2DVQA

Crystal structure analysis of the n-terminal bromodomain of human brd2 complexed with acetylated histone h4 peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 2
publication title Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dvqA00
4XYAA 2I7KA 2YQDA 4O71A 5DFBA 3HMEA 3AADA 2L85A 5DX4A 5F61A 3DWYA 2OUOA 4YYNA 4NYWA 4UYHA 5HLSA 4QZSA 4HBWA 4UIWA 4YBMA 1X0JA 4DONA 4QSPA 5A85A 2G4AA 4O74A 5C7NA 2GRCA 5D3RA 3S91A 2DKWA 5E7DA 4A9LA 5I80A 5IG6A 5F2PA 5A7CA 5I29A 4XUAA 3SVFA 4WIVA 5CP5A 5FFYA 3ZYUA 4NXJA 4LZSA 5TB6A 5KTXA 5DYCA 5D3PA 4CUUA 4QSRA 1ZS5A 4LZ2A 4A9FA 5II2A 4UYFB 5COIA 4J0RA 2R0VA 4YC9A 4NRAA 5FE2A 5DW1A 4QSWA 5FH8A 5KTWA 4TZ2A 5E9IA 5L8TA 5A82A 4IR3A 4TT2A 5TCMA 5C4QA 3LXJA 3U5PA 3HMFA 3UVYA 4O7CA 5ENCA 5DFDA 4NS5A 5CUEA 4ZW1A 2E7NA 4MR5A 5FG5A 5E9MA 4YADA 5F62A 4YY6A 4A9HA 2YEMA 5CUCA 3SVGA 3Q2EA 4IR5A 4J0SA 5E9YA 5C87A 5BT4A 3UV5A 5FE8A 4MEQA 4NQNA 5DY7A 4TZ8A 5E73A 3MUKA 4YH4A 4YBSA 5A5RA 5EQ1A 2YELA 4HXLA 4AKNA 5F36A 5EU1A 3U5NA 4UYGA 4YAXA 4YBTA 3UVXA 5CY9A 4OGIA 4KV1A 5CFWA 5CQTA 5E9LA 4LYSA 3P5OA 5EVAA 3S92A 1JSPB 5IGLA 4HXRA 5CQ6A 4HXOA 5I40A 5FH7A 3JVJA 3HMHA 3D7CA 5A5OA 5F1LA 5HFQA 2RFJA 5ENHA 3RCWA 4HBYA 4QSQA 5LKXA 4TYLA 4NUEA 4Z93A 4NR5A 4BW2A 5A5QA 5HQ6A 5FFWA 4HBXA 4CURA 3GG3A 3QZVA 2DVQA 5J0DA 5IBNA 4A9KA 3P1CA 4IOOA 4LZRA 3TLPA 2RNXA 4CUSA 4J3IA 4YYDA 4N4FA 4UIYA 1JM4B 5EWHA 5EWDA 5D3HA 5IIDA 4HXSA 5DYUA 4HXKA 3JVKA 4A9EA 5H1TA 3P1FA 4A9OA 5CQ8A 5E3GA 4QSUA 2YYNA 5DKCA 4YH3A 4ZC9A 4PCEA 1EQFA 5FG4A 4CLBA 5K29A 5LKZA 4Y03A 5LVRA 4Q0NA 4PKLA 5E74A 4ALHA 5A83A 2I8NA 5EP7A 4LC2A 2E7OA 3ONIA 3U5OA 3P1DA 5ETBA 3IU6A 5HELA 2DWWA 2R10A 5CUBA 4HXMA 3MXFA 4HBVA 5CQAA 4O7BA 4BW1A 4UIVA 5EGUA 5HM0A 5F5ZA 2N9GA 4QSXA 2E3KA 2WP1A 4QR5A 4CFLA 4TQNA 5EICA 5JWMA 4QYLA 3UVDA 4PS5A 3P1EA 5HQ5A 4MEPA 4O72A 4O70A 2F6JA 4O76A 4UIUA 4WHWA 4ALGA 3O36A 5HEMA 1WUGA 4IR4A 4C66A 4QEWA 4TU4A 5FE9A 4LYIA 5G4SA 4GPJA 5D3JA 4MR6A 2DATA 4NUCA 5L98A 4YK0A 4MR4A 4CUTA 2RNWA 3QZSA 4F3IA 4LYWA 5HRWA 2D82A 3O37A 4UIXA 4YYMA 5C8GA 5LVQA 4QUUA 4WHUA 4N3WA 4NR4A 2R0SA 5CS8A 1N72A 5FH6A 4CL9A 4UITA 4QEVA 3UVWA 5CPEA 4IOQA 4CUPA 5KO4A 5ENEA 5HCLA 2RNYA 4QUTA 5DBMA 5L99A 1WUMA 4O7EA 2DVVA 4NR8A 3JVLA 5ACYA 4OGJA 5FE4A 4IORA 5L97A 5EI4A 3K2JA 4QC1A 5L96A 5I86A 4A9JA 4UYEA 4NYVA 5D3NA 4IR6A 4Z6IA 5AMEA 5I89A 5FE1A 3UW9A 3MQMA 4HXNA 4TU6A 5D24A 5KHMA 4QC3A 2L5EA 5IGMA 5E3DA 4O7AA 3IU5A 5EK9A 4QB3A 4MEOA 4QSVA 3MB3A 5EPSA 5CRZA 4BW4A 5JI8A 4YY4A 3UV2A 4NR6A 3JVMA 4BHWA 4TTEA 5CUDA 4QSTA 4XY8A 4QNSA 5FG6A 3G0LA 4QR4A 4PY6A 5CZGA 4N4IA 4TT4A 5ENIA 5ENBA 5KTUA 5EM3A 5FDZA 3O33A 5D3SA 5H85A 5CUAA 4J1PA 2H60A 4O78A 5I7XA 4HXPA 3QZTA 4KCXA 2OSSA 5LJ2A 5AD3A 3AQAA 5FE7A 4Z1QA 5I83A 5C85A 5CQ4A 5FE3A 4E96A 5EV9A 4KV4A 5E0RA 5I1QA 4NRCA 5CU8A 4PTBA 5DLZA 4YABA 4YYHA 5D25A 4Z1SA 5AMFA 4UYDA 5D3TA 5FBXA 4XY9A 2RI7A 5CQ3A 5DYXA 4LR6A 4YYJA 3DAIA 4CFKA 4LDFA 5IGKA 2DVSA 5FFVA 5DYAA 5DKHA 5F60A 4UIZA 3G0JA 5EWVA 5LKTA 5HRXA 3U5JA 5HFRA 2YW5A 2WP2A 4UYFA 5D3LA 4NQMA 5FE6A 2F6NA 5CUGA 5AD2A 2L84A 3U5KA 2DVRA 5CTLA 4C67A 5EISA 5LUUA 3LJWA 5CRMA 5EWCA 5D26A 5HRVA 5HJCA 4N4HA 5E9KA 5KU3A 5DW2A 5ENJA 2YEKA 4NR7A 2NXBA 4QBMA 4RVRA 4NRBA 5HQ7A 4QSSA 2R0YA 3O34A 5H1UA 4MR3A 5A81A 5EPBA 5F63A 5H1VA 4Z6HA 4YYIA 4QYDA 3NXBA 4BJXA 3O35A 5II1A 2RS9B 4TT6A 5CQ7A 5E9VA 5ENFA 4YYGA 5FB1A 3Q2FA 5LJ0A 5FE0A 5C89A 3FKMX 4O7FA 5CGPA 4YATA 1E6IA 4MENA 4NR9A 4O75A 5DKDA 5F1HA 5EA1A 3U5LA 3UV4A 5D0CA 5HENA 5G4RA 4QY4A 4OUFA 2FSAA 5F3AA 3LQJA 2YDWA 5CQ5A 3LQHA 3LQIA 3MB4A 1F68A 4CUQA 5D7XA 4A9NA 2RO1A 5A5SA 4XUBA 4LRGA 4PCIA 3U5MA 5L8UA 4NYXA 5DFCA 3MULA 3SVHA 4ZQLA 4X2IA 5EPRA 2KTBB 5BT5A 4TS8A 5EWWA 5LKUA 5LJ1A 5A5NA 5F25A 4NUDA 3I3JA 5I7YA 5ENGA 4FLPA 5A5PA 5BT3A 5DLXA 4QEUA 5FE5A 5ETDA 4N4GA 5FB0A 5IGNA 5I88A 4A9IA 4A9MA 4Q0OA 4BW3A 4O77A 2OO1A 2LSPB 4YYKA 2MJVB 4QR3A 2D9EA
chains in the Genus database with same CATH superfamily
4XYAA 2I7KA 2YQDA 4O71A 5DFBA 3HMEA 3AADA 2L85A 5DX4A 5F61A 3DWYA 2OUOA 4YYNA 4NYWA 4UYHA 5HLSA 4QZSA 4HBWA 4UIWA 4YBMA 1X0JA 4DONA 4QSPA 5A85A 2G4AA 4O74A 5C7NA 2GRCA 5D3RA 3S91A 2DKWA 5E7DA 4A9LA 5I80A 5IG6A 5F2PA 5A7CA 5I29A 4XUAA 3SVFA 4WIVA 5CP5A 5FFYA 3ZYUA 4NXJA 4LZSA 5TB6A 5KTXA 5DYCA 5D3PA 4CUUA 4QSRA 1ZS5A 4LZ2A 4A9FA 5II2A 4UYFB 5COIA 4J0RA 2R0VA 4YC9A 4NRAA 5FE2A 5DW1A 4QSWA 5FH8A 5KTWA 4TZ2A 5E9IA 5L8TA 5A82A 4IR3A 4TT2A 5TCMA 5C4QA 3LXJA 3U5PA 3HMFA 3UVYA 4O7CA 5ENCA 5DFDA 4NS5A 5CUEA 4ZW1A 2E7NA 4MR5A 5FG5A 5E9MA 4YADA 5F62A 4YY6A 4A9HA 2YEMA 5CUCA 3SVGA 3Q2EA 4IR5A 4J0SA 5E9YA 5C87A 5BT4A 3UV5A 5FE8A 4AKIA 4MEQA 4NQNA 5DY7A 4TZ8A 5E73A 3MUKA 4YH4A 4YBSA 5A5RA 5EQ1A 2YELA 4HXLA 4AKNA 5F36A 2EJNA 5EU1A 3U5NA 4UYGA 4YAXA 4YBTA 3UVXA 5CY9A 4OGIA 4KV1A 5CFWA 5CQTA 5E9LA 4LYSA 3P5OA 5EVAA 3S92A 1JSPB 5IGLA 4HXRA 5CQ6A 4HXOA 5I40A 5FH7A 3JVJA 3HMHA 3D7CA 5A5OA 5F1LA 5HFQA 2RFJA 5ENHA 3RCWA 4HBYA 4QSQA 5LKXA 4TYLA 4NUEA 4Z93A 4NR5A 4BW2A 5A5QA 5HQ6A 5FFWA 4HBXA 4CURA 3GG3A 3QZVA 2DVQA 5J0DA 5IBNA 4A9KA 3P1CA 4IOOA 4LZRA 3TLPA 2RNXA 4CUSA 4J3IA 4YYDA 4N4FA 4UIYA 1JM4B 5EWHA 5EWDA 5D3HA 5IIDA 4HXSA 5DYUA 4HXKA 3JVKA 4A9EA 5H1TA 3P1FA 4A9OA 5CQ8A 5E3GA 4QSUA 2YYNA 5DKCA 4YH3A 4ZC9A 4PCEA 1EQFA 5FG4A 4CLBA 5K29A 5LKZA 4Y03A 5LVRA 4Q0NA 4PKLA 5E74A 4ALHA 5A83A 2I8NA 5EP7A 4LC2A 2E7OA 3ONIA 3U5OA 3P1DA 5ETBA 3IU6A 5HELA 2DWWA 2R10A 5CUBA 4HXMA 3MXFA 4HBVA 5CQAA 4O7BA 4BW1A 4UIVA 5EGUA 5HM0A 5F5ZA 2N9GA 4QSXA 2E3KA 2WP1A 4QR5A 4CFLA 4TQNA 5EICA 5JWMA 4QYLA 3UVDA 3D1BA 4PS5A 3P1EA 5HQ5A 4MEPA 4O72A 4O70A 2F6JA 4O76A 4UIUA 4WHWA 4ALGA 3O36A 5HEMA 1WUGA 4IR4A 4C66A 4QEWA 4TU4A 5FE9A 4LYIA 5G4SA 4GPJA 5D3JA 4MR6A 2DATA 4NUCA 5L98A 4YK0A 4MR4A 4CUTA 3D1DA 2RNWA 3QZSA 4F3IA 4LYWA 5HRWA 2D82A 3O37A 4UIXA 4YYMA 5C8GA 5LVQA 4QUUA 4WHUA 4N3WA 4NR4A 2R0SA 5CS8A 1N72A 5FH6A 4CL9A 4UITA 4QEVA 3UVWA 5CPEA 4IOQA 4CUPA 5KO4A 5ENEA 5HCLA 2RNYA 4QUTA 5DBMA 5L99A 1ZKRA 1WUMA 4O7EA 2DVVA 4NR8A 3JVLA 5ACYA 4OGJA 5FE4A 4IORA 5L97A 5EI4A 3K2JA 4QC1A 5L96A 5I86A 4A9JA 4UYEA 4NYVA 5D3NA 4IR6A 4Z6IA 5AMEA 5I89A 5FE1A 3UW9A 3MQMA 4HXNA 4TU6A 5D24A 5KHMA 4QC3A 2L5EA 5IGMA 5E3DA 4O7AA 3IU5A 5EK9A 4QB3A 4MEOA 4QSVA 3MB3A 5EPSA 5CRZA 4BW4A 5JI8A 4YY4A 3UV2A 4NR6A 3JVMA 4BHWA 4TTEA 5CUDA 4QSTA 4XY8A 4QNSA 5FG6A 3G0LA 4QR4A 4PY6A 5CZGA 4N4IA 4TT4A 5ENIA 5ENBA 5KTUA 5EM3A 5FDZA 3O33A 5D3SA 5H85A 5CUAA 4J1PA 2H60A 4O78A 5I7XA 4HXPA 3QZTA 4KCXA 2OSSA 5LJ2A 5AD3A 3AQAA 5FE7A 4Z1QA 5I83A 5C85A 5CQ4A 5FE3A 4E96A 5EV9A 4KV4A 5E0RA 5I1QA 4NRCA 5CU8A 4PTBA 5DLZA 4YABA 4YYHA 5D25A 4Z1SA 5AMFA 4UYDA 5D3TA 5FBXA 4XY9A 2RI7A 5CQ3A 5DYXA 4LR6A 4YYJA 3VKGA 3DAIA 4CFKA 4LDFA 5IGKA 2DVSA 5FFVA 5DYAA 5DKHA 5F60A 4UIZA 3G0JA 5EWVA 5LKTA 5HRXA 3U5JA 5HFRA 2YW5A 2WP2A 3ERRA 4UYFA 5D3LA 4NQMA 5FE6A 2F6NA 5CUGA 5AD2A 2L84A 3U5KA 2DVRA 5CTLA 4C67A 5EISA 5LUUA 3LJWA 5CRMA 5EWCA 5D26A 5HRVA 5HJCA 4N4HA 5E9KA 5KU3A 5DW2A 5ENJA 2YEKA 4NR7A 2NXBA 4QBMA 4RVRA 4NRBA 5HQ7A 4QSSA 2R0YA 3O34A 5H1UA 4MR3A 5A81A 5EPBA 5F63A 5H1VA 4Z6HA 4YYIA 4QYDA 3NXBA 4BJXA 3O35A 5II1A 2RS9B 4TT6A 5CQ7A 5E9VA 5ENFA 4YYGA 5FB1A 3Q2FA 5LJ0A 5FE0A 5C89A 3FKMX 4O7FA 5CGPA 4YATA 1E6IA 4MENA 4NR9A 4O75A 5DKDA 5F1HA 5EA1A 3U5LA 3UV4A 5D0CA 5HENA 5G4RA 4QY4A 4OUFA 2FSAA 1PUOA 5F3AA 3LQJA 2YDWA 5CQ5A 3LQHA 3LQIA 3MB4A 4AKGA 1F68A 4CUQA 5D7XA 4A9NA 2RO1A 5A5SA 4XUBA 4LRGA 4PCIA 3U5MA 5L8UA 4NYXA 5DFCA 3MULA 3SVHA 4ZQLA 4X2IA 5EPRA 2KTBB 5BT5A 4TS8A 5EWWA 5LKUA 4AKHA 5LJ1A 5A5NA 5F25A 4NUDA 3I3JA 5I7YA 5ENGA 4FLPA 5A5PA 5BT3A 5DLXA 4QEUA 5FE5A 5ETDA 4N4GA 5FB0A 5IGNA 5I88A 4A9IA 4A9MA 3VKHA 4Q0OA 4BW3A 4O77A 4AI6A 2OO1A 2LSPB 4YYKA 2MJVB 4QR3A 2D9EA
chains in the Genus database with same CATH topology
4XYAA 2I7KA 2YQDA 4O71A 5DFBA 3HMEA 3AADA 2L85A 5DX4A 5F61A 3DWYA 2OUOA 4YYNA 4NYWA 4UYHA 5HLSA 4QZSA 4HBWA 4UIWA 4YBMA 1X0JA 4DONA 4QSPA 5A85A 2G4AA 4O74A 5C7NA 2GRCA 5D3RA 3S91A 2DKWA 5E7DA 4A9LA 5I80A 5IG6A 5F2PA 5A7CA 5I29A 4XUAA 3SVFA 4WIVA 5CP5A 5FFYA 3ZYUA 4NXJA 4LZSA 5TB6A 5KTXA 5DYCA 5D3PA 4CUUA 4QSRA 1ZS5A 4LZ2A 4A9FA 5II2A 4UYFB 5COIA 4J0RA 2R0VA 4YC9A 4NRAA 5FE2A 5DW1A 4QSWA 5FH8A 5KTWA 4TZ2A 5E9IA 5L8TA 5A82A 4IR3A 4TT2A 5TCMA 5C4QA 3LXJA 3U5PA 3HMFA 3UVYA 4O7CA 5ENCA 5DFDA 4NS5A 5CUEA 4ZW1A 2E7NA 4MR5A 5FG5A 5E9MA 4YADA 5F62A 4YY6A 4A9HA 2YEMA 5CUCA 3SVGA 3Q2EA 4IR5A 4J0SA 5E9YA 5C87A 5BT4A 3UV5A 5FE8A 4MEQA 4NQNA 5DY7A 4TZ8A 5E73A 3MUKA 4YH4A 4YBSA 5A5RA 5EQ1A 2YELA 4HXLA 4AKNA 5F36A 5EU1A 3U5NA 4UYGA 4YAXA 4YBTA 3UVXA 5CY9A 4OGIA 4KV1A 5CFWA 5CQTA 5E9LA 4LYSA 3P5OA 5EVAA 3S92A 1JSPB 5IGLA 4HXRA 5CQ6A 4HXOA 5I40A 5FH7A 3JVJA 3HMHA 3D7CA 5A5OA 5F1LA 5HFQA 2RFJA 5ENHA 3RCWA 4HBYA 4QSQA 5LKXA 4TYLA 4NUEA 4Z93A 4NR5A 4BW2A 5A5QA 5HQ6A 5FFWA 4HBXA 4CURA 3GG3A 3QZVA 2DVQA 5J0DA 5IBNA 4A9KA 3P1CA 4IOOA 4LZRA 3TLPA 2RNXA 4CUSA 4J3IA 4YYDA 4N4FA 4UIYA 1JM4B 5EWHA 5EWDA 5D3HA 5IIDA 4HXSA 5DYUA 4HXKA 3JVKA 4A9EA 5H1TA 3P1FA 4A9OA 5CQ8A 5E3GA 4QSUA 2YYNA 5DKCA 4YH3A 4ZC9A 4PCEA 1EQFA 5FG4A 4CLBA 5K29A 5LKZA 4Y03A 5LVRA 4Q0NA 4PKLA 5E74A 4ALHA 5A83A 2I8NA 5EP7A 4LC2A 2E7OA 3ONIA 3U5OA 3P1DA 5ETBA 3IU6A 5HELA 2DWWA 2R10A 5CUBA 4HXMA 3MXFA 4HBVA 5CQAA 4O7BA 4BW1A 4UIVA 5EGUA 5HM0A 5F5ZA 2N9GA 4QSXA 2E3KA 2WP1A 4QR5A 4CFLA 4TQNA 5EICA 5JWMA 4QYLA 3UVDA 4PS5A 3P1EA 5HQ5A 4MEPA 4O72A 4O70A 2F6JA 4O76A 4UIUA 4WHWA 4ALGA 3O36A 5HEMA 1WUGA 4IR4A 4C66A 4QEWA 4TU4A 5FE9A 4LYIA 5G4SA 4GPJA 5D3JA 4MR6A 2DATA 4NUCA 5L98A 4YK0A 4MR4A 4CUTA 2RNWA 3QZSA 4F3IA 4LYWA 5HRWA 2D82A 3O37A 4UIXA 4YYMA 5C8GA 5LVQA 4QUUA 4WHUA 4N3WA 4NR4A 2R0SA 5CS8A 1N72A 5FH6A 4CL9A 4UITA 4QEVA 3UVWA 5CPEA 4IOQA 4CUPA 5KO4A 5ENEA 5HCLA 2RNYA 4QUTA 5DBMA 5L99A 1WUMA 4O7EA 2DVVA 4NR8A 3JVLA 5ACYA 4OGJA 5FE4A 4IORA 5L97A 5EI4A 3K2JA 4QC1A 5L96A 5I86A 4A9JA 4UYEA 4NYVA 5D3NA 4IR6A 4Z6IA 5AMEA 5I89A 5FE1A 3UW9A 3MQMA 4HXNA 4TU6A 5D24A 5KHMA 4QC3A 2L5EA 5IGMA 5E3DA 4O7AA 3IU5A 5EK9A 4QB3A 4MEOA 4QSVA 3MB3A 5EPSA 5CRZA 4BW4A 5JI8A 4YY4A 3UV2A 4NR6A 3JVMA 4BHWA 4TTEA 5CUDA 4QSTA 4XY8A 4QNSA 5FG6A 3G0LA 4QR4A 4PY6A 5CZGA 4N4IA 4TT4A 5ENIA 5ENBA 5KTUA 5EM3A 5FDZA 3O33A 5D3SA 5H85A 5CUAA 4J1PA 2H60A 4O78A 5I7XA 4HXPA 3QZTA 4KCXA 2OSSA 5LJ2A 5AD3A 3AQAA 5FE7A 4Z1QA 5I83A 5C85A 5CQ4A 5FE3A 4E96A 5EV9A 4KV4A 5E0RA 5I1QA 4NRCA 5CU8A 4PTBA 5DLZA 4YABA 4YYHA 5D25A 4Z1SA 5AMFA 4UYDA 5D3TA 5FBXA 4XY9A 2RI7A 5CQ3A 5DYXA 4LR6A 4YYJA 3DAIA 4CFKA 4LDFA 5IGKA 2DVSA 5FFVA 5DYAA 5DKHA 5F60A 4UIZA 3G0JA 5EWVA 5LKTA 5HRXA 3U5JA 5HFRA 2YW5A 2WP2A 4UYFA 5D3LA 4NQMA 5FE6A 2F6NA 5CUGA 5AD2A 2L84A 3U5KA 2DVRA 5CTLA 4C67A 5EISA 5LUUA 3LJWA 5CRMA 5EWCA 5D26A 5HRVA 5HJCA 4N4HA 5E9KA 5KU3A 5DW2A 5ENJA 2YEKA 4NR7A 2NXBA 4QBMA 4RVRA 4NRBA 5HQ7A 4QSSA 2R0YA 3O34A 5H1UA 4MR3A 5A81A 5EPBA 5F63A 5H1VA 4Z6HA 4YYIA 4QYDA 3NXBA 4BJXA 3O35A 5II1A 2RS9B 4TT6A 5CQ7A 5E9VA 5ENFA 4YYGA 5FB1A 3Q2FA 5LJ0A 5FE0A 5C89A 3FKMX 4O7FA 5CGPA 4YATA 1E6IA 4MENA 4NR9A 4O75A 5DKDA 5F1HA 5EA1A 3U5LA 3UV4A 5D0CA 5HENA 5G4RA 4QY4A 4OUFA 2FSAA 5F3AA 3LQJA 2YDWA 5CQ5A 3LQHA 3LQIA 3MB4A 1F68A 4CUQA 5D7XA 4A9NA 2RO1A 5A5SA 4XUBA 4LRGA 4PCIA 3U5MA 5L8UA 4NYXA 5DFCA 3MULA 3SVHA 4ZQLA 4X2IA 5EPRA 2KTBB 5BT5A 4TS8A 5EWWA 5LKUA 5LJ1A 5A5NA 5F25A 4NUDA 3I3JA 5I7YA 5ENGA 4FLPA 5A5PA 5BT3A 5DLXA 4QEUA 5FE5A 5ETDA 4N4GA 5FB0A 5IGNA 5I88A 4A9IA 4A9MA 4Q0OA 4BW3A 4O77A 2OO1A 2LSPB 4YYKA 2MJVB 4QR3A 2D9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYA A;  2I7K A;  2YQD A;  4O71 A;  5DFB A;  3HME A;  3AAD A;  2L85 A;  5DX4 A;  5F61 A;  3DWY A;  2OUO A;  4YYN A;  4NYW A;  4UYH A;  5HLS A;  4QZS A;  4HBW A;  4UIW A;  4YBM A;  1X0J A;  4DON A;  4QSP A;  5A85 A;  2G4A A;  4O74 A;  5C7N A;  2GRC A;  5D3R A;  3S91 A;  2DKW A;  5E7D A;  4A9L A;  5I80 A;  5IG6 A;  5F2P A;  5A7C A;  5I29 A;  4XUA A;  3SVF A;  4WIV A;  5CP5 A;  5FFY A;  3ZYU A;  4NXJ A;  4LZS A;  5TB6 A;  5KTX A;  5DYC A;  5D3P A;  4CUU A;  4QSR A;  1ZS5 A;  4LZ2 A;  4A9F A;  5II2 A;  4UYF B;  5COI A;  4J0R A;  2R0V A;  4YC9 A;  4NRA A;  5FE2 A;  5DW1 A;  4QSW A;  5FH8 A;  5KTW A;  4TZ2 A;  5E9I A;  5L8T A;  5A82 A;  4IR3 A;  4TT2 A;  5TCM A;  5C4Q A;  3LXJ A;  3U5P A;  3HMF A;  3UVY A;  4O7C A;  5ENC A;  5DFD A;  4NS5 A;  5CUE A;  4ZW1 A;  2E7N A;  4MR5 A;  5FG5 A;  5E9M A;  4YAD A;  5F62 A;  4YY6 A;  4A9H A;  2YEM A;  5CUC A;  3SVG A;  3Q2E A;  4IR5 A;  4J0S A;  5E9Y A;  5C87 A;  5BT4 A;  3UV5 A;  5FE8 A;  4MEQ A;  4NQN A;  5DY7 A;  4TZ8 A;  5E73 A;  3MUK A;  4YH4 A;  4YBS A;  5A5R A;  5EQ1 A;  2YEL A;  4HXL A;  4AKN A;  5F36 A;  5EU1 A;  3U5N A;  4UYG A;  4YAX A;  4YBT A;  3UVX A;  5CY9 A;  4OGI A;  4KV1 A;  5CFW A;  5CQT A;  5E9L A;  4LYS A;  3P5O A;  5EVA A;  3S92 A;  1JSP B;  5IGL A;  4HXR A;  5CQ6 A;  4HXO A;  5I40 A;  5FH7 A;  3JVJ A;  3HMH A;  3D7C A;  5A5O A;  5F1L A;  5HFQ A;  2RFJ A;  5ENH A;  3RCW A;  4HBY A;  4QSQ A;  5LKX A;  4TYL A;  4NUE A;  4Z93 A;  4NR5 A;  4BW2 A;  5A5Q A;  5HQ6 A;  5FFW A;  4HBX A;  4CUR A;  3GG3 A;  3QZV A;  2DVQ A;  5J0D A;  5IBN A;  4A9K A;  3P1C A;  4IOO A;  4LZR A;  3TLP A;  2RNX A;  4CUS A;  4J3I A;  4YYD A;  4N4F A;  4UIY A;  1JM4 B;  5EWH A;  5EWD A;  5D3H A;  5IID A;  4HXS A;  5DYU A;  4HXK A;  3JVK A;  4A9E A;  5H1T A;  3P1F A;  4A9O A;  5CQ8 A;  5E3G A;  4QSU A;  2YYN A;  5DKC A;  4YH3 A;  4ZC9 A;  4PCE A;  1EQF A;  5FG4 A;  4CLB A;  5K29 A;  5LKZ A;  4Y03 A;  5LVR A;  4Q0N A;  4PKL A;  5E74 A;  4ALH A;  5A83 A;  2I8N A;  5EP7 A;  4LC2 A;  2E7O A;  3ONI A;  3U5O A;  3P1D A;  5ETB A;  3IU6 A;  5HEL A;  2DWW A;  2R10 A;  5CUB A;  4HXM A;  3MXF A;  4HBV A;  5CQA A;  4O7B A;  4BW1 A;  4UIV A;  5EGU A;  5HM0 A;  5F5Z A;  2N9G A;  4QSX A;  2E3K A;  2WP1 A;  4QR5 A;  4CFL A;  4TQN A;  5EIC A;  5JWM A;  4QYL A;  3UVD A;  4PS5 A;  3P1E A;  5HQ5 A;  4MEP A;  4O72 A;  4O70 A;  2F6J A;  4O76 A;  4UIU A;  4WHW A;  4ALG A;  3O36 A;  5HEM A;  1WUG A;  4IR4 A;  4C66 A;  4QEW A;  4TU4 A;  5FE9 A;  4LYI A;  5G4S A;  4GPJ A;  5D3J A;  4MR6 A;  2DAT A;  4NUC A;  5L98 A;  4YK0 A;  4MR4 A;  4CUT A;  2RNW A;  3QZS A;  4F3I A;  4LYW A;  5HRW A;  2D82 A;  3O37 A;  4UIX A;  4YYM A;  5C8G A;  5LVQ A;  4QUU A;  4WHU A;  4N3W A;  4NR4 A;  2R0S A;  5CS8 A;  1N72 A;  5FH6 A;  4CL9 A;  4UIT A;  4QEV A;  3UVW A;  5CPE A;  4IOQ A;  4CUP A;  5KO4 A;  5ENE A;  5HCL A;  2RNY A;  4QUT A;  5DBM A;  5L99 A;  1WUM A;  4O7E A;  2DVV A;  4NR8 A;  3JVL A;  5ACY A;  4OGJ A;  5FE4 A;  4IOR A;  5L97 A;  5EI4 A;  3K2J A;  4QC1 A;  5L96 A;  5I86 A;  4A9J A;  4UYE A;  4NYV A;  5D3N A;  4IR6 A;  4Z6I A;  5AME A;  5I89 A;  5FE1 A;  3UW9 A;  3MQM A;  4HXN A;  4TU6 A;  5D24 A;  5KHM A;  4QC3 A;  2L5E A;  5IGM A;  5E3D A;  4O7A A;  3IU5 A;  5EK9 A;  4QB3 A;  4MEO A;  4QSV A;  3MB3 A;  5EPS A;  5CRZ A;  4BW4 A;  5JI8 A;  4YY4 A;  3UV2 A;  4NR6 A;  3JVM A;  4BHW A;  4TTE A;  5CUD A;  4QST A;  4XY8 A;  4QNS A;  5FG6 A;  3G0L A;  4QR4 A;  4PY6 A;  5CZG A;  4N4I A;  4TT4 A;  5ENI A;  5ENB A;  5KTU A;  5EM3 A;  5FDZ A;  3O33 A;  5D3S A;  5H85 A;  5CUA A;  4J1P A;  2H60 A;  4O78 A;  5I7X A;  4HXP A;  3QZT A;  4KCX A;  2OSS A;  5LJ2 A;  5AD3 A;  3AQA A;  5FE7 A;  4Z1Q A;  5I83 A;  5C85 A;  5CQ4 A;  5FE3 A;  4E96 A;  5EV9 A;  4KV4 A;  5E0R A;  5I1Q A;  4NRC A;  5CU8 A;  4PTB A;  5DLZ A;  4YAB A;  4YYH A;  5D25 A;  4Z1S A;  5AMF A;  4UYD A;  5D3T A;  5FBX A;  4XY9 A;  2RI7 A;  5CQ3 A;  5DYX A;  4LR6 A;  4YYJ A;  3DAI A;  4CFK A;  4LDF A;  5IGK A;  2DVS A;  5FFV A;  5DYA A;  5DKH A;  5F60 A;  4UIZ A;  3G0J A;  5EWV A;  5LKT A;  5HRX A;  3U5J A;  5HFR A;  2YW5 A;  2WP2 A;  4UYF A;  5D3L A;  4NQM A;  5FE6 A;  2F6N A;  5CUG A;  5AD2 A;  2L84 A;  3U5K A;  2DVR A;  5CTL A;  4C67 A;  5EIS A;  5LUU A;  3LJW A;  5CRM A;  5EWC A;  5D26 A;  5HRV A;  5HJC A;  4N4H A;  5E9K A;  5KU3 A;  5DW2 A;  5ENJ A;  2YEK A;  4NR7 A;  2NXB A;  4QBM A;  4RVR A;  4NRB A;  5HQ7 A;  4QSS A;  2R0Y A;  3O34 A;  5H1U A;  4MR3 A;  5A81 A;  5EPB A;  5F63 A;  5H1V A;  4Z6H A;  4YYI A;  4QYD A;  3NXB A;  4BJX A;  3O35 A;  5II1 A;  2RS9 B;  4TT6 A;  5CQ7 A;  5E9V A;  5ENF A;  4YYG A;  5FB1 A;  3Q2F A;  5LJ0 A;  5FE0 A;  5C89 A;  3FKM X;  4O7F A;  5CGP A;  4YAT A;  1E6I A;  4MEN A;  4NR9 A;  4O75 A;  5DKD A;  5F1H A;  5EA1 A;  3U5L A;  3UV4 A;  5D0C A;  5HEN A;  5G4R A;  4QY4 A;  4OUF A;  2FSA A;  5F3A A;  3LQJ A;  2YDW A;  5CQ5 A;  3LQH A;  3LQI A;  3MB4 A;  1F68 A;  4CUQ A;  5D7X A;  4A9N A;  2RO1 A;  5A5S A;  4XUB A;  4LRG A;  4PCI A;  3U5M A;  5L8U A;  4NYX A;  5DFC A;  3MUL A;  3SVH A;  4ZQL A;  4X2I A;  5EPR A;  2KTB B;  5BT5 A;  4TS8 A;  5EWW A;  5LKU A;  5LJ1 A;  5A5N A;  5F25 A;  4NUD A;  3I3J A;  5I7Y A;  5ENG A;  4FLP A;  5A5P A;  5BT3 A;  5DLX A;  4QEU A;  5FE5 A;  5ETD A;  4N4G A;  5FB0 A;  5IGN A;  5I88 A;  4A9I A;  4A9M A;  4Q0O A;  4BW3 A;  4O77 A;  2OO1 A;  2LSP B;  4YYK A;  2MJV B;  4QR3 A;  2D9E A; 
#chains in the Genus database with same CATH topology
 4XYA A;  2I7K A;  2YQD A;  4O71 A;  5DFB A;  3HME A;  3AAD A;  2L85 A;  5DX4 A;  5F61 A;  3DWY A;  2OUO A;  4YYN A;  4NYW A;  4UYH A;  5HLS A;  4QZS A;  4HBW A;  4UIW A;  4YBM A;  1X0J A;  4DON A;  4QSP A;  5A85 A;  2G4A A;  4O74 A;  5C7N A;  2GRC A;  5D3R A;  3S91 A;  2DKW A;  5E7D A;  4A9L A;  5I80 A;  5IG6 A;  5F2P A;  5A7C A;  5I29 A;  4XUA A;  3SVF A;  4WIV A;  5CP5 A;  5FFY A;  3ZYU A;  4NXJ A;  4LZS A;  5TB6 A;  5KTX A;  5DYC A;  5D3P A;  4CUU A;  4QSR A;  1ZS5 A;  4LZ2 A;  4A9F A;  5II2 A;  4UYF B;  5COI A;  4J0R A;  2R0V A;  4YC9 A;  4NRA A;  5FE2 A;  5DW1 A;  4QSW A;  5FH8 A;  5KTW A;  4TZ2 A;  5E9I A;  5L8T A;  5A82 A;  4IR3 A;  4TT2 A;  5TCM A;  5C4Q A;  3LXJ A;  3U5P A;  3HMF A;  3UVY A;  4O7C A;  5ENC A;  5DFD A;  4NS5 A;  5CUE A;  4ZW1 A;  2E7N A;  4MR5 A;  5FG5 A;  5E9M A;  4YAD A;  5F62 A;  4YY6 A;  4A9H A;  2YEM A;  5CUC A;  3SVG A;  3Q2E A;  4IR5 A;  4J0S A;  5E9Y A;  5C87 A;  5BT4 A;  3UV5 A;  5FE8 A;  4AKI A;  4MEQ A;  4NQN A;  5DY7 A;  4TZ8 A;  5E73 A;  3MUK A;  4YH4 A;  4YBS A;  5A5R A;  5EQ1 A;  2YEL A;  4HXL A;  4AKN A;  5F36 A;  2EJN A;  5EU1 A;  3U5N A;  4UYG A;  4YAX A;  4YBT A;  3UVX A;  5CY9 A;  4OGI A;  4KV1 A;  5CFW A;  5CQT A;  5E9L A;  4LYS A;  3P5O A;  5EVA A;  3S92 A;  1JSP B;  5IGL A;  4HXR A;  5CQ6 A;  4HXO A;  5I40 A;  5FH7 A;  3JVJ A;  3HMH A;  3D7C A;  5A5O A;  5F1L A;  5HFQ A;  2RFJ A;  5ENH A;  3RCW A;  4HBY A;  4QSQ A;  5LKX A;  4TYL A;  4NUE A;  4Z93 A;  4NR5 A;  4BW2 A;  5A5Q A;  5HQ6 A;  5FFW A;  4HBX A;  4CUR A;  3GG3 A;  3QZV A;  2DVQ A;  5J0D A;  5IBN A;  4A9K A;  3P1C A;  4IOO A;  4LZR A;  3TLP A;  2RNX A;  4CUS A;  4J3I A;  4YYD A;  4N4F A;  4UIY A;  1JM4 B;  5EWH A;  5EWD A;  5D3H A;  5IID A;  4HXS A;  5DYU A;  4HXK A;  3JVK A;  4A9E A;  5H1T A;  3P1F A;  4A9O A;  5CQ8 A;  5E3G A;  4QSU A;  2YYN A;  5DKC A;  4YH3 A;  4ZC9 A;  4PCE A;  1EQF A;  5FG4 A;  4CLB A;  5K29 A;  5LKZ A;  4Y03 A;  5LVR A;  4Q0N A;  4PKL A;  5E74 A;  4ALH A;  5A83 A;  2I8N A;  5EP7 A;  4LC2 A;  2E7O A;  3ONI A;  3U5O A;  3P1D A;  5ETB A;  3IU6 A;  5HEL A;  2DWW A;  2R10 A;  5CUB A;  4HXM A;  3MXF A;  4HBV A;  5CQA A;  4O7B A;  4BW1 A;  4UIV A;  5EGU A;  5HM0 A;  5F5Z A;  2N9G A;  4QSX A;  2E3K A;  2WP1 A;  4QR5 A;  4CFL A;  4TQN A;  5EIC A;  5JWM A;  4QYL A;  3UVD A;  3D1B A;  4PS5 A;  3P1E A;  5HQ5 A;  4MEP A;  4O72 A;  4O70 A;  2F6J A;  4O76 A;  4UIU A;  4WHW A;  4ALG A;  3O36 A;  5HEM A;  1WUG A;  4IR4 A;  4C66 A;  4QEW A;  4TU4 A;  5FE9 A;  4LYI A;  5G4S A;  4GPJ A;  5D3J A;  4MR6 A;  2DAT A;  4NUC A;  5L98 A;  4YK0 A;  4MR4 A;  4CUT A;  3D1D A;  2RNW A;  3QZS A;  4F3I A;  4LYW A;  5HRW A;  2D82 A;  3O37 A;  4UIX A;  4YYM A;  5C8G A;  5LVQ A;  4QUU A;  4WHU A;  4N3W A;  4NR4 A;  2R0S A;  5CS8 A;  1N72 A;  5FH6 A;  4CL9 A;  4UIT A;  4QEV A;  3UVW A;  5CPE A;  4IOQ A;  4CUP A;  5KO4 A;  5ENE A;  5HCL A;  2RNY A;  4QUT A;  5DBM A;  5L99 A;  1ZKR A;  1WUM A;  4O7E A;  2DVV A;  4NR8 A;  3JVL A;  5ACY A;  4OGJ A;  5FE4 A;  4IOR A;  5L97 A;  5EI4 A;  3K2J A;  4QC1 A;  5L96 A;  5I86 A;  4A9J A;  4UYE A;  4NYV A;  5D3N A;  4IR6 A;  4Z6I A;  5AME A;  5I89 A;  5FE1 A;  3UW9 A;  3MQM A;  4HXN A;  4TU6 A;  5D24 A;  5KHM A;  4QC3 A;  2L5E A;  5IGM A;  5E3D A;  4O7A A;  3IU5 A;  5EK9 A;  4QB3 A;  4MEO A;  4QSV A;  3MB3 A;  5EPS A;  5CRZ A;  4BW4 A;  5JI8 A;  4YY4 A;  3UV2 A;  4NR6 A;  3JVM A;  4BHW A;  4TTE A;  5CUD A;  4QST A;  4XY8 A;  4QNS A;  5FG6 A;  3G0L A;  4QR4 A;  4PY6 A;  5CZG A;  4N4I A;  4TT4 A;  5ENI A;  5ENB A;  5KTU A;  5EM3 A;  5FDZ A;  3O33 A;  5D3S A;  5H85 A;  5CUA A;  4J1P A;  2H60 A;  4O78 A;  5I7X A;  4HXP A;  3QZT A;  4KCX A;  2OSS A;  5LJ2 A;  5AD3 A;  3AQA A;  5FE7 A;  4Z1Q A;  5I83 A;  5C85 A;  5CQ4 A;  5FE3 A;  4E96 A;  5EV9 A;  4KV4 A;  5E0R A;  5I1Q A;  4NRC A;  5CU8 A;  4PTB A;  5DLZ A;  4YAB A;  4YYH A;  5D25 A;  4Z1S A;  5AMF A;  4UYD A;  5D3T A;  5FBX A;  4XY9 A;  2RI7 A;  5CQ3 A;  5DYX A;  4LR6 A;  4YYJ A;  3VKG A;  3DAI A;  4CFK A;  4LDF A;  5IGK A;  2DVS A;  5FFV A;  5DYA A;  5DKH A;  5F60 A;  4UIZ A;  3G0J A;  5EWV A;  5LKT A;  5HRX A;  3U5J A;  5HFR A;  2YW5 A;  2WP2 A;  3ERR A;  4UYF A;  5D3L A;  4NQM A;  5FE6 A;  2F6N A;  5CUG A;  5AD2 A;  2L84 A;  3U5K A;  2DVR A;  5CTL A;  4C67 A;  5EIS A;  5LUU A;  3LJW A;  5CRM A;  5EWC A;  5D26 A;  5HRV A;  5HJC A;  4N4H A;  5E9K A;  5KU3 A;  5DW2 A;  5ENJ A;  2YEK A;  4NR7 A;  2NXB A;  4QBM A;  4RVR A;  4NRB A;  5HQ7 A;  4QSS A;  2R0Y A;  3O34 A;  5H1U A;  4MR3 A;  5A81 A;  5EPB A;  5F63 A;  5H1V A;  4Z6H A;  4YYI A;  4QYD A;  3NXB A;  4BJX A;  3O35 A;  5II1 A;  2RS9 B;  4TT6 A;  5CQ7 A;  5E9V A;  5ENF A;  4YYG A;  5FB1 A;  3Q2F A;  5LJ0 A;  5FE0 A;  5C89 A;  3FKM X;  4O7F A;  5CGP A;  4YAT A;  1E6I A;  4MEN A;  4NR9 A;  4O75 A;  5DKD A;  5F1H A;  5EA1 A;  3U5L A;  3UV4 A;  5D0C A;  5HEN A;  5G4R A;  4QY4 A;  4OUF A;  2FSA A;  1PUO A;  5F3A A;  3LQJ A;  2YDW A;  5CQ5 A;  3LQH A;  3LQI A;  3MB4 A;  4AKG A;  1F68 A;  4CUQ A;  5D7X A;  4A9N A;  2RO1 A;  5A5S A;  4XUB A;  4LRG A;  4PCI A;  3U5M A;  5L8U A;  4NYX A;  5DFC A;  3MUL A;  3SVH A;  4ZQL A;  4X2I A;  5EPR A;  2KTB B;  5BT5 A;  4TS8 A;  5EWW A;  5LKU A;  4AKH A;  5LJ1 A;  5A5N A;  5F25 A;  4NUD A;  3I3J A;  5I7Y A;  5ENG A;  4FLP A;  5A5P A;  5BT3 A;  5DLX A;  4QEU A;  5FE5 A;  5ETD A;  4N4G A;  5FB0 A;  5IGN A;  5I88 A;  4A9I A;  4A9M A;  3VKH A;  4Q0O A;  4BW3 A;  4O77 A;  4AI6 A;  2OO1 A;  2LSP B;  4YYK A;  2MJV B;  4QR3 A;  2D9E A; 
#chains in the Genus database with same CATH homology
 4XYA A;  2I7K A;  2YQD A;  4O71 A;  5DFB A;  3HME A;  3AAD A;  2L85 A;  5DX4 A;  5F61 A;  3DWY A;  2OUO A;  4YYN A;  4NYW A;  4UYH A;  5HLS A;  4QZS A;  4HBW A;  4UIW A;  4YBM A;  1X0J A;  4DON A;  4QSP A;  5A85 A;  2G4A A;  4O74 A;  5C7N A;  2GRC A;  5D3R A;  3S91 A;  2DKW A;  5E7D A;  4A9L A;  5I80 A;  5IG6 A;  5F2P A;  5A7C A;  5I29 A;  4XUA A;  3SVF A;  4WIV A;  5CP5 A;  5FFY A;  3ZYU A;  4NXJ A;  4LZS A;  5TB6 A;  5KTX A;  5DYC A;  5D3P A;  4CUU A;  4QSR A;  1ZS5 A;  4LZ2 A;  4A9F A;  5II2 A;  4UYF B;  5COI A;  4J0R A;  2R0V A;  4YC9 A;  4NRA A;  5FE2 A;  5DW1 A;  4QSW A;  5FH8 A;  5KTW A;  4TZ2 A;  5E9I A;  5L8T A;  5A82 A;  4IR3 A;  4TT2 A;  5TCM A;  5C4Q A;  3LXJ A;  3U5P A;  3HMF A;  3UVY A;  4O7C A;  5ENC A;  5DFD A;  4NS5 A;  5CUE A;  4ZW1 A;  2E7N A;  4MR5 A;  5FG5 A;  5E9M A;  4YAD A;  5F62 A;  4YY6 A;  4A9H A;  2YEM A;  5CUC A;  3SVG A;  3Q2E A;  4IR5 A;  4J0S A;  5E9Y A;  5C87 A;  5BT4 A;  3UV5 A;  5FE8 A;  4MEQ A;  4NQN A;  5DY7 A;  4TZ8 A;  5E73 A;  3MUK A;  4YH4 A;  4YBS A;  5A5R A;  5EQ1 A;  2YEL A;  4HXL A;  4AKN A;  5F36 A;  5EU1 A;  3U5N A;  4UYG A;  4YAX A;  4YBT A;  3UVX A;  5CY9 A;  4OGI A;  4KV1 A;  5CFW A;  5CQT A;  5E9L A;  4LYS A;  3P5O A;  5EVA A;  3S92 A;  1JSP B;  5IGL A;  4HXR A;  5CQ6 A;  4HXO A;  5I40 A;  5FH7 A;  3JVJ A;  3HMH A;  3D7C A;  5A5O A;  5F1L A;  5HFQ A;  2RFJ A;  5ENH A;  3RCW A;  4HBY A;  4QSQ A;  5LKX A;  4TYL A;  4NUE A;  4Z93 A;  4NR5 A;  4BW2 A;  5A5Q A;  5HQ6 A;  5FFW A;  4HBX A;  4CUR A;  3GG3 A;  3QZV A;  2DVQ A;  5J0D A;  5IBN A;  4A9K A;  3P1C A;  4IOO A;  4LZR A;  3TLP A;  2RNX A;  4CUS A;  4J3I A;  4YYD A;  4N4F A;  4UIY A;  1JM4 B;  5EWH A;  5EWD A;  5D3H A;  5IID A;  4HXS A;  5DYU A;  4HXK A;  3JVK A;  4A9E A;  5H1T A;  3P1F A;  4A9O A;  5CQ8 A;  5E3G A;  4QSU A;  2YYN A;  5DKC A;  4YH3 A;  4ZC9 A;  4PCE A;  1EQF A;  5FG4 A;  4CLB A;  5K29 A;  5LKZ A;  4Y03 A;  5LVR A;  4Q0N A;  4PKL A;  5E74 A;  4ALH A;  5A83 A;  2I8N A;  5EP7 A;  4LC2 A;  2E7O A;  3ONI A;  3U5O A;  3P1D A;  5ETB A;  3IU6 A;  5HEL A;  2DWW A;  2R10 A;  5CUB A;  4HXM A;  3MXF A;  4HBV A;  5CQA A;  4O7B A;  4BW1 A;  4UIV A;  5EGU A;  5HM0 A;  5F5Z A;  2N9G A;  4QSX A;  2E3K A;  2WP1 A;  4QR5 A;  4CFL A;  4TQN A;  5EIC A;  5JWM A;  4QYL A;  3UVD A;  4PS5 A;  3P1E A;  5HQ5 A;  4MEP A;  4O72 A;  4O70 A;  2F6J A;  4O76 A;  4UIU A;  4WHW A;  4ALG A;  3O36 A;  5HEM A;  1WUG A;  4IR4 A;  4C66 A;  4QEW A;  4TU4 A;  5FE9 A;  4LYI A;  5G4S A;  4GPJ A;  5D3J A;  4MR6 A;  2DAT A;  4NUC A;  5L98 A;  4YK0 A;  4MR4 A;  4CUT A;  2RNW A;  3QZS A;  4F3I A;  4LYW A;  5HRW A;  2D82 A;  3O37 A;  4UIX A;  4YYM A;  5C8G A;  5LVQ A;  4QUU A;  4WHU A;  4N3W A;  4NR4 A;  2R0S A;  5CS8 A;  1N72 A;  5FH6 A;  4CL9 A;  4UIT A;  4QEV A;  3UVW A;  5CPE A;  4IOQ A;  4CUP A;  5KO4 A;  5ENE A;  5HCL A;  2RNY A;  4QUT A;  5DBM A;  5L99 A;  1WUM A;  4O7E A;  2DVV A;  4NR8 A;  3JVL A;  5ACY A;  4OGJ A;  5FE4 A;  4IOR A;  5L97 A;  5EI4 A;  3K2J A;  4QC1 A;  5L96 A;  5I86 A;  4A9J A;  4UYE A;  4NYV A;  5D3N A;  4IR6 A;  4Z6I A;  5AME A;  5I89 A;  5FE1 A;  3UW9 A;  3MQM A;  4HXN A;  4TU6 A;  5D24 A;  5KHM A;  4QC3 A;  2L5E A;  5IGM A;  5E3D A;  4O7A A;  3IU5 A;  5EK9 A;  4QB3 A;  4MEO A;  4QSV A;  3MB3 A;  5EPS A;  5CRZ A;  4BW4 A;  5JI8 A;  4YY4 A;  3UV2 A;  4NR6 A;  3JVM A;  4BHW A;  4TTE A;  5CUD A;  4QST A;  4XY8 A;  4QNS A;  5FG6 A;  3G0L A;  4QR4 A;  4PY6 A;  5CZG A;  4N4I A;  4TT4 A;  5ENI A;  5ENB A;  5KTU A;  5EM3 A;  5FDZ A;  3O33 A;  5D3S A;  5H85 A;  5CUA A;  4J1P A;  2H60 A;  4O78 A;  5I7X A;  4HXP A;  3QZT A;  4KCX A;  2OSS A;  5LJ2 A;  5AD3 A;  3AQA A;  5FE7 A;  4Z1Q A;  5I83 A;  5C85 A;  5CQ4 A;  5FE3 A;  4E96 A;  5EV9 A;  4KV4 A;  5E0R A;  5I1Q A;  4NRC A;  5CU8 A;  4PTB A;  5DLZ A;  4YAB A;  4YYH A;  5D25 A;  4Z1S A;  5AMF A;  4UYD A;  5D3T A;  5FBX A;  4XY9 A;  2RI7 A;  5CQ3 A;  5DYX A;  4LR6 A;  4YYJ A;  3DAI A;  4CFK A;  4LDF A;  5IGK A;  2DVS A;  5FFV A;  5DYA A;  5DKH A;  5F60 A;  4UIZ A;  3G0J A;  5EWV A;  5LKT A;  5HRX A;  3U5J A;  5HFR A;  2YW5 A;  2WP2 A;  4UYF A;  5D3L A;  4NQM A;  5FE6 A;  2F6N A;  5CUG A;  5AD2 A;  2L84 A;  3U5K A;  2DVR A;  5CTL A;  4C67 A;  5EIS A;  5LUU A;  3LJW A;  5CRM A;  5EWC A;  5D26 A;  5HRV A;  5HJC A;  4N4H A;  5E9K A;  5KU3 A;  5DW2 A;  5ENJ A;  2YEK A;  4NR7 A;  2NXB A;  4QBM A;  4RVR A;  4NRB A;  5HQ7 A;  4QSS A;  2R0Y A;  3O34 A;  5H1U A;  4MR3 A;  5A81 A;  5EPB A;  5F63 A;  5H1V A;  4Z6H A;  4YYI A;  4QYD A;  3NXB A;  4BJX A;  3O35 A;  5II1 A;  2RS9 B;  4TT6 A;  5CQ7 A;  5E9V A;  5ENF A;  4YYG A;  5FB1 A;  3Q2F A;  5LJ0 A;  5FE0 A;  5C89 A;  3FKM X;  4O7F A;  5CGP A;  4YAT A;  1E6I A;  4MEN A;  4NR9 A;  4O75 A;  5DKD A;  5F1H A;  5EA1 A;  3U5L A;  3UV4 A;  5D0C A;  5HEN A;  5G4R A;  4QY4 A;  4OUF A;  2FSA A;  5F3A A;  3LQJ A;  2YDW A;  5CQ5 A;  3LQH A;  3LQI A;  3MB4 A;  1F68 A;  4CUQ A;  5D7X A;  4A9N A;  2RO1 A;  5A5S A;  4XUB A;  4LRG A;  4PCI A;  3U5M A;  5L8U A;  4NYX A;  5DFC A;  3MUL A;  3SVH A;  4ZQL A;  4X2I A;  5EPR A;  2KTB B;  5BT5 A;  4TS8 A;  5EWW A;  5LKU A;  5LJ1 A;  5A5N A;  5F25 A;  4NUD A;  3I3J A;  5I7Y A;  5ENG A;  4FLP A;  5A5P A;  5BT3 A;  5DLX A;  4QEU A;  5FE5 A;  5ETD A;  4N4G A;  5FB0 A;  5IGN A;  5I88 A;  4A9I A;  4A9M A;  4Q0O A;  4BW3 A;  4O77 A;  2OO1 A;  2LSP B;  4YYK A;  2MJV B;  4QR3 A;  2D9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...