5I7XA

Brd9 in complex with cpd2 (n,n-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)benzamide)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
101
structure length
101
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Bromodomain-containing protein 9
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i7xA00
4TU6A 3UV5A 5ENIA 4E96A 4O7FA 4NRCA 3I3JA 2I7KA 4QR5A 4MR4A 3QZTA 5D26A 4YABA 3IU6A 5E9MA 5IGLA 4O75A 3P1FA 4CFKA 5FE3A 5CQTA 4NQNA 5F3AA 2RS9B 2DVQA 3DWYA 3LQJA 3HMHA 5I7YA 5CUAA 5EGUA 4IR6A 5J0DA 3O34A 5F25A 4J0SA 5ACYA 2RFJA 4J0RA 5EU1A 5ENGA 5FB0A 5DLXA 4A9FA 5FG5A 3O36A 4HBYA 5EPSA 5H1UA 2R0YA 5FH6A 5EWHA 5DLZA 5ENCA 5F1HA 4PTBA 4FLPA 2YYNA 5D3JA 4BW1A 4GPJA 4YH4A 5D3HA 4A9NA 5HQ5A 3UVWA 5BT3A 2OUOA 4F3IA 5H1VA 1EQFA 3S91A 4CURA 5C85A 4NR4A 4PCIA 4CUUA 5AD2A 3LQHA 4YATA 5FE8A 1JSPB 5F1LA 4PS5A 4HBVA 4WHUA 4Q0OA 4A9MA 5BT5A 5H1TA 4J3IA 5E73A 4MEPA 4YBTA 1ZS5A 4QC1A 4HBXA 5C87A 5LJ0A 3U5KA 4PY6A 5FE6A 4HXMA 5F2PA 4NRBA 4QSPA 4UYFA 4A9JA 4A9OA 5JI8A 4UYGA 5CQ8A 5EISA 4NUCA 5CP5A 5I7XA 5I86A 4C67A 5FDZA 3IU5A 4O78A 5CPEA 5CUCA 5II2A 5HRWA 5I88A 4O7AA 4WIVA 5LKUA 4NYVA 4CUSA 4UIXA 5DY7A 5DYAA 5DFDA 3JVMA 5KTXA 5CUGA 5FH8A 4QY4A 5EPBA 4A9HA 4QNSA 4N4IA 5LKTA 3NXBA 5CY9A 3MB3A 5TCMA 4YYDA 3UVDA 4CUTA 5F61A 4NQMA 4XUAA 5KO4A 2KTBB 2R0SA 3MUKA 1E6IA 2RNXA 2YEMA 4O77A 5DKCA 4YYKA 4QSTA 4QSSA 5E3DA 4QR3A 4KCXA 5FE7A 5ENBA 4QYLA 4LDFA 4O70A 5COIA 3Q2FA 5I80A 4LYWA 4N3WA 5TB6A 4QSWA 5C8GA 4QZSA 3RCWA 5D3NA 5EQ1A 5HEMA 5I40A 4IR5A 5HFRA 5CQ5A 4QSXA 5A5RA 2R0VA 4ZQLA 4BHWA 5F60A 3U5OA 2L84A 5ENHA 5AD3A 3SVGA 3QZVA 4UIUA 4YH3A 5D24A 4O74A 4NR9A 3LJWA 3GG3A 4HXSA 5EVAA 3P1CA 5HQ7A 5DKHA 5D0CA 5H85A 5HQ6A 4YYNA 5ENEA 5IGMA 3U5NA 2I8NA 5L8TA 5CGPA 4OGJA 4PCEA 5FE2A 5DW1A 4TU4A 5KHMA 5EWDA 1WUGA 5C7NA 4QEUA 4CFLA 5F36A 5HFQA 4YYGA 5FH7A 3SVFA 2DVVA 5KTWA 3ONIA 4YADA 5FBXA 5G4RA 5HLSA 3LXJA 3HMFA 2F6NA 4UYEA 4LYSA 5DYCA 4YC9A 5A7CA 3UVXA 5FE1A 2N9GA 5KTUA 5IIDA 2RNYA 4YYJA 4C66A 5CUDA 4YYHA 4XY8A 5L96A 5C4QA 4QSVA 4CUPA 5K29A 4MENA 2DKWA 3HMEA 4QUTA 3MXFA 3UV4A 4O7BA 4N4GA 3FKMX 5F62A 5ETDA 2OO1A 5E74A 4LZRA 4NS5A 2RNWA 5EV9A 5LJ1A 4QEVA 5ETBA 4YY6A 3K2JA 4MEOA 5CUBA 3SVHA 4NXJA 5DFCA 2YDWA 5ENJA 5CQ4A 5EWVA 4ZC9A 3DAIA 5CS8A 5CZGA 5D3LA 4TT2A 5CRMA 2F6JA 2L5EA 4IR3A 2LSPB 5G4SA 4YBMA 3MULA 4ZW1A 4QEWA 5I1QA 4MR6A 5IBNA 5IG6A 4MEQA 4LRGA 4QB3A 4RVRA 3JVJA 4YYIA 4CL9A 3MB4A 3AADA 3U5JA 2DATA 2YW5A 5FG4A 4UIVA 4QSRA 4A9LA 5C89A 4TS8A 5FE0A 4HXLA 3S92A 5A82A 5DKDA 3U5MA 4YY4A 5CU8A 5A5OA 5FG6A 4BJXA 5FFWA 5E3GA 5EPRA 4Z6HA 5E0RA 2H60A 5CTLA 5DYUA 4TYLA 5II1A 3UW9A 3UVYA 2RO1A 4HXRA 4TQNA 3QZSA 5E9IA 4QC3A 5A81A 4BW3A 4CLBA 4MR5A 5EWWA 5A5PA 4QSUA 2G4AA 5DX4A 5E9KA 2E7NA 5A85A 3D7CA 4NR8A 4AKNA 4UITA 5D3RA 3O37A 4O7CA 4IR4A 4NUEA 5IGNA 3Q2EA 4BW2A 5HCLA 2OSSA 2MJVB 5LVRA 5EP7A 4TTEA 4QBMA 4BW4A 4QYDA 5E9YA 4A9EA 4UYFB 3P1DA 5DBMA 3O35A 4Q0NA 5CQAA 4YBSA 4Z1SA 3U5LA 3MQMA 4IOQA 2GRCA 5CUEA 4LR6A 5A83A 5L98A 5FE5A 3O33A 4OUFA 5I89A 5DFBA 5CQ7A 4HXPA 5AMEA 2DWWA 4UIZA 1N72A 5A5NA 1F68A 4LZ2A 5JWMA 4A9IA 3AQAA 3G0JA 3TLPA 3LQIA 2D82A 5HJCA 3JVKA 2DVSA 4WHWA 5DW2A 5FB1A 5F63A 5LKXA 5CQ3A 1X0JA 2YQDA 1WUMA 4O72A 3G0LA 4NYWA 4TZ8A 4XY9A 5EICA 5AMFA 4IORA 4HXNA 4UIWA 4NR6A 5LVQA 4NRAA 4YYMA 4NUDA 5CFWA 4YK0A 5D3PA 4UYHA 2FSAA 5CQ6A 5HELA 5HENA 5FE4A 4LYIA 4LZSA 4CUQA 5HRVA 4O71A 2YEKA 4QR4A 4NYXA 2WP2A 5FFVA 5A5QA 5L99A 4HXKA 4TT4A 5E7DA 4Z6IA 5FFYA 2YELA 4QUUA 5D7XA 5E9VA 4NR5A 3JVLA 5ENFA 4UIYA 4ALHA 2E7OA 4J1PA 4YAXA 2D9EA 2RI7A 5HM0A 4N4HA 5FE9A 5IGKA 4HXOA 4TT6A 5EI4A 4Z93A 4X2IA 5L8UA 4ALGA 5I29A 2E3KA 4Y03A 4KV1A 5D25A 4XYAA 4O7EA 5A5SA 3P1EA 4QSQA 5EK9A 5KU3A 1JM4B 3P5OA 5CRZA 5LJ2A 4IOOA 5EM3A 4HBWA 5EA1A 5BT4A 5DYXA 2L85A 5LKZA 5HRXA 4PKLA 4TZ2A 5F5ZA 3ZYUA 4Z1QA 4MR3A 5EWCA 2R10A 5D3TA 2DVRA 4A9KA 5I83A 3UV2A 5E9LA 5L97A 4N4FA 5LUUA 2WP1A 4O76A 4OGIA 4NR7A 4LC2A 3U5PA 4XUBA 4DONA 4UYDA 5D3SA 4KV4A 2NXBA
chains in the Genus database with same CATH superfamily
4TU6A 3UV5A 5ENIA 4E96A 4O7FA 4NRCA 3I3JA 2I7KA 4QR5A 4MR4A 3QZTA 5D26A 4YABA 3IU6A 5E9MA 5IGLA 4O75A 3P1FA 4CFKA 5FE3A 5CQTA 4NQNA 5F3AA 2RS9B 2DVQA 3DWYA 3LQJA 3HMHA 5I7YA 5CUAA 5EGUA 4IR6A 5J0DA 3O34A 5F25A 4J0SA 5ACYA 2RFJA 4J0RA 5EU1A 5ENGA 5FB0A 5DLXA 4A9FA 5FG5A 4AI6A 3O36A 4HBYA 5EPSA 5H1UA 2R0YA 5FH6A 5EWHA 5DLZA 5ENCA 5F1HA 4PTBA 4FLPA 2YYNA 5D3JA 4BW1A 4GPJA 4YH4A 5D3HA 4A9NA 5HQ5A 3UVWA 5BT3A 2OUOA 4F3IA 5H1VA 1EQFA 3S91A 4CURA 5C85A 4NR4A 3VKGA 4PCIA 4CUUA 5AD2A 3LQHA 4YATA 5FE8A 1JSPB 5F1LA 4PS5A 4HBVA 4WHUA 4Q0OA 4A9MA 5BT5A 5H1TA 4J3IA 5E73A 4MEPA 4YBTA 1ZS5A 3D1DA 4QC1A 4AKGA 4HBXA 5C87A 5LJ0A 3U5KA 4PY6A 5FE6A 4HXMA 5F2PA 4NRBA 4QSPA 4UYFA 4A9JA 4A9OA 5JI8A 4UYGA 5CQ8A 5EISA 4NUCA 5CP5A 5I7XA 5I86A 4C67A 5FDZA 3IU5A 4O78A 5CPEA 5CUCA 5II2A 5HRWA 5I88A 4O7AA 4WIVA 5LKUA 4NYVA 4CUSA 4UIXA 5DY7A 5DYAA 5DFDA 3JVMA 5KTXA 5CUGA 5FH8A 4QY4A 5EPBA 4A9HA 4QNSA 4N4IA 5LKTA 3NXBA 5CY9A 3MB3A 5TCMA 4YYDA 3UVDA 4CUTA 5F61A 4NQMA 4XUAA 5KO4A 2KTBB 2R0SA 3MUKA 1E6IA 2RNXA 2YEMA 4O77A 5DKCA 4YYKA 4QSTA 4QSSA 5E3DA 4QR3A 4KCXA 5FE7A 5ENBA 4QYLA 4LDFA 4O70A 5COIA 3Q2FA 5I80A 4LYWA 4N3WA 5TB6A 4QSWA 5C8GA 4QZSA 3RCWA 5D3NA 5EQ1A 5HEMA 5I40A 4IR5A 5HFRA 5CQ5A 4QSXA 5A5RA 2R0VA 4ZQLA 4BHWA 5F60A 3U5OA 2L84A 5ENHA 5AD3A 3SVGA 3QZVA 4UIUA 4YH3A 5D24A 4O74A 4NR9A 3LJWA 3GG3A 4HXSA 5EVAA 3P1CA 5HQ7A 5DKHA 5D0CA 5H85A 5HQ6A 4YYNA 5ENEA 5IGMA 3U5NA 2I8NA 5L8TA 5CGPA 4OGJA 4PCEA 5FE2A 5DW1A 4TU4A 5KHMA 5EWDA 1WUGA 5C7NA 4QEUA 4CFLA 5F36A 5HFQA 4YYGA 5FH7A 3SVFA 2DVVA 5KTWA 3ONIA 4YADA 5FBXA 5G4RA 5HLSA 3LXJA 3HMFA 2F6NA 4UYEA 4LYSA 5DYCA 4YC9A 5A7CA 3UVXA 5FE1A 2N9GA 5KTUA 5IIDA 2RNYA 4YYJA 4C66A 5CUDA 4YYHA 4XY8A 5L96A 5C4QA 4QSVA 4CUPA 5K29A 4MENA 2DKWA 3HMEA 4QUTA 3MXFA 3UV4A 4O7BA 4N4GA 3FKMX 5F62A 5ETDA 4AKIA 2OO1A 5E74A 4LZRA 4NS5A 2RNWA 5EV9A 5LJ1A 4QEVA 5ETBA 4YY6A 3K2JA 4MEOA 5CUBA 3SVHA 4NXJA 5DFCA 2YDWA 5ENJA 5CQ4A 5EWVA 4ZC9A 3DAIA 5CS8A 5CZGA 5D3LA 4TT2A 5CRMA 2F6JA 2L5EA 4IR3A 2LSPB 5G4SA 4YBMA 3MULA 4ZW1A 4QEWA 5I1QA 4MR6A 5IBNA 5IG6A 4MEQA 4LRGA 4QB3A 4RVRA 3JVJA 4YYIA 4CL9A 3MB4A 3AADA 3U5JA 2DATA 2YW5A 5FG4A 4UIVA 4QSRA 4A9LA 1PUOA 4TS8A 5C89A 5FE0A 4HXLA 3S92A 5A82A 5DKDA 2EJNA 3U5MA 4YY4A 5CU8A 5A5OA 5FG6A 4BJXA 5FFWA 5E3GA 5EPRA 4Z6HA 5E0RA 2H60A 5CTLA 5DYUA 4TYLA 5II1A 3UW9A 3UVYA 2RO1A 4HXRA 4TQNA 3QZSA 3VKHA 5E9IA 4QC3A 5A81A 4BW3A 4CLBA 4MR5A 5EWWA 5A5PA 4QSUA 2G4AA 5DX4A 5E9KA 2E7NA 5A85A 3D7CA 4NR8A 4AKNA 4UITA 5D3RA 3O37A 4O7CA 4IR4A 4NUEA 5IGNA 3Q2EA 4BW2A 5HCLA 2OSSA 2MJVB 5LVRA 5EP7A 4TTEA 4QBMA 4BW4A 4QYDA 5E9YA 4A9EA 4UYFB 3P1DA 5DBMA 3O35A 4Q0NA 5CQAA 4YBSA 4Z1SA 3U5LA 3MQMA 4IOQA 2GRCA 5CUEA 4LR6A 5A83A 5L98A 5FE5A 3O33A 4OUFA 5I89A 5DFBA 5CQ7A 4HXPA 5AMEA 2DWWA 4UIZA 1N72A 5A5NA 1F68A 4LZ2A 1ZKRA 5JWMA 4A9IA 3AQAA 3G0JA 3TLPA 3LQIA 2D82A 5HJCA 3JVKA 2DVSA 4WHWA 5DW2A 5FB1A 5F63A 5LKXA 5CQ3A 1X0JA 2YQDA 1WUMA 4O72A 3G0LA 4NYWA 4TZ8A 4XY9A 5EICA 5AMFA 4IORA 4HXNA 4UIWA 4NR6A 5LVQA 4NRAA 4YYMA 4NUDA 5CFWA 4YK0A 5D3PA 4UYHA 2FSAA 5CQ6A 5HELA 5HENA 5FE4A 4LYIA 4LZSA 4CUQA 5HRVA 4O71A 2YEKA 4QR4A 4NYXA 2WP2A 5FFVA 5A5QA 5L99A 4HXKA 4TT4A 5E7DA 4Z6IA 5FFYA 2YELA 4QUUA 5D7XA 5E9VA 4NR5A 3JVLA 5ENFA 4UIYA 4ALHA 2E7OA 4J1PA 4YAXA 4AKHA 2D9EA 2RI7A 5HM0A 4N4HA 5FE9A 5IGKA 4HXOA 4TT6A 5EI4A 4Z93A 4X2IA 5L8UA 4ALGA 5I29A 2E3KA 4Y03A 4KV1A 5D25A 4XYAA 4O7EA 5A5SA 3P1EA 4QSQA 5EK9A 5KU3A 3D1BA 1JM4B 3P5OA 5CRZA 5LJ2A 3ERRA 4IOOA 5EM3A 4HBWA 5EA1A 5BT4A 5DYXA 2L85A 5LKZA 5HRXA 4PKLA 4TZ2A 5F5ZA 3ZYUA 4Z1QA 4MR3A 5EWCA 2R10A 5D3TA 2DVRA 4A9KA 5I83A 3UV2A 5E9LA 5L97A 4N4FA 5LUUA 2WP1A 4O76A 4OGIA 4NR7A 4LC2A 3U5PA 4XUBA 4DONA 4UYDA 5D3SA 4KV4A 2NXBA
chains in the Genus database with same CATH topology
4TU6A 3UV5A 5ENIA 4E96A 4O7FA 4NRCA 3I3JA 2I7KA 4QR5A 4MR4A 3QZTA 5D26A 4YABA 3IU6A 5E9MA 5IGLA 4O75A 3P1FA 4CFKA 5FE3A 5CQTA 4NQNA 5F3AA 2RS9B 2DVQA 3DWYA 3LQJA 3HMHA 5I7YA 5CUAA 5EGUA 4IR6A 5J0DA 3O34A 5F25A 4J0SA 5ACYA 2RFJA 4J0RA 5EU1A 5ENGA 5FB0A 5DLXA 4A9FA 5FG5A 3O36A 4HBYA 5EPSA 5H1UA 2R0YA 5FH6A 5EWHA 5DLZA 5ENCA 5F1HA 4PTBA 4FLPA 2YYNA 5D3JA 4BW1A 4GPJA 4YH4A 5D3HA 4A9NA 5HQ5A 3UVWA 5BT3A 2OUOA 4F3IA 5H1VA 1EQFA 3S91A 4CURA 5C85A 4NR4A 4PCIA 4CUUA 5AD2A 3LQHA 4YATA 5FE8A 1JSPB 5F1LA 4PS5A 4HBVA 4WHUA 4Q0OA 4A9MA 5BT5A 5H1TA 4J3IA 5E73A 4MEPA 4YBTA 1ZS5A 4QC1A 4HBXA 5C87A 5LJ0A 3U5KA 4PY6A 5FE6A 4HXMA 5F2PA 4NRBA 4QSPA 4UYFA 4A9JA 4A9OA 5JI8A 4UYGA 5CQ8A 5EISA 4NUCA 5CP5A 5I7XA 5I86A 4C67A 5FDZA 3IU5A 4O78A 5CPEA 5CUCA 5II2A 5HRWA 5I88A 4O7AA 4WIVA 5LKUA 4NYVA 4CUSA 4UIXA 5DY7A 5DYAA 5DFDA 3JVMA 5KTXA 5CUGA 5FH8A 4QY4A 5EPBA 4A9HA 4QNSA 4N4IA 5LKTA 3NXBA 5CY9A 3MB3A 5TCMA 4YYDA 3UVDA 4CUTA 5F61A 4NQMA 4XUAA 5KO4A 2KTBB 2R0SA 3MUKA 1E6IA 2RNXA 2YEMA 4O77A 5DKCA 4YYKA 4QSTA 4QSSA 5E3DA 4QR3A 4KCXA 5FE7A 5ENBA 4QYLA 4LDFA 4O70A 5COIA 3Q2FA 5I80A 4LYWA 4N3WA 5TB6A 4QSWA 5C8GA 4QZSA 3RCWA 5D3NA 5EQ1A 5HEMA 5I40A 4IR5A 5HFRA 5CQ5A 4QSXA 5A5RA 2R0VA 4ZQLA 4BHWA 5F60A 3U5OA 2L84A 5ENHA 5AD3A 3SVGA 3QZVA 4UIUA 4YH3A 5D24A 4O74A 4NR9A 3LJWA 3GG3A 4HXSA 5EVAA 3P1CA 5HQ7A 5DKHA 5D0CA 5H85A 5HQ6A 4YYNA 5ENEA 5IGMA 3U5NA 2I8NA 5L8TA 5CGPA 4OGJA 4PCEA 5FE2A 5DW1A 4TU4A 5KHMA 5EWDA 1WUGA 5C7NA 4QEUA 4CFLA 5F36A 5HFQA 4YYGA 5FH7A 3SVFA 2DVVA 5KTWA 3ONIA 4YADA 5FBXA 5G4RA 5HLSA 3LXJA 3HMFA 2F6NA 4UYEA 4LYSA 5DYCA 4YC9A 5A7CA 3UVXA 5FE1A 2N9GA 5KTUA 5IIDA 2RNYA 4YYJA 4C66A 5CUDA 4YYHA 4XY8A 5L96A 5C4QA 4QSVA 4CUPA 5K29A 4MENA 2DKWA 3HMEA 4QUTA 3MXFA 3UV4A 4O7BA 4N4GA 3FKMX 5F62A 5ETDA 2OO1A 5E74A 4LZRA 4NS5A 2RNWA 5EV9A 5LJ1A 4QEVA 5ETBA 4YY6A 3K2JA 4MEOA 5CUBA 3SVHA 4NXJA 5DFCA 2YDWA 5ENJA 5CQ4A 5EWVA 4ZC9A 3DAIA 5CS8A 5CZGA 5D3LA 4TT2A 5CRMA 2F6JA 2L5EA 4IR3A 2LSPB 5G4SA 4YBMA 3MULA 4ZW1A 4QEWA 5I1QA 4MR6A 5IBNA 5IG6A 4MEQA 4LRGA 4QB3A 4RVRA 3JVJA 4YYIA 4CL9A 3MB4A 3AADA 3U5JA 2DATA 2YW5A 5FG4A 4UIVA 4QSRA 4A9LA 5C89A 4TS8A 5FE0A 4HXLA 3S92A 5A82A 5DKDA 3U5MA 4YY4A 5CU8A 5A5OA 5FG6A 4BJXA 5FFWA 5E3GA 5EPRA 4Z6HA 5E0RA 2H60A 5CTLA 5DYUA 4TYLA 5II1A 3UW9A 3UVYA 2RO1A 4HXRA 4TQNA 3QZSA 5E9IA 4QC3A 5A81A 4BW3A 4CLBA 4MR5A 5EWWA 5A5PA 4QSUA 2G4AA 5DX4A 5E9KA 2E7NA 5A85A 3D7CA 4NR8A 4AKNA 4UITA 5D3RA 3O37A 4O7CA 4IR4A 4NUEA 5IGNA 3Q2EA 4BW2A 5HCLA 2OSSA 2MJVB 5LVRA 5EP7A 4TTEA 4QBMA 4BW4A 4QYDA 5E9YA 4A9EA 4UYFB 3P1DA 5DBMA 3O35A 4Q0NA 5CQAA 4YBSA 4Z1SA 3U5LA 3MQMA 4IOQA 2GRCA 5CUEA 4LR6A 5A83A 5L98A 5FE5A 3O33A 4OUFA 5I89A 5DFBA 5CQ7A 4HXPA 5AMEA 2DWWA 4UIZA 1N72A 5A5NA 1F68A 4LZ2A 5JWMA 4A9IA 3AQAA 3G0JA 3TLPA 3LQIA 2D82A 5HJCA 3JVKA 2DVSA 4WHWA 5DW2A 5FB1A 5F63A 5LKXA 5CQ3A 1X0JA 2YQDA 1WUMA 4O72A 3G0LA 4NYWA 4TZ8A 4XY9A 5EICA 5AMFA 4IORA 4HXNA 4UIWA 4NR6A 5LVQA 4NRAA 4YYMA 4NUDA 5CFWA 4YK0A 5D3PA 4UYHA 2FSAA 5CQ6A 5HELA 5HENA 5FE4A 4LYIA 4LZSA 4CUQA 5HRVA 4O71A 2YEKA 4QR4A 4NYXA 2WP2A 5FFVA 5A5QA 5L99A 4HXKA 4TT4A 5E7DA 4Z6IA 5FFYA 2YELA 4QUUA 5D7XA 5E9VA 4NR5A 3JVLA 5ENFA 4UIYA 4ALHA 2E7OA 4J1PA 4YAXA 2D9EA 2RI7A 5HM0A 4N4HA 5FE9A 5IGKA 4HXOA 4TT6A 5EI4A 4Z93A 4X2IA 5L8UA 4ALGA 5I29A 2E3KA 4Y03A 4KV1A 5D25A 4XYAA 4O7EA 5A5SA 3P1EA 4QSQA 5EK9A 5KU3A 1JM4B 3P5OA 5CRZA 5LJ2A 4IOOA 5EM3A 4HBWA 5EA1A 5BT4A 5DYXA 2L85A 5LKZA 5HRXA 4PKLA 4TZ2A 5F5ZA 3ZYUA 4Z1QA 4MR3A 5EWCA 2R10A 5D3TA 2DVRA 4A9KA 5I83A 3UV2A 5E9LA 5L97A 4N4FA 5LUUA 2WP1A 4O76A 4OGIA 4NR7A 4LC2A 3U5PA 4XUBA 4DONA 4UYDA 5D3SA 4KV4A 2NXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TU6 A;  3UV5 A;  5ENI A;  4E96 A;  4O7F A;  4NRC A;  3I3J A;  2I7K A;  4QR5 A;  4MR4 A;  3QZT A;  5D26 A;  4YAB A;  3IU6 A;  5E9M A;  5IGL A;  4O75 A;  3P1F A;  4CFK A;  5FE3 A;  5CQT A;  4NQN A;  5F3A A;  2RS9 B;  2DVQ A;  3DWY A;  3LQJ A;  3HMH A;  5I7Y A;  5CUA A;  5EGU A;  4IR6 A;  5J0D A;  3O34 A;  5F25 A;  4J0S A;  5ACY A;  2RFJ A;  4J0R A;  5EU1 A;  5ENG A;  5FB0 A;  5DLX A;  4A9F A;  5FG5 A;  3O36 A;  4HBY A;  5EPS A;  5H1U A;  2R0Y A;  5FH6 A;  5EWH A;  5DLZ A;  5ENC A;  5F1H A;  4PTB A;  4FLP A;  2YYN A;  5D3J A;  4BW1 A;  4GPJ A;  4YH4 A;  5D3H A;  4A9N A;  5HQ5 A;  3UVW A;  5BT3 A;  2OUO A;  4F3I A;  5H1V A;  1EQF A;  3S91 A;  4CUR A;  5C85 A;  4NR4 A;  4PCI A;  4CUU A;  5AD2 A;  3LQH A;  4YAT A;  5FE8 A;  1JSP B;  5F1L A;  4PS5 A;  4HBV A;  4WHU A;  4Q0O A;  4A9M A;  5BT5 A;  5H1T A;  4J3I A;  5E73 A;  4MEP A;  4YBT A;  1ZS5 A;  4QC1 A;  4HBX A;  5C87 A;  5LJ0 A;  3U5K A;  4PY6 A;  5FE6 A;  4HXM A;  5F2P A;  4NRB A;  4QSP A;  4UYF A;  4A9J A;  4A9O A;  5JI8 A;  4UYG A;  5CQ8 A;  5EIS A;  4NUC A;  5CP5 A;  5I7X A;  5I86 A;  4C67 A;  5FDZ A;  3IU5 A;  4O78 A;  5CPE A;  5CUC A;  5II2 A;  5HRW A;  5I88 A;  4O7A A;  4WIV A;  5LKU A;  4NYV A;  4CUS A;  4UIX A;  5DY7 A;  5DYA A;  5DFD A;  3JVM A;  5KTX A;  5CUG A;  5FH8 A;  4QY4 A;  5EPB A;  4A9H A;  4QNS A;  4N4I A;  5LKT A;  3NXB A;  5CY9 A;  3MB3 A;  5TCM A;  4YYD A;  3UVD A;  4CUT A;  5F61 A;  4NQM A;  4XUA A;  5KO4 A;  2KTB B;  2R0S A;  3MUK A;  1E6I A;  2RNX A;  2YEM A;  4O77 A;  5DKC A;  4YYK A;  4QST A;  4QSS A;  5E3D A;  4QR3 A;  4KCX A;  5FE7 A;  5ENB A;  4QYL A;  4LDF A;  4O70 A;  5COI A;  3Q2F A;  5I80 A;  4LYW A;  4N3W A;  5TB6 A;  4QSW A;  5C8G A;  4QZS A;  3RCW A;  5D3N A;  5EQ1 A;  5HEM A;  5I40 A;  4IR5 A;  5HFR A;  5CQ5 A;  4QSX A;  5A5R A;  2R0V A;  4ZQL A;  4BHW A;  5F60 A;  3U5O A;  2L84 A;  5ENH A;  5AD3 A;  3SVG A;  3QZV A;  4UIU A;  4YH3 A;  5D24 A;  4O74 A;  4NR9 A;  3LJW A;  3GG3 A;  4HXS A;  5EVA A;  3P1C A;  5HQ7 A;  5DKH A;  5D0C A;  5H85 A;  5HQ6 A;  4YYN A;  5ENE A;  5IGM A;  3U5N A;  2I8N A;  5L8T A;  5CGP A;  4OGJ A;  4PCE A;  5FE2 A;  5DW1 A;  4TU4 A;  5KHM A;  5EWD A;  1WUG A;  5C7N A;  4QEU A;  4CFL A;  5F36 A;  5HFQ A;  4YYG A;  5FH7 A;  3SVF A;  2DVV A;  5KTW A;  3ONI A;  4YAD A;  5FBX A;  5G4R A;  5HLS A;  3LXJ A;  3HMF A;  2F6N A;  4UYE A;  4LYS A;  5DYC A;  4YC9 A;  5A7C A;  3UVX A;  5FE1 A;  2N9G A;  5KTU A;  5IID A;  2RNY A;  4YYJ A;  4C66 A;  5CUD A;  4YYH A;  4XY8 A;  5L96 A;  5C4Q A;  4QSV A;  4CUP A;  5K29 A;  4MEN A;  2DKW A;  3HME A;  4QUT A;  3MXF A;  3UV4 A;  4O7B A;  4N4G A;  3FKM X;  5F62 A;  5ETD A;  2OO1 A;  5E74 A;  4LZR A;  4NS5 A;  2RNW A;  5EV9 A;  5LJ1 A;  4QEV A;  5ETB A;  4YY6 A;  3K2J A;  4MEO A;  5CUB A;  3SVH A;  4NXJ A;  5DFC A;  2YDW A;  5ENJ A;  5CQ4 A;  5EWV A;  4ZC9 A;  3DAI A;  5CS8 A;  5CZG A;  5D3L A;  4TT2 A;  5CRM A;  2F6J A;  2L5E A;  4IR3 A;  2LSP B;  5G4S A;  4YBM A;  3MUL A;  4ZW1 A;  4QEW A;  5I1Q A;  4MR6 A;  5IBN A;  5IG6 A;  4MEQ A;  4LRG A;  4QB3 A;  4RVR A;  3JVJ A;  4YYI A;  4CL9 A;  3MB4 A;  3AAD A;  3U5J A;  2DAT A;  2YW5 A;  5FG4 A;  4UIV A;  4QSR A;  4A9L A;  5C89 A;  4TS8 A;  5FE0 A;  4HXL A;  3S92 A;  5A82 A;  5DKD A;  3U5M A;  4YY4 A;  5CU8 A;  5A5O A;  5FG6 A;  4BJX A;  5FFW A;  5E3G A;  5EPR A;  4Z6H A;  5E0R A;  2H60 A;  5CTL A;  5DYU A;  4TYL A;  5II1 A;  3UW9 A;  3UVY A;  2RO1 A;  4HXR A;  4TQN A;  3QZS A;  5E9I A;  4QC3 A;  5A81 A;  4BW3 A;  4CLB A;  4MR5 A;  5EWW A;  5A5P A;  4QSU A;  2G4A A;  5DX4 A;  5E9K A;  2E7N A;  5A85 A;  3D7C A;  4NR8 A;  4AKN A;  4UIT A;  5D3R A;  3O37 A;  4O7C A;  4IR4 A;  4NUE A;  5IGN A;  3Q2E A;  4BW2 A;  5HCL A;  2OSS A;  2MJV B;  5LVR A;  5EP7 A;  4TTE A;  4QBM A;  4BW4 A;  4QYD A;  5E9Y A;  4A9E A;  4UYF B;  3P1D A;  5DBM A;  3O35 A;  4Q0N A;  5CQA A;  4YBS A;  4Z1S A;  3U5L A;  3MQM A;  4IOQ A;  2GRC A;  5CUE A;  4LR6 A;  5A83 A;  5L98 A;  5FE5 A;  3O33 A;  4OUF A;  5I89 A;  5DFB A;  5CQ7 A;  4HXP A;  5AME A;  2DWW A;  4UIZ A;  1N72 A;  5A5N A;  1F68 A;  4LZ2 A;  5JWM A;  4A9I A;  3AQA A;  3G0J A;  3TLP A;  3LQI A;  2D82 A;  5HJC A;  3JVK A;  2DVS A;  4WHW A;  5DW2 A;  5FB1 A;  5F63 A;  5LKX A;  5CQ3 A;  1X0J A;  2YQD A;  1WUM A;  4O72 A;  3G0L A;  4NYW A;  4TZ8 A;  4XY9 A;  5EIC A;  5AMF A;  4IOR A;  4HXN A;  4UIW A;  4NR6 A;  5LVQ A;  4NRA A;  4YYM A;  4NUD A;  5CFW A;  4YK0 A;  5D3P A;  4UYH A;  2FSA A;  5CQ6 A;  5HEL A;  5HEN A;  5FE4 A;  4LYI A;  4LZS A;  4CUQ A;  5HRV A;  4O71 A;  2YEK A;  4QR4 A;  4NYX A;  2WP2 A;  5FFV A;  5A5Q A;  5L99 A;  4HXK A;  4TT4 A;  5E7D A;  4Z6I A;  5FFY A;  2YEL A;  4QUU A;  5D7X A;  5E9V A;  4NR5 A;  3JVL A;  5ENF A;  4UIY A;  4ALH A;  2E7O A;  4J1P A;  4YAX A;  2D9E A;  2RI7 A;  5HM0 A;  4N4H A;  5FE9 A;  5IGK A;  4HXO A;  4TT6 A;  5EI4 A;  4Z93 A;  4X2I A;  5L8U A;  4ALG A;  5I29 A;  2E3K A;  4Y03 A;  4KV1 A;  5D25 A;  4XYA A;  4O7E A;  5A5S A;  3P1E A;  4QSQ A;  5EK9 A;  5KU3 A;  1JM4 B;  3P5O A;  5CRZ A;  5LJ2 A;  4IOO A;  5EM3 A;  4HBW A;  5EA1 A;  5BT4 A;  5DYX A;  2L85 A;  5LKZ A;  5HRX A;  4PKL A;  4TZ2 A;  5F5Z A;  3ZYU A;  4Z1Q A;  4MR3 A;  5EWC A;  2R10 A;  5D3T A;  2DVR A;  4A9K A;  5I83 A;  3UV2 A;  5E9L A;  5L97 A;  4N4F A;  5LUU A;  2WP1 A;  4O76 A;  4OGI A;  4NR7 A;  4LC2 A;  3U5P A;  4XUB A;  4DON A;  4UYD A;  5D3S A;  4KV4 A;  2NXB A; 
#chains in the Genus database with same CATH topology
 4TU6 A;  3UV5 A;  5ENI A;  4E96 A;  4O7F A;  4NRC A;  3I3J A;  2I7K A;  4QR5 A;  4MR4 A;  3QZT A;  5D26 A;  4YAB A;  3IU6 A;  5E9M A;  5IGL A;  4O75 A;  3P1F A;  4CFK A;  5FE3 A;  5CQT A;  4NQN A;  5F3A A;  2RS9 B;  2DVQ A;  3DWY A;  3LQJ A;  3HMH A;  5I7Y A;  5CUA A;  5EGU A;  4IR6 A;  5J0D A;  3O34 A;  5F25 A;  4J0S A;  5ACY A;  2RFJ A;  4J0R A;  5EU1 A;  5ENG A;  5FB0 A;  5DLX A;  4A9F A;  5FG5 A;  4AI6 A;  3O36 A;  4HBY A;  5EPS A;  5H1U A;  2R0Y A;  5FH6 A;  5EWH A;  5DLZ A;  5ENC A;  5F1H A;  4PTB A;  4FLP A;  2YYN A;  5D3J A;  4BW1 A;  4GPJ A;  4YH4 A;  5D3H A;  4A9N A;  5HQ5 A;  3UVW A;  5BT3 A;  2OUO A;  4F3I A;  5H1V A;  1EQF A;  3S91 A;  4CUR A;  5C85 A;  4NR4 A;  3VKG A;  4PCI A;  4CUU A;  5AD2 A;  3LQH A;  4YAT A;  5FE8 A;  1JSP B;  5F1L A;  4PS5 A;  4HBV A;  4WHU A;  4Q0O A;  4A9M A;  5BT5 A;  5H1T A;  4J3I A;  5E73 A;  4MEP A;  4YBT A;  1ZS5 A;  3D1D A;  4QC1 A;  4AKG A;  4HBX A;  5C87 A;  5LJ0 A;  3U5K A;  4PY6 A;  5FE6 A;  4HXM A;  5F2P A;  4NRB A;  4QSP A;  4UYF A;  4A9J A;  4A9O A;  5JI8 A;  4UYG A;  5CQ8 A;  5EIS A;  4NUC A;  5CP5 A;  5I7X A;  5I86 A;  4C67 A;  5FDZ A;  3IU5 A;  4O78 A;  5CPE A;  5CUC A;  5II2 A;  5HRW A;  5I88 A;  4O7A A;  4WIV A;  5LKU A;  4NYV A;  4CUS A;  4UIX A;  5DY7 A;  5DYA A;  5DFD A;  3JVM A;  5KTX A;  5CUG A;  5FH8 A;  4QY4 A;  5EPB A;  4A9H A;  4QNS A;  4N4I A;  5LKT A;  3NXB A;  5CY9 A;  3MB3 A;  5TCM A;  4YYD A;  3UVD A;  4CUT A;  5F61 A;  4NQM A;  4XUA A;  5KO4 A;  2KTB B;  2R0S A;  3MUK A;  1E6I A;  2RNX A;  2YEM A;  4O77 A;  5DKC A;  4YYK A;  4QST A;  4QSS A;  5E3D A;  4QR3 A;  4KCX A;  5FE7 A;  5ENB A;  4QYL A;  4LDF A;  4O70 A;  5COI A;  3Q2F A;  5I80 A;  4LYW A;  4N3W A;  5TB6 A;  4QSW A;  5C8G A;  4QZS A;  3RCW A;  5D3N A;  5EQ1 A;  5HEM A;  5I40 A;  4IR5 A;  5HFR A;  5CQ5 A;  4QSX A;  5A5R A;  2R0V A;  4ZQL A;  4BHW A;  5F60 A;  3U5O A;  2L84 A;  5ENH A;  5AD3 A;  3SVG A;  3QZV A;  4UIU A;  4YH3 A;  5D24 A;  4O74 A;  4NR9 A;  3LJW A;  3GG3 A;  4HXS A;  5EVA A;  3P1C A;  5HQ7 A;  5DKH A;  5D0C A;  5H85 A;  5HQ6 A;  4YYN A;  5ENE A;  5IGM A;  3U5N A;  2I8N A;  5L8T A;  5CGP A;  4OGJ A;  4PCE A;  5FE2 A;  5DW1 A;  4TU4 A;  5KHM A;  5EWD A;  1WUG A;  5C7N A;  4QEU A;  4CFL A;  5F36 A;  5HFQ A;  4YYG A;  5FH7 A;  3SVF A;  2DVV A;  5KTW A;  3ONI A;  4YAD A;  5FBX A;  5G4R A;  5HLS A;  3LXJ A;  3HMF A;  2F6N A;  4UYE A;  4LYS A;  5DYC A;  4YC9 A;  5A7C A;  3UVX A;  5FE1 A;  2N9G A;  5KTU A;  5IID A;  2RNY A;  4YYJ A;  4C66 A;  5CUD A;  4YYH A;  4XY8 A;  5L96 A;  5C4Q A;  4QSV A;  4CUP A;  5K29 A;  4MEN A;  2DKW A;  3HME A;  4QUT A;  3MXF A;  3UV4 A;  4O7B A;  4N4G A;  3FKM X;  5F62 A;  5ETD A;  4AKI A;  2OO1 A;  5E74 A;  4LZR A;  4NS5 A;  2RNW A;  5EV9 A;  5LJ1 A;  4QEV A;  5ETB A;  4YY6 A;  3K2J A;  4MEO A;  5CUB A;  3SVH A;  4NXJ A;  5DFC A;  2YDW A;  5ENJ A;  5CQ4 A;  5EWV A;  4ZC9 A;  3DAI A;  5CS8 A;  5CZG A;  5D3L A;  4TT2 A;  5CRM A;  2F6J A;  2L5E A;  4IR3 A;  2LSP B;  5G4S A;  4YBM A;  3MUL A;  4ZW1 A;  4QEW A;  5I1Q A;  4MR6 A;  5IBN A;  5IG6 A;  4MEQ A;  4LRG A;  4QB3 A;  4RVR A;  3JVJ A;  4YYI A;  4CL9 A;  3MB4 A;  3AAD A;  3U5J A;  2DAT A;  2YW5 A;  5FG4 A;  4UIV A;  4QSR A;  4A9L A;  1PUO A;  4TS8 A;  5C89 A;  5FE0 A;  4HXL A;  3S92 A;  5A82 A;  5DKD A;  2EJN A;  3U5M A;  4YY4 A;  5CU8 A;  5A5O A;  5FG6 A;  4BJX A;  5FFW A;  5E3G A;  5EPR A;  4Z6H A;  5E0R A;  2H60 A;  5CTL A;  5DYU A;  4TYL A;  5II1 A;  3UW9 A;  3UVY A;  2RO1 A;  4HXR A;  4TQN A;  3QZS A;  3VKH A;  5E9I A;  4QC3 A;  5A81 A;  4BW3 A;  4CLB A;  4MR5 A;  5EWW A;  5A5P A;  4QSU A;  2G4A A;  5DX4 A;  5E9K A;  2E7N A;  5A85 A;  3D7C A;  4NR8 A;  4AKN A;  4UIT A;  5D3R A;  3O37 A;  4O7C A;  4IR4 A;  4NUE A;  5IGN A;  3Q2E A;  4BW2 A;  5HCL A;  2OSS A;  2MJV B;  5LVR A;  5EP7 A;  4TTE A;  4QBM A;  4BW4 A;  4QYD A;  5E9Y A;  4A9E A;  4UYF B;  3P1D A;  5DBM A;  3O35 A;  4Q0N A;  5CQA A;  4YBS A;  4Z1S A;  3U5L A;  3MQM A;  4IOQ A;  2GRC A;  5CUE A;  4LR6 A;  5A83 A;  5L98 A;  5FE5 A;  3O33 A;  4OUF A;  5I89 A;  5DFB A;  5CQ7 A;  4HXP A;  5AME A;  2DWW A;  4UIZ A;  1N72 A;  5A5N A;  1F68 A;  4LZ2 A;  1ZKR A;  5JWM A;  4A9I A;  3AQA A;  3G0J A;  3TLP A;  3LQI A;  2D82 A;  5HJC A;  3JVK A;  2DVS A;  4WHW A;  5DW2 A;  5FB1 A;  5F63 A;  5LKX A;  5CQ3 A;  1X0J A;  2YQD A;  1WUM A;  4O72 A;  3G0L A;  4NYW A;  4TZ8 A;  4XY9 A;  5EIC A;  5AMF A;  4IOR A;  4HXN A;  4UIW A;  4NR6 A;  5LVQ A;  4NRA A;  4YYM A;  4NUD A;  5CFW A;  4YK0 A;  5D3P A;  4UYH A;  2FSA A;  5CQ6 A;  5HEL A;  5HEN A;  5FE4 A;  4LYI A;  4LZS A;  4CUQ A;  5HRV A;  4O71 A;  2YEK A;  4QR4 A;  4NYX A;  2WP2 A;  5FFV A;  5A5Q A;  5L99 A;  4HXK A;  4TT4 A;  5E7D A;  4Z6I A;  5FFY A;  2YEL A;  4QUU A;  5D7X A;  5E9V A;  4NR5 A;  3JVL A;  5ENF A;  4UIY A;  4ALH A;  2E7O A;  4J1P A;  4YAX A;  4AKH A;  2D9E A;  2RI7 A;  5HM0 A;  4N4H A;  5FE9 A;  5IGK A;  4HXO A;  4TT6 A;  5EI4 A;  4Z93 A;  4X2I A;  5L8U A;  4ALG A;  5I29 A;  2E3K A;  4Y03 A;  4KV1 A;  5D25 A;  4XYA A;  4O7E A;  5A5S A;  3P1E A;  4QSQ A;  5EK9 A;  5KU3 A;  3D1B A;  1JM4 B;  3P5O A;  5CRZ A;  5LJ2 A;  3ERR A;  4IOO A;  5EM3 A;  4HBW A;  5EA1 A;  5BT4 A;  5DYX A;  2L85 A;  5LKZ A;  5HRX A;  4PKL A;  4TZ2 A;  5F5Z A;  3ZYU A;  4Z1Q A;  4MR3 A;  5EWC A;  2R10 A;  5D3T A;  2DVR A;  4A9K A;  5I83 A;  3UV2 A;  5E9L A;  5L97 A;  4N4F A;  5LUU A;  2WP1 A;  4O76 A;  4OGI A;  4NR7 A;  4LC2 A;  3U5P A;  4XUB A;  4DON A;  4UYD A;  5D3S A;  4KV4 A;  2NXB A; 
#chains in the Genus database with same CATH homology
 4TU6 A;  3UV5 A;  5ENI A;  4E96 A;  4O7F A;  4NRC A;  3I3J A;  2I7K A;  4QR5 A;  4MR4 A;  3QZT A;  5D26 A;  4YAB A;  3IU6 A;  5E9M A;  5IGL A;  4O75 A;  3P1F A;  4CFK A;  5FE3 A;  5CQT A;  4NQN A;  5F3A A;  2RS9 B;  2DVQ A;  3DWY A;  3LQJ A;  3HMH A;  5I7Y A;  5CUA A;  5EGU A;  4IR6 A;  5J0D A;  3O34 A;  5F25 A;  4J0S A;  5ACY A;  2RFJ A;  4J0R A;  5EU1 A;  5ENG A;  5FB0 A;  5DLX A;  4A9F A;  5FG5 A;  3O36 A;  4HBY A;  5EPS A;  5H1U A;  2R0Y A;  5FH6 A;  5EWH A;  5DLZ A;  5ENC A;  5F1H A;  4PTB A;  4FLP A;  2YYN A;  5D3J A;  4BW1 A;  4GPJ A;  4YH4 A;  5D3H A;  4A9N A;  5HQ5 A;  3UVW A;  5BT3 A;  2OUO A;  4F3I A;  5H1V A;  1EQF A;  3S91 A;  4CUR A;  5C85 A;  4NR4 A;  4PCI A;  4CUU A;  5AD2 A;  3LQH A;  4YAT A;  5FE8 A;  1JSP B;  5F1L A;  4PS5 A;  4HBV A;  4WHU A;  4Q0O A;  4A9M A;  5BT5 A;  5H1T A;  4J3I A;  5E73 A;  4MEP A;  4YBT A;  1ZS5 A;  4QC1 A;  4HBX A;  5C87 A;  5LJ0 A;  3U5K A;  4PY6 A;  5FE6 A;  4HXM A;  5F2P A;  4NRB A;  4QSP A;  4UYF A;  4A9J A;  4A9O A;  5JI8 A;  4UYG A;  5CQ8 A;  5EIS A;  4NUC A;  5CP5 A;  5I7X A;  5I86 A;  4C67 A;  5FDZ A;  3IU5 A;  4O78 A;  5CPE A;  5CUC A;  5II2 A;  5HRW A;  5I88 A;  4O7A A;  4WIV A;  5LKU A;  4NYV A;  4CUS A;  4UIX A;  5DY7 A;  5DYA A;  5DFD A;  3JVM A;  5KTX A;  5CUG A;  5FH8 A;  4QY4 A;  5EPB A;  4A9H A;  4QNS A;  4N4I A;  5LKT A;  3NXB A;  5CY9 A;  3MB3 A;  5TCM A;  4YYD A;  3UVD A;  4CUT A;  5F61 A;  4NQM A;  4XUA A;  5KO4 A;  2KTB B;  2R0S A;  3MUK A;  1E6I A;  2RNX A;  2YEM A;  4O77 A;  5DKC A;  4YYK A;  4QST A;  4QSS A;  5E3D A;  4QR3 A;  4KCX A;  5FE7 A;  5ENB A;  4QYL A;  4LDF A;  4O70 A;  5COI A;  3Q2F A;  5I80 A;  4LYW A;  4N3W A;  5TB6 A;  4QSW A;  5C8G A;  4QZS A;  3RCW A;  5D3N A;  5EQ1 A;  5HEM A;  5I40 A;  4IR5 A;  5HFR A;  5CQ5 A;  4QSX A;  5A5R A;  2R0V A;  4ZQL A;  4BHW A;  5F60 A;  3U5O A;  2L84 A;  5ENH A;  5AD3 A;  3SVG A;  3QZV A;  4UIU A;  4YH3 A;  5D24 A;  4O74 A;  4NR9 A;  3LJW A;  3GG3 A;  4HXS A;  5EVA A;  3P1C A;  5HQ7 A;  5DKH A;  5D0C A;  5H85 A;  5HQ6 A;  4YYN A;  5ENE A;  5IGM A;  3U5N A;  2I8N A;  5L8T A;  5CGP A;  4OGJ A;  4PCE A;  5FE2 A;  5DW1 A;  4TU4 A;  5KHM A;  5EWD A;  1WUG A;  5C7N A;  4QEU A;  4CFL A;  5F36 A;  5HFQ A;  4YYG A;  5FH7 A;  3SVF A;  2DVV A;  5KTW A;  3ONI A;  4YAD A;  5FBX A;  5G4R A;  5HLS A;  3LXJ A;  3HMF A;  2F6N A;  4UYE A;  4LYS A;  5DYC A;  4YC9 A;  5A7C A;  3UVX A;  5FE1 A;  2N9G A;  5KTU A;  5IID A;  2RNY A;  4YYJ A;  4C66 A;  5CUD A;  4YYH A;  4XY8 A;  5L96 A;  5C4Q A;  4QSV A;  4CUP A;  5K29 A;  4MEN A;  2DKW A;  3HME A;  4QUT A;  3MXF A;  3UV4 A;  4O7B A;  4N4G A;  3FKM X;  5F62 A;  5ETD A;  2OO1 A;  5E74 A;  4LZR A;  4NS5 A;  2RNW A;  5EV9 A;  5LJ1 A;  4QEV A;  5ETB A;  4YY6 A;  3K2J A;  4MEO A;  5CUB A;  3SVH A;  4NXJ A;  5DFC A;  2YDW A;  5ENJ A;  5CQ4 A;  5EWV A;  4ZC9 A;  3DAI A;  5CS8 A;  5CZG A;  5D3L A;  4TT2 A;  5CRM A;  2F6J A;  2L5E A;  4IR3 A;  2LSP B;  5G4S A;  4YBM A;  3MUL A;  4ZW1 A;  4QEW A;  5I1Q A;  4MR6 A;  5IBN A;  5IG6 A;  4MEQ A;  4LRG A;  4QB3 A;  4RVR A;  3JVJ A;  4YYI A;  4CL9 A;  3MB4 A;  3AAD A;  3U5J A;  2DAT A;  2YW5 A;  5FG4 A;  4UIV A;  4QSR A;  4A9L A;  5C89 A;  4TS8 A;  5FE0 A;  4HXL A;  3S92 A;  5A82 A;  5DKD A;  3U5M A;  4YY4 A;  5CU8 A;  5A5O A;  5FG6 A;  4BJX A;  5FFW A;  5E3G A;  5EPR A;  4Z6H A;  5E0R A;  2H60 A;  5CTL A;  5DYU A;  4TYL A;  5II1 A;  3UW9 A;  3UVY A;  2RO1 A;  4HXR A;  4TQN A;  3QZS A;  5E9I A;  4QC3 A;  5A81 A;  4BW3 A;  4CLB A;  4MR5 A;  5EWW A;  5A5P A;  4QSU A;  2G4A A;  5DX4 A;  5E9K A;  2E7N A;  5A85 A;  3D7C A;  4NR8 A;  4AKN A;  4UIT A;  5D3R A;  3O37 A;  4O7C A;  4IR4 A;  4NUE A;  5IGN A;  3Q2E A;  4BW2 A;  5HCL A;  2OSS A;  2MJV B;  5LVR A;  5EP7 A;  4TTE A;  4QBM A;  4BW4 A;  4QYD A;  5E9Y A;  4A9E A;  4UYF B;  3P1D A;  5DBM A;  3O35 A;  4Q0N A;  5CQA A;  4YBS A;  4Z1S A;  3U5L A;  3MQM A;  4IOQ A;  2GRC A;  5CUE A;  4LR6 A;  5A83 A;  5L98 A;  5FE5 A;  3O33 A;  4OUF A;  5I89 A;  5DFB A;  5CQ7 A;  4HXP A;  5AME A;  2DWW A;  4UIZ A;  1N72 A;  5A5N A;  1F68 A;  4LZ2 A;  5JWM A;  4A9I A;  3AQA A;  3G0J A;  3TLP A;  3LQI A;  2D82 A;  5HJC A;  3JVK A;  2DVS A;  4WHW A;  5DW2 A;  5FB1 A;  5F63 A;  5LKX A;  5CQ3 A;  1X0J A;  2YQD A;  1WUM A;  4O72 A;  3G0L A;  4NYW A;  4TZ8 A;  4XY9 A;  5EIC A;  5AMF A;  4IOR A;  4HXN A;  4UIW A;  4NR6 A;  5LVQ A;  4NRA A;  4YYM A;  4NUD A;  5CFW A;  4YK0 A;  5D3P A;  4UYH A;  2FSA A;  5CQ6 A;  5HEL A;  5HEN A;  5FE4 A;  4LYI A;  4LZS A;  4CUQ A;  5HRV A;  4O71 A;  2YEK A;  4QR4 A;  4NYX A;  2WP2 A;  5FFV A;  5A5Q A;  5L99 A;  4HXK A;  4TT4 A;  5E7D A;  4Z6I A;  5FFY A;  2YEL A;  4QUU A;  5D7X A;  5E9V A;  4NR5 A;  3JVL A;  5ENF A;  4UIY A;  4ALH A;  2E7O A;  4J1P A;  4YAX A;  2D9E A;  2RI7 A;  5HM0 A;  4N4H A;  5FE9 A;  5IGK A;  4HXO A;  4TT6 A;  5EI4 A;  4Z93 A;  4X2I A;  5L8U A;  4ALG A;  5I29 A;  2E3K A;  4Y03 A;  4KV1 A;  5D25 A;  4XYA A;  4O7E A;  5A5S A;  3P1E A;  4QSQ A;  5EK9 A;  5KU3 A;  1JM4 B;  3P5O A;  5CRZ A;  5LJ2 A;  4IOO A;  5EM3 A;  4HBW A;  5EA1 A;  5BT4 A;  5DYX A;  2L85 A;  5LKZ A;  5HRX A;  4PKL A;  4TZ2 A;  5F5Z A;  3ZYU A;  4Z1Q A;  4MR3 A;  5EWC A;  2R10 A;  5D3T A;  2DVR A;  4A9K A;  5I83 A;  3UV2 A;  5E9L A;  5L97 A;  4N4F A;  5LUU A;  2WP1 A;  4O76 A;  4OGI A;  4NR7 A;  4LC2 A;  3U5P A;  4XUB A;  4DON A;  4UYD A;  5D3S A;  4KV4 A;  2NXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...