A 5ENEA 4TQNA 4NUCA 5HFQA 4TU4A 3MUKA 1N72A 5ENIA 5EWDA 4QY4A 4LYSA 5EISA 5FE4A 4HXNA 5I86A 4UYDA 3LQHA 5FFWA 5E3DA 5FFVA 3DWYA 3O35A 4NUEA 4YK0A 1ZS5A 2N9GA 4J1PA 5CFWA 4XY8A 5A83A 2DWWA 4MEPA 5D26A 5E7DA 5EWWA 2E7NA 3D7CA 5EA1A 4O70A 4BW2A 2DVQA 5HQ6A 5I83A 2YELA 5E9YA 5DW2A 5ACYA 5EWHA 4PS5A 5HEMA 3JVJA 4PTBA 3IU5A 5E9KA 3LQJA 5A5PA 1X0JA 3IU6A 4NRBA 3U5PA 4A9HA 2GRCA 5CY9A 4KV4A 2RNYA 5CQ6A 4UIUA 4RVRA 4QC3A 4UIXA 4O7BA 5EVAA 5D0CA 2YEKA 5EWCA 2RI7A 4ZQLA 5KTWA 3JVKA 4ZC9A 4QBMA 4N4IA 5FBXA 4UIYA 5AD2A 5EICA 5D3JA 3UVXA 5D3NA 4O75A 5KTXA 4LR6A 4QR4A 5DYAA 2DATA 5TCMA 5D3SA 3U5JA 3MB3A 4A9LA 5K29A 4LZ2A 4QSSA 3Q2EA 5DLZA 4NR9A 5CUGA 1WUMA 5LVRA 4LC2A 5FG6A 5F2PA 4TS8A 3DAIA 4N4GA 4A9JA 3ZYUA 5ETBA 5FH6A 3U5MA 1E6IA 4LZSA 4QSUA 4TZ8A 5EWVA 5F5ZA 5TB6A 2R0YA 4UYEA 5CQ8A 5CUDA 4YABA 5CS8A 4YADA 5CQTA 4QSRA 5E9VA 4HXLA 4CURA 2L5EA 5LJ2A 4NQMA 5FE5A 2L85A 4TYLA 5II1A 5I89A 5DKDA 5F1LA 2F6NA 4TT2A 4NQNA 4OGJA 5A5NA 5I40A 3I3JA 5IBNA 5EPRA 5ENJA 4O7EA 2DKWA 5CQ4A 5FE1A 4OGIA 2YW5A 4BJXA 4YYGA 5CQ5A 4HBWA 5DY7A 2E3KA 5EPBA 4PKLA 2MJVB 4F3IA 5HRWA 5KU3A 1JSPB 3QZVA 5CRZA 4GPJA 5L99A 3TLPA 4A9NA 3Q2FA 4UIZA 3U5LA 3ONIA 5EPSA 3AQAA 4NUDA 4MR4A 5IGMA 4A9IA 5H85A 5EGUA 4NYXA 4O7CA 4J0RA 5L97A 2D82A 5FFYA 4A9MA 5IGNA 4BHWA 1EQFA 4YH3A 5FE2A 3P1DA 5CUEA 5E74A 5FG4A 2I7KA 5F36A 4QSQA 5ENGA 4XUAA 2R0VA 5IIDA 4YH4A 5AMFA 4LYIA 4J3IA 3LQIA 5I1QA 4QYDA 5EM3A 3UVYA 5DW1A 3FKMX 4NR7A 4HXKA 5C4QA 5F25A 2RNXA 4YBTA 4QSPA 5HFRA 1F68A 2L84A 4MEOA 4QEVA 5DFDA 5IGKA 5I7XA 5LKTA 3UVDA 5BT5A 4C66A 4IR5A 3K2JA 4CFLA 4NRAA 5L8TA 4CUTA 4YYMA 4NR6A 2OUOA 4BW3A 5EU1A 5LUUA 4UITA 4LZRA 2R10A 4TT4A 4QYLA 4A9FA 5DYXA 3MB4A 4HBXA 4WHUA 4HXMA 4YAXA 5F61A 3HMHA 5A82A 5FE8A 5CGPA 5DBMA 3O37A 4HBVA 5EV9A 5A5RA 3S91A 5D3LA 3UV4A 2E7OA 4AKNA 5A5OA 4NR5A 5F1HA 5COIA 4LYWA 4Z1QA 5DKHA 5EQ1A 5LKZA 3MXFA 2WP2A 5H1UA 3SVGA 4CUQA 4CUPA 5C89A 4MEQA 4MR6A 4PY6A 4Y03A 4IOOA 5FE0A 2F6JA 4LRGA 3O33A 4YYJA 5CUCA 4TU6A 4TZ2A 4Z93A 4QUTA 5A85A 5F63A 4O72A 5FH8A 3LXJA 5HENA 5F60A 2H60A 4WHWA 5E9LA 5II2A 5FG5A 3U5NA 5A5SA 2G4AA 5FE6A 2R0SA 2YQDA 3MQMA 4HXRA 4NR4A 2RO1A 5CUAA 5CRMA 4O7AA 4UYFA 5JWMA 4YBSA 4QEUA 3G0LA 3P1EA 3U5KA 3GG3A 5C8GA 2WP1A 4IR4A 4XY9A 5A81A 4CUSA 3JVMA 3P1CA 4QSXA 4YY6A 5AD3A 5FH7A 3SVHA 4O77A 5LVQA 2RS9B 4NYWA 5A5QA 5CUBA 4QEWA 5HRVA 1WUGA 3P1FA 5HJCA 4N4HA 5BT3A 5HELA 3RCWA 3U5OA 4QNSA 5LKXA 2NXBA 5E9MA 4QR3A 4Z6HA 4UYGA 5C85A 2DVVA 3QZSA 5E3GA 4IR3A 5FE7A 5FB0A 5AMEA 5KTUA 2FSAA 5LKUA 2RNWA 5D24A 4HXOA 5IGLA 4WIVA 5D7XA 5LJ1A 3G0JA 5HCLA 5A7CA 4UYHA 4YYHA 5H1VA 4MENA 4UIVA 4YYIA 5DYCA 2D9EA 5ENCA 4ALGA 5L8UA 3SVFA 5H1TA 5DLXA 5HM0A 5D3RA 5JI8A 4PCIA 4QR5A 4YATA 5E9IA 5L96A 2DVSA 4J0SA 5F62A 4O74A 5D3TA 4QUUA 5CP5A 4Q0OA 3S92A 4MR3A 2YYNA 4TT6A 3UV2A 4A9KA 4TTEA 5D3PA 4CFKA 4QSTA 5EP7A 4IR6A 5CQ3A 5BT4A 3P5OA 5ENHA 5L98A 4E96A 4QZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENF A;  4HBY A;  4X2I A;  4CL9 A;  5E0R A;  5DKC A;  3JVL A;  5DYU A;  5LJ0 A;  5FE3 A;  5I88 A;  5HRX A;  5FB1 A;  5EI4 A;  5HQ5 A;  5KO4 A;  4CUU A;  4QSW A;  4UYF B;  4CLB A;  4OUF A;  5FE9 A;  4LDF A;  1JM4 B;  4HXS A;  4FLP A;  4NS5 A;  4NYV A;  2YDW A;  4IOR A;  4KCX A;  3NXB A;  5ENB A;  4N4F A;  5ETD A;  4YBM A;  5FDZ A;  5HQ7 A;  3HME A;  3O36 A;  2OSS A;  5CPE A;  4HXP A;  4QSV A;  5CU8 A;  4A9E A;  4Z6I A;  5D3H A;  4IOQ A;  4BW1 A;  2YEM A;  5G4S A;  5J0D A;  4A9O A;  4NXJ A;  4ZW1 A;  5DX4 A;  2I8N A;  4O76 A;  3UVW A;  3UV5 A;  4O78 A;  3O34 A;  3QZT A;  4UIW A;  5HLS A;  3HMF A;  5F3A A;  4DON A;  5EK9 A;  4NRC A;  5IG6 A;  2OO1 A;  4MR5 A;  5I80 A;  2LSP B;  4YC9 A;  5I7Y A;  4ALH A;  5E73 A;  4O7F A;  4O71 A;  4KV1 A;  5DFC A;  5CZG A;  5G4R A;  4YY4 A;  5C7N A;  4BW4 A;  4N3W A;  5CQ7 A;  2RFJ A;  4XUB A;  3AAD A;  3UW9 A;  4YYN A;  4Z1S A;  3MUL A;  4Q0N A;  5KHM A;  3LJW A;  4C67 A;  4PCE A;  4NR8 A;  4XYA A;  5CTL A;  5D25 A;  4YYD A;  5C87 A;  5CQA A;  4QB3 A;  5I29 A;  2KTB B;  4YYK A;  2DVR A;  5DFB A;  4QC1 A;  5ENE A;  4TQN A;  4NUC A;  5HFQ A;  4TU4 A;  3MUK A;  1N72 A;  5ENI A;  5EWD A;  4QY4 A;  4LYS A;  5EIS A;  5FE4 A;  4HXN A;  5I86 A;  4UYD A;  3LQH A;  5FFW A;  5E3D A;  5FFV A;  3DWY A;  3O35 A;  4NUE A;  4YK0 A;  1ZS5 A;  2N9G A;  4J1P A;  5CFW A;  4XY8 A;  5A83 A;  2DWW A;  4MEP A;  5D26 A;  5E7D A;  5EWW A;  2E7N A;  3D7C A;  5EA1 A;  4O70 A;  4BW2 A;  2DVQ A;  5HQ6 A;  5I83 A;  2YEL A;  5E9Y A;  5DW2 A;  5ACY A;  5EWH A;  4PS5 A;  5HEM A;  3JVJ A;  4PTB A;  3IU5 A;  5E9K A;  3LQJ A;  5A5P A;  1X0J A;  3IU6 A;  4NRB A;  3U5P A;  4A9H A;  2GRC A;  5CY9 A;  4KV4 A;  2RNY A;  5CQ6 A;  4UIU A;  4RVR A;  4QC3 A;  4UIX A;  4O7B A;  5EVA A;  5D0C A;  2YEK A;  5EWC A;  2RI7 A;  4ZQL A;  5KTW A;  3JVK A;  4ZC9 A;  4QBM A;  4N4I A;  5FBX A;  4UIY A;  5AD2 A;  5EIC A;  5D3J A;  3UVX A;  5D3N A;  4O75 A;  5KTX A;  4LR6 A;  4QR4 A;  5DYA A;  2DAT A;  5TCM A;  5D3S A;  3U5J A;  3MB3 A;  4A9L A;  5K29 A;  4LZ2 A;  4QSS A;  3Q2E A;  5DLZ A;  4NR9 A;  5CUG A;  1WUM A;  5LVR A;  4LC2 A;  5FG6 A;  5F2P A;  4TS8 A;  3DAI A;  4N4G A;  4A9J A;  3ZYU A;  5ETB A;  5FH6 A;  3U5M A;  1E6I A;  4LZS A;  4QSU A;  4TZ8 A;  5EWV A;  5F5Z A;  5TB6 A;  2R0Y A;  4UYE A;  5CQ8 A;  5CUD A;  4YAB A;  5CS8 A;  4YAD A;  5CQT A;  4QSR A;  5E9V A;  4HXL A;  4CUR A;  2L5E A;  5LJ2 A;  4NQM A;  5FE5 A;  2L85 A;  4TYL A;  5II1 A;  5I89 A;  5DKD A;  5F1L A;  2F6N A;  4TT2 A;  4NQN A;  4OGJ A;  5A5N A;  5I40 A;  3I3J A;  5IBN A;  5EPR A;  5ENJ A;  4O7E A;  2DKW A;  5CQ4 A;  5FE1 A;  4OGI A;  2YW5 A;  4BJX A;  4YYG A;  5CQ5 A;  4HBW A;  5DY7 A;  2E3K A;  5EPB A;  4PKL A;  2MJV B;  4F3I A;  5HRW A;  5KU3 A;  1JSP B;  3QZV A;  5CRZ A;  4GPJ A;  5L99 A;  3TLP A;  4A9N A;  3Q2F A;  4UIZ A;  3U5L A;  3ONI A;  5EPS A;  3AQA A;  4NUD A;  4MR4 A;  5IGM A;  4A9I A;  5H85 A;  5EGU A;  4NYX A;  4O7C A;  4J0R A;  5L97 A;  2D82 A;  5FFY A;  4A9M A;  5IGN A;  4BHW A;  1EQF A;  4YH3 A;  5FE2 A;  3P1D A;  5CUE A;  5E74 A;  5FG4 A;  2I7K A;  5F36 A;  4QSQ A;  5ENG A;  4XUA A;  2R0V A;  5IID A;  4YH4 A;  5AMF A;  4LYI A;  4J3I A;  3LQI A;  5I1Q A;  4QYD A;  5EM3 A;  3UVY A;  5DW1 A;  3FKM X;  4NR7 A;  4HXK A;  5C4Q A;  5F25 A;  2RNX A;  4YBT A;  4QSP A;  5HFR A;  1F68 A;  2L84 A;  4MEO A;  4QEV A;  5DFD A;  5IGK A;  5I7X A;  5LKT A;  3UVD A;  5BT5 A;  4C66 A;  4IR5 A;  3K2J A;  4CFL A;  4NRA A;  5L8T A;  4CUT A;  4YYM A;  4NR6 A;  2OUO A;  4BW3 A;  5EU1 A;  5LUU A;  4UIT A;  4LZR A;  2R10 A;  4TT4 A;  4QYL A;  4A9F A;  5DYX A;  3MB4 A;  4HBX A;  4WHU A;  4HXM A;  4YAX A;  5F61 A;  3HMH A;  5A82 A;  5FE8 A;  5CGP A;  5DBM A;  3O37 A;  4HBV A;  5EV9 A;  5A5R A;  3S91 A;  5D3L A;  3UV4 A;  2E7O A;  4AKN A;  5A5O A;  4NR5 A;  5F1H A;  5COI A;  4LYW A;  4Z1Q A;  5DKH A;  5EQ1 A;  5LKZ A;  3MXF A;  2WP2 A;  5H1U A;  3SVG A;  4CUQ A;  4CUP A;  5C89 A;  4MEQ A;  4MR6 A;  4PY6 A;  4Y03 A;  4IOO A;  5FE0 A;  2F6J A;  4LRG A;  3O33 A;  4YYJ A;  5CUC A;  4TU6 A;  4TZ2 A;  4Z93 A;  4QUT A;  5A85 A;  5F63 A;  4O72 A;  5FH8 A;  3LXJ A;  5HEN A;  5F60 A;  2H60 A;  4WHW A;  5E9L A;  5II2 A;  5FG5 A;  3U5N A;  5A5S A;  2G4A A;  5FE6 A;  2R0S A;  2YQD A;  3MQM A;  4HXR A;  4NR4 A;  2RO1 A;  5CUA A;  5CRM A;  4O7A A;  4UYF A;  5JWM A;  4YBS A;  4QEU A;  3G0L A;  3P1E A;  3U5K A;  3GG3 A;  5C8G A;  2WP1 A;  4IR4 A;  4XY9 A;  5A81 A;  4CUS A;  3JVM A;  3P1C A;  4QSX A;  4YY6 A;  5AD3 A;  5FH7 A;  3SVH A;  4O77 A;  5LVQ A;  2RS9 B;  4NYW A;  5A5Q A;  5CUB A;  4QEW A;  5HRV A;  1WUG A;  3P1F A;  5HJC A;  4N4H A;  5BT3 A;  5HEL A;  3RCW A;  3U5O A;  4QNS A;  5LKX A;  2NXB A;  5E9M A;  4QR3 A;  4Z6H A;  4UYG A;  5C85 A;  2DVV A;  3QZS A;  5E3G A;  4IR3 A;  5FE7 A;  5FB0 A;  5AME A;  5KTU A;  2FSA A;  5LKU A;  2RNW A;  5D24 A;  4HXO A;  5IGL A;  4WIV A;  5D7X A;  5LJ1 A;  3G0J A;  5HCL A;  5A7C A;  4UYH A;  4YYH A;  5H1V A;  4MEN A;  4UIV A;  4YYI A;  5DYC A;  2D9E A;  5ENC A;  4ALG A;  5L8U A;  3SVF A;  5H1T A;  5DLX A;  5HM0 A;  5D3R A;  5JI8 A;  4PCI A;  4QR5 A;  4YAT A;  5E9I A;  5L96 A;  2DVS A;  4J0S A;  5F62 A;  4O74 A;  5D3T A;  4QUU A;  5CP5 A;  4Q0O A;  3S92 A;  4MR3 A;  2YYN A;  4TT6 A;  3UV2 A;  4A9K A;  4TTE A;  5D3P A;  4CFK A;  4QST A;  5EP7 A;  4IR6 A;  5CQ3 A;  5BT4 A;  3P5O A;  5ENH A;  5L98 A;  4E96 A;  4QZS A; 
#chains in the Genus database with same CATH topology
 5ENF A;  4HBY A;  4X2I A;  4CL9 A;  5E0R A;  5DKC A;  3JVL A;  5DYU A;  5LJ0 A;  5FE3 A;  5I88 A;  5HRX A;  5FB1 A;  5EI4 A;  5HQ5 A;  5KO4 A;  4CUU A;  4QSW A;  4UYF B;  4CLB A;  4OUF A;  5FE9 A;  4LDF A;  1JM4 B;  4HXS A;  4FLP A;  4NS5 A;  4NYV A;  2YDW A;  4IOR A;  4KCX A;  3NXB A;  5ENB A;  4N4F A;  5ETD A;  4YBM A;  5FDZ A;  5HQ7 A;  3HME A;  3O36 A;  2OSS A;  5CPE A;  4HXP A;  4QSV A;  5CU8 A;  4A9E A;  4Z6I A;  5D3H A;  4IOQ A;  4BW1 A;  2YEM A;  5G4S A;  5J0D A;  4A9O A;  4NXJ A;  4ZW1 A;  5DX4 A;  2I8N A;  4O76 A;  3UVW A;  3UV5 A;  4O78 A;  3O34 A;  3QZT A;  4UIW A;  5HLS A;  3HMF A;  5F3A A;  4DON A;  5EK9 A;  4NRC A;  5IG6 A;  2OO1 A;  4MR5 A;  5I80 A;  2LSP B;  4YC9 A;  5I7Y A;  4ALH A;  5E73 A;  4O7F A;  4O71 A;  4KV1 A;  5DFC A;  5CZG A;  5G4R A;  4YY4 A;  5C7N A;  4BW4 A;  4N3W A;  5CQ7 A;  2RFJ A;  4XUB A;  3AAD A;  3UW9 A;  4YYN A;  4Z1S A;  3MUL A;  4Q0N A;  5KHM A;  3LJW A;  4C67 A;  4PCE A;  4NR8 A;  4XYA A;  5CTL A;  5D25 A;  4YYD A;  5C87 A;  5CQA A;  4QB3 A;  5I29 A;  2KTB B;  4YYK A;  2DVR A;  5DFB A;  4QC1 A;  5ENE A;  4TQN A;  4NUC A;  5HFQ A;  4TU4 A;  3MUK A;  1N72 A;  5ENI A;  5EWD A;  4QY4 A;  4LYS A;  5EIS A;  5FE4 A;  4HXN A;  5I86 A;  4UYD A;  3LQH A;  5FFW A;  5E3D A;  5FFV A;  3DWY A;  3O35 A;  4NUE A;  4YK0 A;  1ZS5 A;  2N9G A;  4J1P A;  5CFW A;  4XY8 A;  5A83 A;  2DWW A;  4MEP A;  5D26 A;  5E7D A;  5EWW A;  2E7N A;  3D7C A;  5EA1 A;  3VKG A;  4O70 A;  4BW2 A;  2DVQ A;  5HQ6 A;  5I83 A;  2YEL A;  5E9Y A;  5DW2 A;  5ACY A;  5EWH A;  4PS5 A;  5HEM A;  3JVJ A;  4PTB A;  3IU5 A;  5E9K A;  3LQJ A;  5A5P A;  1X0J A;  3IU6 A;  4NRB A;  3U5P A;  4A9H A;  2GRC A;  5CY9 A;  4KV4 A;  2RNY A;  5CQ6 A;  4UIU A;  4RVR A;  4QC3 A;  4UIX A;  4O7B A;  5EVA A;  5D0C A;  2YEK A;  5EWC A;  2RI7 A;  4ZQL A;  5KTW A;  3JVK A;  4ZC9 A;  4QBM A;  4N4I A;  5FBX A;  4UIY A;  5AD2 A;  5EIC A;  5D3J A;  3UVX A;  5D3N A;  4O75 A;  5KTX A;  4LR6 A;  4QR4 A;  5DYA A;  2DAT A;  5TCM A;  5D3S A;  3U5J A;  3MB3 A;  4A9L A;  5K29 A;  4LZ2 A;  4QSS A;  3Q2E A;  5DLZ A;  4NR9 A;  5CUG A;  1WUM A;  5LVR A;  4LC2 A;  5FG6 A;  5F2P A;  4TS8 A;  3DAI A;  4N4G A;  4A9J A;  3ZYU A;  5ETB A;  5FH6 A;  3U5M A;  1E6I A;  4LZS A;  4QSU A;  4TZ8 A;  5EWV A;  5F5Z A;  5TB6 A;  2R0Y A;  4UYE A;  5CQ8 A;  5CUD A;  4YAB A;  5CS8 A;  4YAD A;  5CQT A;  4QSR A;  5E9V A;  4HXL A;  4CUR A;  2L5E A;  5LJ2 A;  4NQM A;  5FE5 A;  2L85 A;  4TYL A;  5II1 A;  5I89 A;  5DKD A;  5F1L A;  2F6N A;  4TT2 A;  4NQN A;  4OGJ A;  5A5N A;  5I40 A;  3I3J A;  5IBN A;  5EPR A;  5ENJ A;  4O7E A;  2DKW A;  5CQ4 A;  5FE1 A;  4OGI A;  2YW5 A;  4BJX A;  4YYG A;  5CQ5 A;  4HBW A;  5DY7 A;  2E3K A;  5EPB A;  4PKL A;  2MJV B;  4F3I A;  5HRW A;  5KU3 A;  1JSP B;  3QZV A;  5CRZ A;  3D1B A;  4GPJ A;  5L99 A;  3TLP A;  4A9N A;  3Q2F A;  4UIZ A;  3U5L A;  3ONI A;  5EPS A;  3AQA A;  4NUD A;  4MR4 A;  5IGM A;  4A9I A;  5H85 A;  4AKH A;  5EGU A;  4NYX A;  4O7C A;  4J0R A;  5L97 A;  2D82 A;  5FFY A;  4A9M A;  5IGN A;  4BHW A;  1EQF A;  4YH3 A;  5FE2 A;  3P1D A;  5CUE A;  5E74 A;  5FG4 A;  2I7K A;  5F36 A;  4QSQ A;  5ENG A;  4XUA A;  2R0V A;  5IID A;  4YH4 A;  5AMF A;  4LYI A;  3D1D A;  4J3I A;  3LQI A;  5I1Q A;  4QYD A;  5EM3 A;  3UVY A;  5DW1 A;  3FKM X;  4NR7 A;  4HXK A;  5C4Q A;  5F25 A;  2RNX A;  4YBT A;  4QSP A;  5HFR A;  1F68 A;  2L84 A;  4MEO A;  4QEV A;  5DFD A;  5IGK A;  5I7X A;  5LKT A;  3UVD A;  5BT5 A;  4C66 A;  4IR5 A;  3K2J A;  4CFL A;  4NRA A;  5L8T A;  4CUT A;  4YYM A;  4NR6 A;  2OUO A;  4BW3 A;  5EU1 A;  5LUU A;  4UIT A;  4LZR A;  2R10 A;  4TT4 A;  4QYL A;  4A9F A;  5DYX A;  3MB4 A;  4HBX A;  4WHU A;  4HXM A;  3ERR A;  4YAX A;  5F61 A;  3HMH A;  5A82 A;  5FE8 A;  5CGP A;  5DBM A;  3O37 A;  4HBV A;  5EV9 A;  5A5R A;  3S91 A;  5D3L A;  3UV4 A;  2E7O A;  4AKN A;  5A5O A;  4NR5 A;  5F1H A;  5COI A;  4LYW A;  4Z1Q A;  5DKH A;  5EQ1 A;  5LKZ A;  3MXF A;  2WP2 A;  5H1U A;  3SVG A;  2EJN A;  4CUQ A;  4CUP A;  5C89 A;  4MEQ A;  4MR6 A;  4PY6 A;  4Y03 A;  4IOO A;  5FE0 A;  4AKI A;  2F6J A;  4LRG A;  3O33 A;  4YYJ A;  5CUC A;  4AKG A;  4TU6 A;  4TZ2 A;  1ZKR A;  4Z93 A;  4QUT A;  5A85 A;  5F63 A;  1PUO A;  4O72 A;  5FH8 A;  3LXJ A;  5HEN A;  5F60 A;  2H60 A;  4WHW A;  5E9L A;  5II2 A;  5FG5 A;  3U5N A;  5A5S A;  2G4A A;  5FE6 A;  2R0S A;  2YQD A;  3MQM A;  4HXR A;  4NR4 A;  2RO1 A;  5CUA A;  5CRM A;  4O7A A;  4UYF A;  5JWM A;  4YBS A;  4QEU A;  3G0L A;  3P1E A;  3U5K A;  3GG3 A;  5C8G A;  2WP1 A;  4IR4 A;  4XY9 A;  5A81 A;  4CUS A;  3JVM A;  3P1C A;  4AI6 A;  4QSX A;  4YY6 A;  5AD3 A;  5FH7 A;  3SVH A;  4O77 A;  5LVQ A;  2RS9 B;  4NYW A;  5A5Q A;  5CUB A;  4QEW A;  5HRV A;  1WUG A;  3P1F A;  5HJC A;  4N4H A;  5BT3 A;  5HEL A;  3RCW A;  3U5O A;  4QNS A;  5LKX A;  2NXB A;  5E9M A;  4QR3 A;  4Z6H A;  4UYG A;  5C85 A;  2DVV A;  3QZS A;  5E3G A;  4IR3 A;  5FE7 A;  5FB0 A;  5AME A;  5KTU A;  2FSA A;  5LKU A;  2RNW A;  5D24 A;  4HXO A;  5IGL A;  4WIV A;  5D7X A;  5LJ1 A;  3G0J A;  5HCL A;  5A7C A;  4UYH A;  4YYH A;  5H1V A;  4MEN A;  4UIV A;  4YYI A;  5DYC A;  2D9E A;  5ENC A;  4ALG A;  5L8U A;  3SVF A;  5H1T A;  3VKH A;  5DLX A;  5HM0 A;  5D3R A;  5JI8 A;  4PCI A;  4QR5 A;  4YAT A;  5E9I A;  5L96 A;  2DVS A;  4J0S A;  5F62 A;  4O74 A;  5D3T A;  4QUU A;  5CP5 A;  4Q0O A;  3S92 A;  4MR3 A;  2YYN A;  4TT6 A;  3UV2 A;  4A9K A;  4TTE A;  5D3P A;  4CFK A;  4QST A;  5EP7 A;  4IR6 A;  5CQ3 A;  5BT4 A;  3P5O A;  5ENH A;  5L98 A;  4E96 A;  4QZS A; 
#chains in the Genus database with same CATH homology
 5ENF A;  4HBY A;  4X2I A;  4CL9 A;  5E0R A;  5DKC A;  3JVL A;  5DYU A;  5LJ0 A;  5FE3 A;  5I88 A;  5HRX A;  5FB1 A;  5EI4 A;  5HQ5 A;  5KO4 A;  4CUU A;  4QSW A;  4UYF B;  4CLB A;  4OUF A;  5FE9 A;  4LDF A;  1JM4 B;  4HXS A;  4FLP A;  4NS5 A;  4NYV A;  2YDW A;  4IOR A;  4KCX A;  3NXB A;  5ENB A;  4N4F A;  5ETD A;  4YBM A;  5FDZ A;  5HQ7 A;  3HME A;  3O36 A;  2OSS A;  5CPE A;  4HXP A;  4QSV A;  5CU8 A;  4A9E A;  4Z6I A;  5D3H A;  4IOQ A;  4BW1 A;  2YEM A;  5G4S A;  5J0D A;  4A9O A;  4NXJ A;  4ZW1 A;  5DX4 A;  2I8N A;  4O76 A;  3UVW A;  3UV5 A;  4O78 A;  3O34 A;  3QZT A;  4UIW A;  5HLS A;  3HMF A;  5F3A A;  4DON A;  5EK9 A;  4NRC A;  5IG6 A;  2OO1 A;  4MR5 A;  5I80 A;  2LSP B;  4YC9 A;  5I7Y A;  4ALH A;  5E73 A;  4O7F A;  4O71 A;  4KV1 A;  5DFC A;  5CZG A;  5G4R A;  4YY4 A;  5C7N A;  4BW4 A;  4N3W A;  5CQ7 A;  2RFJ A;  4XUB A;  3AAD A;  3UW9 A;  4YYN A;  4Z1S A;  3MUL A;  4Q0N A;  5KHM A;  3LJW A;  4C67 A;  4PCE A;  4NR8 A;  4XYA A;  5CTL A;  5D25 A;  4YYD A;  5C87 A;  5CQA A;  4QB3 A;  5I29 A;  2KTB B;  4YYK A;  2DVR A;  5DFB A;  4QC1 A;  5ENE A;  4TQN A;  4NUC A;  5HFQ A;  4TU4 A;  3MUK A;  1N72 A;  5ENI A;  5EWD A;  4QY4 A;  4LYS A;  5EIS A;  5FE4 A;  4HXN A;  5I86 A;  4UYD A;  3LQH A;  5FFW A;  5E3D A;  5FFV A;  3DWY A;  3O35 A;  4NUE A;  4YK0 A;  1ZS5 A;  2N9G A;  4J1P A;  5CFW A;  4XY8 A;  5A83 A;  2DWW A;  4MEP A;  5D26 A;  5E7D A;  5EWW A;  2E7N A;  3D7C A;  5EA1 A;  4O70 A;  4BW2 A;  2DVQ A;  5HQ6 A;  5I83 A;  2YEL A;  5E9Y A;  5DW2 A;  5ACY A;  5EWH A;  4PS5 A;  5HEM A;  3JVJ A;  4PTB A;  3IU5 A;  5E9K A;  3LQJ A;  5A5P A;  1X0J A;  3IU6 A;  4NRB A;  3U5P A;  4A9H A;  2GRC A;  5CY9 A;  4KV4 A;  2RNY A;  5CQ6 A;  4UIU A;  4RVR A;  4QC3 A;  4UIX A;  4O7B A;  5EVA A;  5D0C A;  2YEK A;  5EWC A;  2RI7 A;  4ZQL A;  5KTW A;  3JVK A;  4ZC9 A;  4QBM A;  4N4I A;  5FBX A;  4UIY A;  5AD2 A;  5EIC A;  5D3J A;  3UVX A;  5D3N A;  4O75 A;  5KTX A;  4LR6 A;  4QR4 A;  5DYA A;  2DAT A;  5TCM A;  5D3S A;  3U5J A;  3MB3 A;  4A9L A;  5K29 A;  4LZ2 A;  4QSS A;  3Q2E A;  5DLZ A;  4NR9 A;  5CUG A;  1WUM A;  5LVR A;  4LC2 A;  5FG6 A;  5F2P A;  4TS8 A;  3DAI A;  4N4G A;  4A9J A;  3ZYU A;  5ETB A;  5FH6 A;  3U5M A;  1E6I A;  4LZS A;  4QSU A;  4TZ8 A;  5EWV A;  5F5Z A;  5TB6 A;  2R0Y A;  4UYE A;  5CQ8 A;  5CUD A;  4YAB A;  5CS8 A;  4YAD A;  5CQT A;  4QSR A;  5E9V A;  4HXL A;  4CUR A;  2L5E A;  5LJ2 A;  4NQM A;  5FE5 A;  2L85 A;  4TYL A;  5II1 A;  5I89 A;  5DKD A;  5F1L A;  2F6N A;  4TT2 A;  4NQN A;  4OGJ A;  5A5N A;  5I40 A;  3I3J A;  5IBN A;  5EPR A;  5ENJ A;  4O7E A;  2DKW A;  5CQ4 A;  5FE1 A;  4OGI A;  2YW5 A;  4BJX A;  4YYG A;  5CQ5 A;  4HBW A;  5DY7 A;  2E3K A;  5EPB A;  4PKL A;  2MJV B;  4F3I A;  5HRW A;  5KU3 A;  1JSP B;  3QZV A;  5CRZ A;  4GPJ A;  5L99 A;  3TLP A;  4A9N A;  3Q2F A;  4UIZ A;  3U5L A;  3ONI A;  5EPS A;  3AQA A;  4NUD A;  4MR4 A;  5IGM A;  4A9I A;  5H85 A;  5EGU A;  4NYX A;  4O7C A;  4J0R A;  5L97 A;  2D82 A;  5FFY A;  4A9M A;  5IGN A;  4BHW A;  1EQF A;  4YH3 A;  5FE2 A;  3P1D A;  5CUE A;  5E74 A;  5FG4 A;  2I7K A;  5F36 A;  4QSQ A;  5ENG A;  4XUA A;  2R0V A;  5IID A;  4YH4 A;  5AMF A;  4LYI A;  4J3I A;  3LQI A;  5I1Q A;  4QYD A;  5EM3 A;  3UVY A;  5DW1 A;  3FKM X;  4NR7 A;  4HXK A;  5C4Q A;  5F25 A;  2RNX A;  4YBT A;  4QSP A;  5HFR A;  1F68 A;  2L84 A;  4MEO A;  4QEV A;  5DFD A;  5IGK A;  5I7X A;  5LKT A;  3UVD A;  5BT5 A;  4C66 A;  4IR5 A;  3K2J A;  4CFL A;  4NRA A;  5L8T A;  4CUT A;  4YYM A;  4NR6 A;  2OUO A;  4BW3 A;  5EU1 A;  5LUU A;  4UIT A;  4LZR A;  2R10 A;  4TT4 A;  4QYL A;  4A9F A;  5DYX A;  3MB4 A;  4HBX A;  4WHU A;  4HXM A;  4YAX A;  5F61 A;  3HMH A;  5A82 A;  5FE8 A;  5CGP A;  5DBM A;  3O37 A;  4HBV A;  5EV9 A;  5A5R A;  3S91 A;  5D3L A;  3UV4 A;  2E7O A;  4AKN A;  5A5O A;  4NR5 A;  5F1H A;  5COI A;  4LYW A;  4Z1Q A;  5DKH A;  5EQ1 A;  5LKZ A;  3MXF A;  2WP2 A;  5H1U A;  3SVG A;  4CUQ A;  4CUP A;  5C89 A;  4MEQ A;  4MR6 A;  4PY6 A;  4Y03 A;  4IOO A;  5FE0 A;  2F6J A;  4LRG A;  3O33 A;  4YYJ A;  5CUC A;  4TU6 A;  4TZ2 A;  4Z93 A;  4QUT A;  5A85 A;  5F63 A;  4O72 A;  5FH8 A;  3LXJ A;  5HEN A;  5F60 A;  2H60 A;  4WHW A;  5E9L A;  5II2 A;  5FG5 A;  3U5N A;  5A5S A;  2G4A A;  5FE6 A;  2R0S A;  2YQD A;  3MQM A;  4HXR A;  4NR4 A;  2RO1 A;  5CUA A;  5CRM A;  4O7A A;  4UYF A;  5JWM A;  4YBS A;  4QEU A;  3G0L A;  3P1E A;  3U5K A;  3GG3 A;  5C8G A;  2WP1 A;  4IR4 A;  4XY9 A;  5A81 A;  4CUS A;  3JVM A;  3P1C A;  4QSX A;  4YY6 A;  5AD3 A;  5FH7 A;  3SVH A;  4O77 A;  5LVQ A;  2RS9 B;  4NYW A;  5A5Q A;  5CUB A;  4QEW A;  5HRV A;  1WUG A;  3P1F A;  5HJC A;  4N4H A;  5BT3 A;  5HEL A;  3RCW A;  3U5O A;  4QNS A;  5LKX A;  2NXB A;  5E9M A;  4QR3 A;  4Z6H A;  4UYG A;  5C85 A;  2DVV A;  3QZS A;  5E3G A;  4IR3 A;  5FE7 A;  5FB0 A;  5AME A;  5KTU A;  2FSA A;  5LKU A;  2RNW A;  5D24 A;  4HXO A;  5IGL A;  4WIV A;  5D7X A;  5LJ1 A;  3G0J A;  5HCL A;  5A7C A;  4UYH A;  4YYH A;  5H1V A;  4MEN A;  4UIV A;  4YYI A;  5DYC A;  2D9E A;  5ENC A;  4ALG A;  5L8U A;  3SVF A;  5H1T A;  5DLX A;  5HM0 A;  5D3R A;  5JI8 A;  4PCI A;  4QR5 A;  4YAT A;  5E9I A;  5L96 A;  2DVS A;  4J0S A;  5F62 A;  4O74 A;  5D3T A;  4QUU A;  5CP5 A;  4Q0O A;  3S92 A;  4MR3 A;  2YYN A;  4TT6 A;  3UV2 A;  4A9K A;  4TTE A;  5D3P A;  4CFK A;  4QST A;  5EP7 A;  4IR6 A;  5CQ3 A;  5BT4 A;  3P5O A;  5ENH A;  5L98 A;  4E96 A;  4QZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...