5II2A

Crystal structure of the fifth bromodomain of human polybromo (pb1) in complex with 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4h-chromen-4-one
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Discovery and Optimization of a Selective Ligand for the Switch/Sucrose Nonfermenting-Related Bromodomains of Polybromo Protein-1 by the Use of Virtual Screening and Hydration Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ii2A00
4QR4A 4ZC9A 4QUUA 5ETDA 4TT6A 5EVAA 2RNXA 4BJXA 2RNWA 4O74A 2E3KA 2KTBB 5A5PA 2FSAA 5C85A 5D25A 3D7CA 1JSPB 3P5OA 5ACYA 4UITA 3Q2EA 4QEWA 5A85A 5A5OA 4O7CA 5A5QA 5A5NA 4YYNA 5E0RA 5DYUA 5KO4A 1X0JA 2L85A 2WP2A 4BW4A 5D3TA 4QY4A 4MEOA 4QUTA 4ZQLA 5HRVA 5K29A 3Q2FA 4QEUA 5E74A 4HBVA 5DX4A 2RI7A 4QB3A 4Z93A 3HMEA 3QZTA 5FFWA 2L84A 3IU6A 4HXOA 2D82A 3UW9A 4IOOA 4QSXA 5FDZA 4HXLA 5FH6A 5L8TA 5D0CA 4QYDA 4BW3A 5LJ2A 5I29A 4CFLA 4TTEA 3UVWA 2DVRA 4QSUA 5H1UA 4UIVA 5H85A 4O7EA 4XUBA 5CP5A 5CQ7A 3UVYA 4UIWA 2G4AA 4YBMA 2YYNA 5EWDA 5ENFA 4A9KA 3P1FA 5F5ZA 5EWHA 2NXBA 5G4SA 3ZYUA 4KV4A 4J3IA 5BT3A 5L99A 4YH4A 2R0VA 4O76A 4NRBA 2E7NA 5ENGA 4NQNA 4TS8A 3LQIA 2D9EA 4NUEA 2YELA 4LZRA 3JVJA 5D3RA 2E7OA 3LQJA 5CUDA 4TT4A 5E9VA 5L96A 3O35A 4YY6A 4YYGA 5HM0A 4MENA 5HQ6A 4QR3A 5FE7A 4HBYA 5CFWA 1N72A 4NR4A 5KTUA 5A81A 3MB4A 2YEMA 3MUKA 5CRMA 5ENBA 4HXRA 4PY6A 4LRGA 4X2IA 5EV9A 4A9HA 5TCMA 4O78A 2DKWA 5LKXA 5CRZA 3QZSA 4WIVA 5DLXA 5FBXA 5I1QA 4QC1A 5BT5A 4Z1SA 4O72A 2DATA 5I7XA 4YYHA 4CUTA 4YBSA 5F2PA 5H1VA 4BW1A 4A9FA 5CUCA 5EP7A 5H1TA 4Y03A 5KU3A 5FB0A 4XY9A 3MULA 1F68A 4MR6A 3P1DA 4O77A 4MR4A 5HRWA 4UYHA 4ALGA 4F3IA 4TU6A 4QZSA 4NXJA 3RCWA 4UIYA 5E9KA 5EICA 5LVRA 2OSSA 4TQNA 1EQFA 4PCIA 5DW2A 5D26A 4UYFB 5FE9A 4QSQA 4O7BA 4NRAA 2R0SA 3MQMA 4IORA 4NR5A 3P1EA 4HBWA 4J0RA 4O71A 5IGKA 5CQ8A 5FG4A 5ENCA 4QNSA 2I7KA 3AADA 3DWYA 2RS9B 5DYCA 5EGUA 4HXPA 3ONIA 2OUOA 4MR3A 5E9MA 5II1A 4E96A 4NRCA 4PCEA 4UYEA 2DVVA 3LJWA 4LYWA 5AD2A 3MXFA 2N9GA 4OUFA 5FE4A 4N4HA 4NUCA 5DYAA 5I88A 5FH8A 5AD3A 4HXKA 5A5SA 2R0YA 4Q0NA 5IG6A 5F60A 3K2JA 1WUMA 4UYFA 1WUGA 5E7DA 5CS8A 2DVSA 5I83A 5CQTA 4UIZA 2WP1A 4QBMA 5EI4A 4CUQA 5I80A 4YYJA 5DKCA 3HMHA 4NUDA 3S91A 5E3GA 4NR6A 5CTLA 5F62A 4UIXA 5LKUA 4OGIA 3O36A 5I7YA 4O7FA 3IU5A 5I40A 3O37A 5D7XA 4O7AA 5LJ1A 5HQ7A 4FLPA 5HEMA 3FKMX 5F1HA 5HJCA 4CUSA 5I89A 5ENIA 5IBNA 5J0DA 4NS5A 4YADA 4N4FA 4DONA 5C87A 4J1PA 5CGPA 5DBMA 3U5NA 3U5KA 3NXBA 3SVFA 5CQ4A 3U5JA 4BHWA 5F3AA 4N4IA 3U5PA 4CL9A 5DLZA 3SVGA 5FFVA 4QSSA 5D3HA 5FB1A 5FE3A 4MEQA 4TT2A 5EM3A 2GRCA 5CZGA 1E6IA 5D3PA 4YYKA 4QR5A 5A5RA 5C89A 5F1LA 4QC3A 2YDWA 2RNYA 4ZW1A 5HRXA 5C8GA 5EPSA 4YATA 4TZ2A 5FE5A 5DW1A 4TZ8A 5ENEA 4C67A 4YH3A 5TB6A 3P1CA 4MR5A 4NR7A 3AQAA 4NR8A 5D3LA 5E3DA 5E73A 5IGNA 5A7CA 3G0JA 5FE2A 3LQHA 4LR6A 4XUAA 4PS5A 5D3SA 5EPRA 5FG6A 5EISA 5II2A 4CURA 3G0LA 5C4QA 4NYXA 4IR6A 4MEPA 5E9YA 5ENJA 4NYWA 5HELA 5CUGA 5L98A 4YK0A 4AKNA 5EPBA 5L97A 5G4RA 5BT4A 5CQ3A 5D3JA 5FE6A 5C7NA 3DAIA 4CFKA 5KHMA 4YYDA 4A9LA 4XY8A 4N4GA 5FE1A 4QSVA 4WHUA 4KV1A 5IGLA 3S92A 4TU4A 4CUUA 2YQDA 4YBTA 4BW2A 4NR9A 5E9IA 4XYAA 4QSWA 3QZVA 2F6NA 5EWWA 5LUUA 5IGMA 4LZ2A 4YABA 4HXSA 5E9LA 4OGJA 4C66A 5EU1A 4LZSA 2RO1A 5LJ0A 4Z6IA 3TLPA 4YC9A 4LC2A 2DWWA 5IIDA 5FH7A 4GPJA 4N3WA 4NYVA 4Q0OA 2DVQA 3SVHA 4QYLA 4LYIA 5HENA 4CLBA 5KTWA 5CQ5A 5DY7A 4QSRA 5KTXA 5D24A 2MJVB 2I8NA 5D3NA 2H60A 4LYSA 5FG5A 4KCXA 5CY9A 4YYIA 5DFDA 5HQ5A 4UIUA 4QEVA 3JVMA 5DKDA 4PKLA 3UVXA 3I3JA 5DYXA 5EQ1A 4QSPA 4QSTA 5CUBA 5F63A 3U5OA 5F36A 4YYMA 5EWVA 3UVDA 5CUAA 5DFBA 5JI8A 5JWMA 4A9EA 3U5MA 4HXMA 2YEKA 5L8UA 5LKTA 4UYGA 4A9OA 3U5LA 5EWCA 4O75A 2LSPB 4IR4A 3MB3A 4PTBA 5EK9A 5LKZA 5F25A 4CUPA 5ENHA 2L5EA 5HFRA 4WHWA 3UV4A 5CQ6A 5CUEA 3UV2A 5AMFA 4Z1QA 3O33A 3UV5A 5HLSA 5DKHA 4ALHA 3JVKA 4IR3A 2F6JA 2R10A 2RFJA 4YAXA 4A9IA 5HCLA 4HBXA 4IOQA 5CQAA 3O34A 5AMEA 4RVRA 5F61A 5DFCA 4J0SA 5CPEA 4YY4A 5A83A 4TYLA 4A9NA 4IR5A 1ZS5A 4LDFA 4O70A 5I86A 5FE8A 4Z6HA 5CU8A 5HFQA 2YW5A 4A9MA 3GG3A 5A82A 5COIA 5FE0A 3HMFA 3JVLA 4NQMA 3LXJA 5EA1A 5FFYA 5LVQA 1JM4B 2OO1A 5ETBA 4A9JA 4UYDA 4HXNA
chains in the Genus database with same CATH superfamily
4QR4A 4ZC9A 4QUUA 5ETDA 4TT6A 5EVAA 2RNXA 4BJXA 2RNWA 4O74A 2E3KA 2KTBB 5A5PA 2FSAA 5C85A 5D25A 3D7CA 1JSPB 3P5OA 5ACYA 4UITA 3Q2EA 4QEWA 5A85A 5A5OA 4O7CA 5A5QA 5A5NA 4YYNA 5E0RA 5DYUA 5KO4A 1X0JA 2L85A 2WP2A 4BW4A 5D3TA 4QY4A 4MEOA 4QUTA 4ZQLA 5HRVA 5K29A 3Q2FA 4QEUA 5E74A 4HBVA 5DX4A 2RI7A 4QB3A 4Z93A 3HMEA 3QZTA 5FFWA 2L84A 3IU6A 4HXOA 2D82A 3UW9A 4IOOA 4QSXA 5FDZA 4HXLA 5FH6A 5L8TA 5D0CA 4QYDA 4BW3A 5LJ2A 5I29A 4CFLA 4TTEA 3UVWA 2DVRA 4QSUA 5H1UA 4UIVA 5H85A 4O7EA 4XUBA 5CP5A 5CQ7A 3UVYA 4UIWA 2G4AA 4YBMA 2YYNA 5EWDA 5ENFA 4A9KA 3P1FA 5F5ZA 5EWHA 2NXBA 5G4SA 3ZYUA 4KV4A 4J3IA 5BT3A 5L99A 4YH4A 2R0VA 4O76A 4AI6A 4NRBA 2E7NA 5ENGA 4NQNA 4TS8A 3LQIA 2D9EA 3D1BA 4AKGA 4NUEA 2YELA 4LZRA 3JVJA 5D3RA 2E7OA 3LQJA 5CUDA 4TT4A 5E9VA 5L96A 3O35A 4YY6A 4YYGA 5HM0A 4MENA 5HQ6A 4QR3A 5FE7A 4HBYA 5CFWA 1N72A 4NR4A 5KTUA 5A81A 3MB4A 2YEMA 3MUKA 5CRMA 5ENBA 4HXRA 4PY6A 4LRGA 4X2IA 5EV9A 4A9HA 5TCMA 4O78A 2DKWA 5LKXA 5CRZA 3QZSA 4WIVA 5DLXA 5FBXA 5I1QA 4QC1A 5BT5A 4Z1SA 4O72A 2DATA 5I7XA 4YYHA 4CUTA 4YBSA 5F2PA 5H1VA 4BW1A 4A9FA 5CUCA 5EP7A 5H1TA 4Y03A 5KU3A 5FB0A 4XY9A 3MULA 1F68A 4MR6A 3P1DA 4O77A 4MR4A 5HRWA 4UYHA 4ALGA 4F3IA 4TU6A 4QZSA 4NXJA 3RCWA 4UIYA 5E9KA 5EICA 5LVRA 2OSSA 4TQNA 1EQFA 4PCIA 5DW2A 5D26A 4UYFB 5FE9A 4QSQA 4O7BA 4NRAA 3VKGA 2R0SA 3MQMA 4IORA 4NR5A 3P1EA 4HBWA 4J0RA 4O71A 5IGKA 5CQ8A 5FG4A 5ENCA 4QNSA 2I7KA 3AADA 3DWYA 2RS9B 5DYCA 5EGUA 4HXPA 3ONIA 2OUOA 4MR3A 5E9MA 5II1A 4E96A 4NRCA 4PCEA 4UYEA 2DVVA 3LJWA 4LYWA 5AD2A 3MXFA 2N9GA 4OUFA 5FE4A 4N4HA 4NUCA 5DYAA 5I88A 5FH8A 5AD3A 4HXKA 5A5SA 2R0YA 4Q0NA 5IG6A 5F60A 3K2JA 1WUMA 4UYFA 1WUGA 5E7DA 5CS8A 2DVSA 5I83A 5CQTA 4UIZA 2WP1A 4QBMA 5EI4A 4CUQA 5I80A 4YYJA 5DKCA 3HMHA 4NUDA 3S91A 3ERRA 5E3GA 4NR6A 5CTLA 5F62A 4UIXA 4AKIA 5LKUA 4OGIA 3O36A 5I7YA 4O7FA 3IU5A 5I40A 3O37A 5D7XA 4O7AA 5LJ1A 5HQ7A 4FLPA 5HEMA 3FKMX 5F1HA 5HJCA 4CUSA 5I89A 5ENIA 5IBNA 5J0DA 4NS5A 4YADA 4N4FA 4DONA 5C87A 4J1PA 5CGPA 5DBMA 3U5NA 3U5KA 3NXBA 3SVFA 5CQ4A 3U5JA 4BHWA 5F3AA 4N4IA 3U5PA 4CL9A 5DLZA 3SVGA 5FFVA 4QSSA 5D3HA 5FB1A 5FE3A 4MEQA 4TT2A 4AKHA 5EM3A 2GRCA 5CZGA 1E6IA 5D3PA 4YYKA 4QR5A 5A5RA 5C89A 5F1LA 4QC3A 2YDWA 3VKHA 2RNYA 4ZW1A 5HRXA 5C8GA 5EPSA 4YATA 4TZ2A 5FE5A 5DW1A 4TZ8A 5ENEA 4C67A 4YH3A 5TB6A 3P1CA 4MR5A 4NR7A 3AQAA 4NR8A 5D3LA 5E3DA 5E73A 5IGNA 5A7CA 3G0JA 5FE2A 3LQHA 4LR6A 4XUAA 4PS5A 5D3SA 5EPRA 5FG6A 5EISA 5II2A 4CURA 3G0LA 5C4QA 4NYXA 4IR6A 4MEPA 5E9YA 5ENJA 1PUOA 4NYWA 5HELA 5CUGA 5L98A 4YK0A 4AKNA 5EPBA 5L97A 5G4RA 5BT4A 5CQ3A 5D3JA 5FE6A 5C7NA 3DAIA 4CFKA 5KHMA 4YYDA 4A9LA 4XY8A 4N4GA 5FE1A 4QSVA 4WHUA 4KV1A 5IGLA 3S92A 4TU4A 4CUUA 2YQDA 4YBTA 4BW2A 4NR9A 5E9IA 4XYAA 4QSWA 3QZVA 2F6NA 5EWWA 5LUUA 5IGMA 4LZ2A 4YABA 4HXSA 5E9LA 4OGJA 4C66A 5EU1A 4LZSA 2RO1A 5LJ0A 4Z6IA 3TLPA 4YC9A 4LC2A 2DWWA 5IIDA 3D1DA 4GPJA 5FH7A 4N3WA 4NYVA 4Q0OA 2DVQA 3SVHA 4QYLA 4LYIA 5HENA 4CLBA 5KTWA 5CQ5A 5DY7A 4QSRA 5KTXA 5D24A 2MJVB 2I8NA 5D3NA 2H60A 4LYSA 5FG5A 4KCXA 5CY9A 4YYIA 5DFDA 5HQ5A 4UIUA 4QEVA 3JVMA 5DKDA 4PKLA 3UVXA 3I3JA 5DYXA 5EQ1A 4QSPA 4QSTA 5CUBA 5F63A 3U5OA 5F36A 4YYMA 5EWVA 3UVDA 5CUAA 5DFBA 5JI8A 5JWMA 4A9EA 3U5MA 4HXMA 2YEKA 5L8UA 5LKTA 4UYGA 4A9OA 3U5LA 5EWCA 4O75A 2LSPB 4IR4A 3MB3A 4PTBA 5EK9A 5LKZA 5F25A 4CUPA 5ENHA 2L5EA 1ZKRA 2EJNA 4WHWA 5HFRA 3UV4A 5CQ6A 5CUEA 3UV2A 5AMFA 4Z1QA 3O33A 3UV5A 5HLSA 5DKHA 4ALHA 3JVKA 4IR3A 2F6JA 2R10A 2RFJA 4YAXA 4A9IA 5HCLA 4HBXA 4IOQA 5CQAA 3O34A 5AMEA 4RVRA 5F61A 5DFCA 4J0SA 5CPEA 4YY4A 5A83A 4TYLA 4A9NA 4IR5A 1ZS5A 4LDFA 4O70A 5I86A 5FE8A 4Z6HA 5CU8A 5HFQA 2YW5A 4A9MA 3GG3A 5A82A 5COIA 5FE0A 3HMFA 3JVLA 4NQMA 3LXJA 5EA1A 5FFYA 5LVQA 1JM4B 2OO1A 5ETBA 4A9JA 4UYDA 4HXNA
chains in the Genus database with same CATH topology
4QR4A 4ZC9A 4QUUA 5ETDA 4TT6A 5EVAA 2RNXA 4BJXA 2RNWA 4O74A 2E3KA 2KTBB 5A5PA 2FSAA 5C85A 5D25A 3D7CA 1JSPB 3P5OA 5ACYA 4UITA 3Q2EA 4QEWA 5A85A 5A5OA 4O7CA 5A5QA 5A5NA 4YYNA 5E0RA 5DYUA 5KO4A 1X0JA 2L85A 2WP2A 4BW4A 5D3TA 4QY4A 4MEOA 4QUTA 4ZQLA 5HRVA 5K29A 3Q2FA 4QEUA 5E74A 4HBVA 5DX4A 2RI7A 4QB3A 4Z93A 3HMEA 3QZTA 5FFWA 2L84A 3IU6A 4HXOA 2D82A 3UW9A 4IOOA 4QSXA 5FDZA 4HXLA 5FH6A 5L8TA 5D0CA 4QYDA 4BW3A 5LJ2A 5I29A 4CFLA 4TTEA 3UVWA 2DVRA 4QSUA 5H1UA 4UIVA 5H85A 4O7EA 4XUBA 5CP5A 5CQ7A 3UVYA 4UIWA 2G4AA 4YBMA 2YYNA 5EWDA 5ENFA 4A9KA 3P1FA 5F5ZA 5EWHA 2NXBA 5G4SA 3ZYUA 4KV4A 4J3IA 5BT3A 5L99A 4YH4A 2R0VA 4O76A 4NRBA 2E7NA 5ENGA 4NQNA 4TS8A 3LQIA 2D9EA 4NUEA 2YELA 4LZRA 3JVJA 5D3RA 2E7OA 3LQJA 5CUDA 4TT4A 5E9VA 5L96A 3O35A 4YY6A 4YYGA 5HM0A 4MENA 5HQ6A 4QR3A 5FE7A 4HBYA 5CFWA 1N72A 4NR4A 5KTUA 5A81A 3MB4A 2YEMA 3MUKA 5CRMA 5ENBA 4HXRA 4PY6A 4LRGA 4X2IA 5EV9A 4A9HA 5TCMA 4O78A 2DKWA 5LKXA 5CRZA 3QZSA 4WIVA 5DLXA 5FBXA 5I1QA 4QC1A 5BT5A 4Z1SA 4O72A 2DATA 5I7XA 4YYHA 4CUTA 4YBSA 5F2PA 5H1VA 4BW1A 4A9FA 5CUCA 5EP7A 5H1TA 4Y03A 5KU3A 5FB0A 4XY9A 3MULA 1F68A 4MR6A 3P1DA 4O77A 4MR4A 5HRWA 4UYHA 4ALGA 4F3IA 4TU6A 4QZSA 4NXJA 3RCWA 4UIYA 5E9KA 5EICA 5LVRA 2OSSA 4TQNA 1EQFA 4PCIA 5DW2A 5D26A 4UYFB 5FE9A 4QSQA 4O7BA 4NRAA 2R0SA 3MQMA 4IORA 4NR5A 3P1EA 4HBWA 4J0RA 4O71A 5IGKA 5CQ8A 5FG4A 5ENCA 4QNSA 2I7KA 3AADA 3DWYA 2RS9B 5DYCA 5EGUA 4HXPA 3ONIA 2OUOA 4MR3A 5E9MA 5II1A 4E96A 4NRCA 4PCEA 4UYEA 2DVVA 3LJWA 4LYWA 5AD2A 3MXFA 2N9GA 4OUFA 5FE4A 4N4HA 4NUCA 5DYAA 5I88A 5FH8A 5AD3A 4HXKA 5A5SA 2R0YA 4Q0NA 5IG6A 5F60A 3K2JA 1WUMA 4UYFA 1WUGA 5E7DA 5CS8A 2DVSA 5I83A 5CQTA 4UIZA 2WP1A 4QBMA 5EI4A 4CUQA 5I80A 4YYJA 5DKCA 3HMHA 4NUDA 3S91A 5E3GA 4NR6A 5CTLA 5F62A 4UIXA 5LKUA 4OGIA 3O36A 5I7YA 4O7FA 3IU5A 5I40A 3O37A 5D7XA 4O7AA 5LJ1A 5HQ7A 4FLPA 5HEMA 3FKMX 5F1HA 5HJCA 4CUSA 5I89A 5ENIA 5IBNA 5J0DA 4NS5A 4YADA 4N4FA 4DONA 5C87A 4J1PA 5CGPA 5DBMA 3U5NA 3U5KA 3NXBA 3SVFA 5CQ4A 3U5JA 4BHWA 5F3AA 4N4IA 3U5PA 4CL9A 5DLZA 3SVGA 5FFVA 4QSSA 5D3HA 5FB1A 5FE3A 4MEQA 4TT2A 5EM3A 2GRCA 5CZGA 1E6IA 5D3PA 4YYKA 4QR5A 5A5RA 5C89A 5F1LA 4QC3A 2YDWA 2RNYA 4ZW1A 5HRXA 5C8GA 5EPSA 4YATA 4TZ2A 5FE5A 5DW1A 4TZ8A 5ENEA 4C67A 4YH3A 5TB6A 3P1CA 4MR5A 4NR7A 3AQAA 4NR8A 5D3LA 5E3DA 5E73A 5IGNA 5A7CA 3G0JA 5FE2A 3LQHA 4LR6A 4XUAA 4PS5A 5D3SA 5EPRA 5FG6A 5EISA 5II2A 4CURA 3G0LA 5C4QA 4NYXA 4IR6A 4MEPA 5E9YA 5ENJA 4NYWA 5HELA 5CUGA 5L98A 4YK0A 4AKNA 5EPBA 5L97A 5G4RA 5BT4A 5CQ3A 5D3JA 5FE6A 5C7NA 3DAIA 4CFKA 5KHMA 4YYDA 4A9LA 4XY8A 4N4GA 5FE1A 4QSVA 4WHUA 4KV1A 5IGLA 3S92A 4TU4A 4CUUA 2YQDA 4YBTA 4BW2A 4NR9A 5E9IA 4XYAA 4QSWA 3QZVA 2F6NA 5EWWA 5LUUA 5IGMA 4LZ2A 4YABA 4HXSA 5E9LA 4OGJA 4C66A 5EU1A 4LZSA 2RO1A 5LJ0A 4Z6IA 3TLPA 4YC9A 4LC2A 2DWWA 5IIDA 5FH7A 4GPJA 4N3WA 4NYVA 4Q0OA 2DVQA 3SVHA 4QYLA 4LYIA 5HENA 4CLBA 5KTWA 5CQ5A 5DY7A 4QSRA 5KTXA 5D24A 2MJVB 2I8NA 5D3NA 2H60A 4LYSA 5FG5A 4KCXA 5CY9A 4YYIA 5DFDA 5HQ5A 4UIUA 4QEVA 3JVMA 5DKDA 4PKLA 3UVXA 3I3JA 5DYXA 5EQ1A 4QSPA 4QSTA 5CUBA 5F63A 3U5OA 5F36A 4YYMA 5EWVA 3UVDA 5CUAA 5DFBA 5JI8A 5JWMA 4A9EA 3U5MA 4HXMA 2YEKA 5L8UA 5LKTA 4UYGA 4A9OA 3U5LA 5EWCA 4O75A 2LSPB 4IR4A 3MB3A 4PTBA 5EK9A 5LKZA 5F25A 4CUPA 5ENHA 2L5EA 5HFRA 4WHWA 3UV4A 5CQ6A 5CUEA 3UV2A 5AMFA 4Z1QA 3O33A 3UV5A 5HLSA 5DKHA 4ALHA 3JVKA 4IR3A 2F6JA 2R10A 2RFJA 4YAXA 4A9IA 5HCLA 4HBXA 4IOQA 5CQAA 3O34A 5AMEA 4RVRA 5F61A 5DFCA 4J0SA 5CPEA 4YY4A 5A83A 4TYLA 4A9NA 4IR5A 1ZS5A 4LDFA 4O70A 5I86A 5FE8A 4Z6HA 5CU8A 5HFQA 2YW5A 4A9MA 3GG3A 5A82A 5COIA 5FE0A 3HMFA 3JVLA 4NQMA 3LXJA 5EA1A 5FFYA 5LVQA 1JM4B 2OO1A 5ETBA 4A9JA 4UYDA 4HXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QR4 A;  4ZC9 A;  4QUU A;  5ETD A;  4TT6 A;  5EVA A;  2RNX A;  4BJX A;  2RNW A;  4O74 A;  2E3K A;  2KTB B;  5A5P A;  2FSA A;  5C85 A;  5D25 A;  3D7C A;  1JSP B;  3P5O A;  5ACY A;  4UIT A;  3Q2E A;  4QEW A;  5A85 A;  5A5O A;  4O7C A;  5A5Q A;  5A5N A;  4YYN A;  5E0R A;  5DYU A;  5KO4 A;  1X0J A;  2L85 A;  2WP2 A;  4BW4 A;  5D3T A;  4QY4 A;  4MEO A;  4QUT A;  4ZQL A;  5HRV A;  5K29 A;  3Q2F A;  4QEU A;  5E74 A;  4HBV A;  5DX4 A;  2RI7 A;  4QB3 A;  4Z93 A;  3HME A;  3QZT A;  5FFW A;  2L84 A;  3IU6 A;  4HXO A;  2D82 A;  3UW9 A;  4IOO A;  4QSX A;  5FDZ A;  4HXL A;  5FH6 A;  5L8T A;  5D0C A;  4QYD A;  4BW3 A;  5LJ2 A;  5I29 A;  4CFL A;  4TTE A;  3UVW A;  2DVR A;  4QSU A;  5H1U A;  4UIV A;  5H85 A;  4O7E A;  4XUB A;  5CP5 A;  5CQ7 A;  3UVY A;  4UIW A;  2G4A A;  4YBM A;  2YYN A;  5EWD A;  5ENF A;  4A9K A;  3P1F A;  5F5Z A;  5EWH A;  2NXB A;  5G4S A;  3ZYU A;  4KV4 A;  4J3I A;  5BT3 A;  5L99 A;  4YH4 A;  2R0V A;  4O76 A;  4NRB A;  2E7N A;  5ENG A;  4NQN A;  4TS8 A;  3LQI A;  2D9E A;  4NUE A;  2YEL A;  4LZR A;  3JVJ A;  5D3R A;  2E7O A;  3LQJ A;  5CUD A;  4TT4 A;  5E9V A;  5L96 A;  3O35 A;  4YY6 A;  4YYG A;  5HM0 A;  4MEN A;  5HQ6 A;  4QR3 A;  5FE7 A;  4HBY A;  5CFW A;  1N72 A;  4NR4 A;  5KTU A;  5A81 A;  3MB4 A;  2YEM A;  3MUK A;  5CRM A;  5ENB A;  4HXR A;  4PY6 A;  4LRG A;  4X2I A;  5EV9 A;  4A9H A;  5TCM A;  4O78 A;  2DKW A;  5LKX A;  5CRZ A;  3QZS A;  4WIV A;  5DLX A;  5FBX A;  5I1Q A;  4QC1 A;  5BT5 A;  4Z1S A;  4O72 A;  2DAT A;  5I7X A;  4YYH A;  4CUT A;  4YBS A;  5F2P A;  5H1V A;  4BW1 A;  4A9F A;  5CUC A;  5EP7 A;  5H1T A;  4Y03 A;  5KU3 A;  5FB0 A;  4XY9 A;  3MUL A;  1F68 A;  4MR6 A;  3P1D A;  4O77 A;  4MR4 A;  5HRW A;  4UYH A;  4ALG A;  4F3I A;  4TU6 A;  4QZS A;  4NXJ A;  3RCW A;  4UIY A;  5E9K A;  5EIC A;  5LVR A;  2OSS A;  4TQN A;  1EQF A;  4PCI A;  5DW2 A;  5D26 A;  4UYF B;  5FE9 A;  4QSQ A;  4O7B A;  4NRA A;  2R0S A;  3MQM A;  4IOR A;  4NR5 A;  3P1E A;  4HBW A;  4J0R A;  4O71 A;  5IGK A;  5CQ8 A;  5FG4 A;  5ENC A;  4QNS A;  2I7K A;  3AAD A;  3DWY A;  2RS9 B;  5DYC A;  5EGU A;  4HXP A;  3ONI A;  2OUO A;  4MR3 A;  5E9M A;  5II1 A;  4E96 A;  4NRC A;  4PCE A;  4UYE A;  2DVV A;  3LJW A;  4LYW A;  5AD2 A;  3MXF A;  2N9G A;  4OUF A;  5FE4 A;  4N4H A;  4NUC A;  5DYA A;  5I88 A;  5FH8 A;  5AD3 A;  4HXK A;  5A5S A;  2R0Y A;  4Q0N A;  5IG6 A;  5F60 A;  3K2J A;  1WUM A;  4UYF A;  1WUG A;  5E7D A;  5CS8 A;  2DVS A;  5I83 A;  5CQT A;  4UIZ A;  2WP1 A;  4QBM A;  5EI4 A;  4CUQ A;  5I80 A;  4YYJ A;  5DKC A;  3HMH A;  4NUD A;  3S91 A;  5E3G A;  4NR6 A;  5CTL A;  5F62 A;  4UIX A;  5LKU A;  4OGI A;  3O36 A;  5I7Y A;  4O7F A;  3IU5 A;  5I40 A;  3O37 A;  5D7X A;  4O7A A;  5LJ1 A;  5HQ7 A;  4FLP A;  5HEM A;  3FKM X;  5F1H A;  5HJC A;  4CUS A;  5I89 A;  5ENI A;  5IBN A;  5J0D A;  4NS5 A;  4YAD A;  4N4F A;  4DON A;  5C87 A;  4J1P A;  5CGP A;  5DBM A;  3U5N A;  3U5K A;  3NXB A;  3SVF A;  5CQ4 A;  3U5J A;  4BHW A;  5F3A A;  4N4I A;  3U5P A;  4CL9 A;  5DLZ A;  3SVG A;  5FFV A;  4QSS A;  5D3H A;  5FB1 A;  5FE3 A;  4MEQ A;  4TT2 A;  5EM3 A;  2GRC A;  5CZG A;  1E6I A;  5D3P A;  4YYK A;  4QR5 A;  5A5R A;  5C89 A;  5F1L A;  4QC3 A;  2YDW A;  2RNY A;  4ZW1 A;  5HRX A;  5C8G A;  5EPS A;  4YAT A;  4TZ2 A;  5FE5 A;  5DW1 A;  4TZ8 A;  5ENE A;  4C67 A;  4YH3 A;  5TB6 A;  3P1C A;  4MR5 A;  4NR7 A;  3AQA A;  4NR8 A;  5D3L A;  5E3D A;  5E73 A;  5IGN A;  5A7C A;  3G0J A;  5FE2 A;  3LQH A;  4LR6 A;  4XUA A;  4PS5 A;  5D3S A;  5EPR A;  5FG6 A;  5EIS A;  5II2 A;  4CUR A;  3G0L A;  5C4Q A;  4NYX A;  4IR6 A;  4MEP A;  5E9Y A;  5ENJ A;  4NYW A;  5HEL A;  5CUG A;  5L98 A;  4YK0 A;  4AKN A;  5EPB A;  5L97 A;  5G4R A;  5BT4 A;  5CQ3 A;  5D3J A;  5FE6 A;  5C7N A;  3DAI A;  4CFK A;  5KHM A;  4YYD A;  4A9L A;  4XY8 A;  4N4G A;  5FE1 A;  4QSV A;  4WHU A;  4KV1 A;  5IGL A;  3S92 A;  4TU4 A;  4CUU A;  2YQD A;  4YBT A;  4BW2 A;  4NR9 A;  5E9I A;  4XYA A;  4QSW A;  3QZV A;  2F6N A;  5EWW A;  5LUU A;  5IGM A;  4LZ2 A;  4YAB A;  4HXS A;  5E9L A;  4OGJ A;  4C66 A;  5EU1 A;  4LZS A;  2RO1 A;  5LJ0 A;  4Z6I A;  3TLP A;  4YC9 A;  4LC2 A;  2DWW A;  5IID A;  5FH7 A;  4GPJ A;  4N3W A;  4NYV A;  4Q0O A;  2DVQ A;  3SVH A;  4QYL A;  4LYI A;  5HEN A;  4CLB A;  5KTW A;  5CQ5 A;  5DY7 A;  4QSR A;  5KTX A;  5D24 A;  2MJV B;  2I8N A;  5D3N A;  2H60 A;  4LYS A;  5FG5 A;  4KCX A;  5CY9 A;  4YYI A;  5DFD A;  5HQ5 A;  4UIU A;  4QEV A;  3JVM A;  5DKD A;  4PKL A;  3UVX A;  3I3J A;  5DYX A;  5EQ1 A;  4QSP A;  4QST A;  5CUB A;  5F63 A;  3U5O A;  5F36 A;  4YYM A;  5EWV A;  3UVD A;  5CUA A;  5DFB A;  5JI8 A;  5JWM A;  4A9E A;  3U5M A;  4HXM A;  2YEK A;  5L8U A;  5LKT A;  4UYG A;  4A9O A;  3U5L A;  5EWC A;  4O75 A;  2LSP B;  4IR4 A;  3MB3 A;  4PTB A;  5EK9 A;  5LKZ A;  5F25 A;  4CUP A;  5ENH A;  2L5E A;  5HFR A;  4WHW A;  3UV4 A;  5CQ6 A;  5CUE A;  3UV2 A;  5AMF A;  4Z1Q A;  3O33 A;  3UV5 A;  5HLS A;  5DKH A;  4ALH A;  3JVK A;  4IR3 A;  2F6J A;  2R10 A;  2RFJ A;  4YAX A;  4A9I A;  5HCL A;  4HBX A;  4IOQ A;  5CQA A;  3O34 A;  5AME A;  4RVR A;  5F61 A;  5DFC A;  4J0S A;  5CPE A;  4YY4 A;  5A83 A;  4TYL A;  4A9N A;  4IR5 A;  1ZS5 A;  4LDF A;  4O70 A;  5I86 A;  5FE8 A;  4Z6H A;  5CU8 A;  5HFQ A;  2YW5 A;  4A9M A;  3GG3 A;  5A82 A;  5COI A;  5FE0 A;  3HMF A;  3JVL A;  4NQM A;  3LXJ A;  5EA1 A;  5FFY A;  5LVQ A;  1JM4 B;  2OO1 A;  5ETB A;  4A9J A;  4UYD A;  4HXN A; 
#chains in the Genus database with same CATH topology
 4QR4 A;  4ZC9 A;  4QUU A;  5ETD A;  4TT6 A;  5EVA A;  2RNX A;  4BJX A;  2RNW A;  4O74 A;  2E3K A;  2KTB B;  5A5P A;  2FSA A;  5C85 A;  5D25 A;  3D7C A;  1JSP B;  3P5O A;  5ACY A;  4UIT A;  3Q2E A;  4QEW A;  5A85 A;  5A5O A;  4O7C A;  5A5Q A;  5A5N A;  4YYN A;  5E0R A;  5DYU A;  5KO4 A;  1X0J A;  2L85 A;  2WP2 A;  4BW4 A;  5D3T A;  4QY4 A;  4MEO A;  4QUT A;  4ZQL A;  5HRV A;  5K29 A;  3Q2F A;  4QEU A;  5E74 A;  4HBV A;  5DX4 A;  2RI7 A;  4QB3 A;  4Z93 A;  3HME A;  3QZT A;  5FFW A;  2L84 A;  3IU6 A;  4HXO A;  2D82 A;  3UW9 A;  4IOO A;  4QSX A;  5FDZ A;  4HXL A;  5FH6 A;  5L8T A;  5D0C A;  4QYD A;  4BW3 A;  5LJ2 A;  5I29 A;  4CFL A;  4TTE A;  3UVW A;  2DVR A;  4QSU A;  5H1U A;  4UIV A;  5H85 A;  4O7E A;  4XUB A;  5CP5 A;  5CQ7 A;  3UVY A;  4UIW A;  2G4A A;  4YBM A;  2YYN A;  5EWD A;  5ENF A;  4A9K A;  3P1F A;  5F5Z A;  5EWH A;  2NXB A;  5G4S A;  3ZYU A;  4KV4 A;  4J3I A;  5BT3 A;  5L99 A;  4YH4 A;  2R0V A;  4O76 A;  4AI6 A;  4NRB A;  2E7N A;  5ENG A;  4NQN A;  4TS8 A;  3LQI A;  2D9E A;  3D1B A;  4AKG A;  4NUE A;  2YEL A;  4LZR A;  3JVJ A;  5D3R A;  2E7O A;  3LQJ A;  5CUD A;  4TT4 A;  5E9V A;  5L96 A;  3O35 A;  4YY6 A;  4YYG A;  5HM0 A;  4MEN A;  5HQ6 A;  4QR3 A;  5FE7 A;  4HBY A;  5CFW A;  1N72 A;  4NR4 A;  5KTU A;  5A81 A;  3MB4 A;  2YEM A;  3MUK A;  5CRM A;  5ENB A;  4HXR A;  4PY6 A;  4LRG A;  4X2I A;  5EV9 A;  4A9H A;  5TCM A;  4O78 A;  2DKW A;  5LKX A;  5CRZ A;  3QZS A;  4WIV A;  5DLX A;  5FBX A;  5I1Q A;  4QC1 A;  5BT5 A;  4Z1S A;  4O72 A;  2DAT A;  5I7X A;  4YYH A;  4CUT A;  4YBS A;  5F2P A;  5H1V A;  4BW1 A;  4A9F A;  5CUC A;  5EP7 A;  5H1T A;  4Y03 A;  5KU3 A;  5FB0 A;  4XY9 A;  3MUL A;  1F68 A;  4MR6 A;  3P1D A;  4O77 A;  4MR4 A;  5HRW A;  4UYH A;  4ALG A;  4F3I A;  4TU6 A;  4QZS A;  4NXJ A;  3RCW A;  4UIY A;  5E9K A;  5EIC A;  5LVR A;  2OSS A;  4TQN A;  1EQF A;  4PCI A;  5DW2 A;  5D26 A;  4UYF B;  5FE9 A;  4QSQ A;  4O7B A;  4NRA A;  3VKG A;  2R0S A;  3MQM A;  4IOR A;  4NR5 A;  3P1E A;  4HBW A;  4J0R A;  4O71 A;  5IGK A;  5CQ8 A;  5FG4 A;  5ENC A;  4QNS A;  2I7K A;  3AAD A;  3DWY A;  2RS9 B;  5DYC A;  5EGU A;  4HXP A;  3ONI A;  2OUO A;  4MR3 A;  5E9M A;  5II1 A;  4E96 A;  4NRC A;  4PCE A;  4UYE A;  2DVV A;  3LJW A;  4LYW A;  5AD2 A;  3MXF A;  2N9G A;  4OUF A;  5FE4 A;  4N4H A;  4NUC A;  5DYA A;  5I88 A;  5FH8 A;  5AD3 A;  4HXK A;  5A5S A;  2R0Y A;  4Q0N A;  5IG6 A;  5F60 A;  3K2J A;  1WUM A;  4UYF A;  1WUG A;  5E7D A;  5CS8 A;  2DVS A;  5I83 A;  5CQT A;  4UIZ A;  2WP1 A;  4QBM A;  5EI4 A;  4CUQ A;  5I80 A;  4YYJ A;  5DKC A;  3HMH A;  4NUD A;  3S91 A;  3ERR A;  5E3G A;  4NR6 A;  5CTL A;  5F62 A;  4UIX A;  4AKI A;  5LKU A;  4OGI A;  3O36 A;  5I7Y A;  4O7F A;  3IU5 A;  5I40 A;  3O37 A;  5D7X A;  4O7A A;  5LJ1 A;  5HQ7 A;  4FLP A;  5HEM A;  3FKM X;  5F1H A;  5HJC A;  4CUS A;  5I89 A;  5ENI A;  5IBN A;  5J0D A;  4NS5 A;  4YAD A;  4N4F A;  4DON A;  5C87 A;  4J1P A;  5CGP A;  5DBM A;  3U5N A;  3U5K A;  3NXB A;  3SVF A;  5CQ4 A;  3U5J A;  4BHW A;  5F3A A;  4N4I A;  3U5P A;  4CL9 A;  5DLZ A;  3SVG A;  5FFV A;  4QSS A;  5D3H A;  5FB1 A;  5FE3 A;  4MEQ A;  4TT2 A;  4AKH A;  5EM3 A;  2GRC A;  5CZG A;  1E6I A;  5D3P A;  4YYK A;  4QR5 A;  5A5R A;  5C89 A;  5F1L A;  4QC3 A;  2YDW A;  3VKH A;  2RNY A;  4ZW1 A;  5HRX A;  5C8G A;  5EPS A;  4YAT A;  4TZ2 A;  5FE5 A;  5DW1 A;  4TZ8 A;  5ENE A;  4C67 A;  4YH3 A;  5TB6 A;  3P1C A;  4MR5 A;  4NR7 A;  3AQA A;  4NR8 A;  5D3L A;  5E3D A;  5E73 A;  5IGN A;  5A7C A;  3G0J A;  5FE2 A;  3LQH A;  4LR6 A;  4XUA A;  4PS5 A;  5D3S A;  5EPR A;  5FG6 A;  5EIS A;  5II2 A;  4CUR A;  3G0L A;  5C4Q A;  4NYX A;  4IR6 A;  4MEP A;  5E9Y A;  5ENJ A;  1PUO A;  4NYW A;  5HEL A;  5CUG A;  5L98 A;  4YK0 A;  4AKN A;  5EPB A;  5L97 A;  5G4R A;  5BT4 A;  5CQ3 A;  5D3J A;  5FE6 A;  5C7N A;  3DAI A;  4CFK A;  5KHM A;  4YYD A;  4A9L A;  4XY8 A;  4N4G A;  5FE1 A;  4QSV A;  4WHU A;  4KV1 A;  5IGL A;  3S92 A;  4TU4 A;  4CUU A;  2YQD A;  4YBT A;  4BW2 A;  4NR9 A;  5E9I A;  4XYA A;  4QSW A;  3QZV A;  2F6N A;  5EWW A;  5LUU A;  5IGM A;  4LZ2 A;  4YAB A;  4HXS A;  5E9L A;  4OGJ A;  4C66 A;  5EU1 A;  4LZS A;  2RO1 A;  5LJ0 A;  4Z6I A;  3TLP A;  4YC9 A;  4LC2 A;  2DWW A;  5IID A;  3D1D A;  4GPJ A;  5FH7 A;  4N3W A;  4NYV A;  4Q0O A;  2DVQ A;  3SVH A;  4QYL A;  4LYI A;  5HEN A;  4CLB A;  5KTW A;  5CQ5 A;  5DY7 A;  4QSR A;  5KTX A;  5D24 A;  2MJV B;  2I8N A;  5D3N A;  2H60 A;  4LYS A;  5FG5 A;  4KCX A;  5CY9 A;  4YYI A;  5DFD A;  5HQ5 A;  4UIU A;  4QEV A;  3JVM A;  5DKD A;  4PKL A;  3UVX A;  3I3J A;  5DYX A;  5EQ1 A;  4QSP A;  4QST A;  5CUB A;  5F63 A;  3U5O A;  5F36 A;  4YYM A;  5EWV A;  3UVD A;  5CUA A;  5DFB A;  5JI8 A;  5JWM A;  4A9E A;  3U5M A;  4HXM A;  2YEK A;  5L8U A;  5LKT A;  4UYG A;  4A9O A;  3U5L A;  5EWC A;  4O75 A;  2LSP B;  4IR4 A;  3MB3 A;  4PTB A;  5EK9 A;  5LKZ A;  5F25 A;  4CUP A;  5ENH A;  2L5E A;  1ZKR A;  2EJN A;  4WHW A;  5HFR A;  3UV4 A;  5CQ6 A;  5CUE A;  3UV2 A;  5AMF A;  4Z1Q A;  3O33 A;  3UV5 A;  5HLS A;  5DKH A;  4ALH A;  3JVK A;  4IR3 A;  2F6J A;  2R10 A;  2RFJ A;  4YAX A;  4A9I A;  5HCL A;  4HBX A;  4IOQ A;  5CQA A;  3O34 A;  5AME A;  4RVR A;  5F61 A;  5DFC A;  4J0S A;  5CPE A;  4YY4 A;  5A83 A;  4TYL A;  4A9N A;  4IR5 A;  1ZS5 A;  4LDF A;  4O70 A;  5I86 A;  5FE8 A;  4Z6H A;  5CU8 A;  5HFQ A;  2YW5 A;  4A9M A;  3GG3 A;  5A82 A;  5COI A;  5FE0 A;  3HMF A;  3JVL A;  4NQM A;  3LXJ A;  5EA1 A;  5FFY A;  5LVQ A;  1JM4 B;  2OO1 A;  5ETB A;  4A9J A;  4UYD A;  4HXN A; 
#chains in the Genus database with same CATH homology
 4QR4 A;  4ZC9 A;  4QUU A;  5ETD A;  4TT6 A;  5EVA A;  2RNX A;  4BJX A;  2RNW A;  4O74 A;  2E3K A;  2KTB B;  5A5P A;  2FSA A;  5C85 A;  5D25 A;  3D7C A;  1JSP B;  3P5O A;  5ACY A;  4UIT A;  3Q2E A;  4QEW A;  5A85 A;  5A5O A;  4O7C A;  5A5Q A;  5A5N A;  4YYN A;  5E0R A;  5DYU A;  5KO4 A;  1X0J A;  2L85 A;  2WP2 A;  4BW4 A;  5D3T A;  4QY4 A;  4MEO A;  4QUT A;  4ZQL A;  5HRV A;  5K29 A;  3Q2F A;  4QEU A;  5E74 A;  4HBV A;  5DX4 A;  2RI7 A;  4QB3 A;  4Z93 A;  3HME A;  3QZT A;  5FFW A;  2L84 A;  3IU6 A;  4HXO A;  2D82 A;  3UW9 A;  4IOO A;  4QSX A;  5FDZ A;  4HXL A;  5FH6 A;  5L8T A;  5D0C A;  4QYD A;  4BW3 A;  5LJ2 A;  5I29 A;  4CFL A;  4TTE A;  3UVW A;  2DVR A;  4QSU A;  5H1U A;  4UIV A;  5H85 A;  4O7E A;  4XUB A;  5CP5 A;  5CQ7 A;  3UVY A;  4UIW A;  2G4A A;  4YBM A;  2YYN A;  5EWD A;  5ENF A;  4A9K A;  3P1F A;  5F5Z A;  5EWH A;  2NXB A;  5G4S A;  3ZYU A;  4KV4 A;  4J3I A;  5BT3 A;  5L99 A;  4YH4 A;  2R0V A;  4O76 A;  4NRB A;  2E7N A;  5ENG A;  4NQN A;  4TS8 A;  3LQI A;  2D9E A;  4NUE A;  2YEL A;  4LZR A;  3JVJ A;  5D3R A;  2E7O A;  3LQJ A;  5CUD A;  4TT4 A;  5E9V A;  5L96 A;  3O35 A;  4YY6 A;  4YYG A;  5HM0 A;  4MEN A;  5HQ6 A;  4QR3 A;  5FE7 A;  4HBY A;  5CFW A;  1N72 A;  4NR4 A;  5KTU A;  5A81 A;  3MB4 A;  2YEM A;  3MUK A;  5CRM A;  5ENB A;  4HXR A;  4PY6 A;  4LRG A;  4X2I A;  5EV9 A;  4A9H A;  5TCM A;  4O78 A;  2DKW A;  5LKX A;  5CRZ A;  3QZS A;  4WIV A;  5DLX A;  5FBX A;  5I1Q A;  4QC1 A;  5BT5 A;  4Z1S A;  4O72 A;  2DAT A;  5I7X A;  4YYH A;  4CUT A;  4YBS A;  5F2P A;  5H1V A;  4BW1 A;  4A9F A;  5CUC A;  5EP7 A;  5H1T A;  4Y03 A;  5KU3 A;  5FB0 A;  4XY9 A;  3MUL A;  1F68 A;  4MR6 A;  3P1D A;  4O77 A;  4MR4 A;  5HRW A;  4UYH A;  4ALG A;  4F3I A;  4TU6 A;  4QZS A;  4NXJ A;  3RCW A;  4UIY A;  5E9K A;  5EIC A;  5LVR A;  2OSS A;  4TQN A;  1EQF A;  4PCI A;  5DW2 A;  5D26 A;  4UYF B;  5FE9 A;  4QSQ A;  4O7B A;  4NRA A;  2R0S A;  3MQM A;  4IOR A;  4NR5 A;  3P1E A;  4HBW A;  4J0R A;  4O71 A;  5IGK A;  5CQ8 A;  5FG4 A;  5ENC A;  4QNS A;  2I7K A;  3AAD A;  3DWY A;  2RS9 B;  5DYC A;  5EGU A;  4HXP A;  3ONI A;  2OUO A;  4MR3 A;  5E9M A;  5II1 A;  4E96 A;  4NRC A;  4PCE A;  4UYE A;  2DVV A;  3LJW A;  4LYW A;  5AD2 A;  3MXF A;  2N9G A;  4OUF A;  5FE4 A;  4N4H A;  4NUC A;  5DYA A;  5I88 A;  5FH8 A;  5AD3 A;  4HXK A;  5A5S A;  2R0Y A;  4Q0N A;  5IG6 A;  5F60 A;  3K2J A;  1WUM A;  4UYF A;  1WUG A;  5E7D A;  5CS8 A;  2DVS A;  5I83 A;  5CQT A;  4UIZ A;  2WP1 A;  4QBM A;  5EI4 A;  4CUQ A;  5I80 A;  4YYJ A;  5DKC A;  3HMH A;  4NUD A;  3S91 A;  5E3G A;  4NR6 A;  5CTL A;  5F62 A;  4UIX A;  5LKU A;  4OGI A;  3O36 A;  5I7Y A;  4O7F A;  3IU5 A;  5I40 A;  3O37 A;  5D7X A;  4O7A A;  5LJ1 A;  5HQ7 A;  4FLP A;  5HEM A;  3FKM X;  5F1H A;  5HJC A;  4CUS A;  5I89 A;  5ENI A;  5IBN A;  5J0D A;  4NS5 A;  4YAD A;  4N4F A;  4DON A;  5C87 A;  4J1P A;  5CGP A;  5DBM A;  3U5N A;  3U5K A;  3NXB A;  3SVF A;  5CQ4 A;  3U5J A;  4BHW A;  5F3A A;  4N4I A;  3U5P A;  4CL9 A;  5DLZ A;  3SVG A;  5FFV A;  4QSS A;  5D3H A;  5FB1 A;  5FE3 A;  4MEQ A;  4TT2 A;  5EM3 A;  2GRC A;  5CZG A;  1E6I A;  5D3P A;  4YYK A;  4QR5 A;  5A5R A;  5C89 A;  5F1L A;  4QC3 A;  2YDW A;  2RNY A;  4ZW1 A;  5HRX A;  5C8G A;  5EPS A;  4YAT A;  4TZ2 A;  5FE5 A;  5DW1 A;  4TZ8 A;  5ENE A;  4C67 A;  4YH3 A;  5TB6 A;  3P1C A;  4MR5 A;  4NR7 A;  3AQA A;  4NR8 A;  5D3L A;  5E3D A;  5E73 A;  5IGN A;  5A7C A;  3G0J A;  5FE2 A;  3LQH A;  4LR6 A;  4XUA A;  4PS5 A;  5D3S A;  5EPR A;  5FG6 A;  5EIS A;  5II2 A;  4CUR A;  3G0L A;  5C4Q A;  4NYX A;  4IR6 A;  4MEP A;  5E9Y A;  5ENJ A;  4NYW A;  5HEL A;  5CUG A;  5L98 A;  4YK0 A;  4AKN A;  5EPB A;  5L97 A;  5G4R A;  5BT4 A;  5CQ3 A;  5D3J A;  5FE6 A;  5C7N A;  3DAI A;  4CFK A;  5KHM A;  4YYD A;  4A9L A;  4XY8 A;  4N4G A;  5FE1 A;  4QSV A;  4WHU A;  4KV1 A;  5IGL A;  3S92 A;  4TU4 A;  4CUU A;  2YQD A;  4YBT A;  4BW2 A;  4NR9 A;  5E9I A;  4XYA A;  4QSW A;  3QZV A;  2F6N A;  5EWW A;  5LUU A;  5IGM A;  4LZ2 A;  4YAB A;  4HXS A;  5E9L A;  4OGJ A;  4C66 A;  5EU1 A;  4LZS A;  2RO1 A;  5LJ0 A;  4Z6I A;  3TLP A;  4YC9 A;  4LC2 A;  2DWW A;  5IID A;  5FH7 A;  4GPJ A;  4N3W A;  4NYV A;  4Q0O A;  2DVQ A;  3SVH A;  4QYL A;  4LYI A;  5HEN A;  4CLB A;  5KTW A;  5CQ5 A;  5DY7 A;  4QSR A;  5KTX A;  5D24 A;  2MJV B;  2I8N A;  5D3N A;  2H60 A;  4LYS A;  5FG5 A;  4KCX A;  5CY9 A;  4YYI A;  5DFD A;  5HQ5 A;  4UIU A;  4QEV A;  3JVM A;  5DKD A;  4PKL A;  3UVX A;  3I3J A;  5DYX A;  5EQ1 A;  4QSP A;  4QST A;  5CUB A;  5F63 A;  3U5O A;  5F36 A;  4YYM A;  5EWV A;  3UVD A;  5CUA A;  5DFB A;  5JI8 A;  5JWM A;  4A9E A;  3U5M A;  4HXM A;  2YEK A;  5L8U A;  5LKT A;  4UYG A;  4A9O A;  3U5L A;  5EWC A;  4O75 A;  2LSP B;  4IR4 A;  3MB3 A;  4PTB A;  5EK9 A;  5LKZ A;  5F25 A;  4CUP A;  5ENH A;  2L5E A;  5HFR A;  4WHW A;  3UV4 A;  5CQ6 A;  5CUE A;  3UV2 A;  5AMF A;  4Z1Q A;  3O33 A;  3UV5 A;  5HLS A;  5DKH A;  4ALH A;  3JVK A;  4IR3 A;  2F6J A;  2R10 A;  2RFJ A;  4YAX A;  4A9I A;  5HCL A;  4HBX A;  4IOQ A;  5CQA A;  3O34 A;  5AME A;  4RVR A;  5F61 A;  5DFC A;  4J0S A;  5CPE A;  4YY4 A;  5A83 A;  4TYL A;  4A9N A;  4IR5 A;  1ZS5 A;  4LDF A;  4O70 A;  5I86 A;  5FE8 A;  4Z6H A;  5CU8 A;  5HFQ A;  2YW5 A;  4A9M A;  3GG3 A;  5A82 A;  5COI A;  5FE0 A;  3HMF A;  3JVL A;  4NQM A;  3LXJ A;  5EA1 A;  5FFY A;  5LVQ A;  1JM4 B;  2OO1 A;  5ETB A;  4A9J A;  4UYD A;  4HXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...