2DVQA

Crystal structure analysis of the n-terminal bromodomain of human brd2 complexed with acetylated histone h4 peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 2
publication title Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dvqA00
3D7CA 4MR4A 3UVDA 3U5PA 5KTXA 5H1VA 4NRCA 4MENA 5L8TA 4QC1A 3O36A 4HBYA 5CPEA 3O33A 5D3NA 4NR6A 4PTBA 4ALHA 2F6NA 4IR5A 5E7DA 4YBTA 3DWYA 4UIWA 5CS8A 2FSAA 3P1CA 2R0YA 4N4HA 3RCWA 2WP1A 3U5JA 4CFKA 5DY7A 4IR3A 1EQFA 5DFCA 5FBXA 4ZW1A 4BHWA 5HQ7A 5KTUA 4O7CA 2L5EA 2L84A 4HXKA 4NR5A 5E9MA 5F25A 5FG5A 5ENIA 4N4GA 4HBVA 4XY8A 4UYHA 4BW3A 5CQAA 4Y03A 5C8GA 5L97A 2YQDA 2E7NA 5BT5A 5HJCA 5F36A 4Z1SA 4QSXA 4A9EA 5EPSA 4HXRA 4UYGA 5E0RA 4QYDA 1N72A 4QY4A 4QNSA 4PCIA 5L96A 4A9KA 2H60A 4IR6A 3SVGA 4Q0OA 5HQ6A 5D26A 4NRBA 5CQTA 5CUBA 5A5OA 3U5MA 5ENHA 5L8UA 5I7YA 4O77A 4J1PA 4O71A 3DAIA 5ENCA 5H85A 5F1LA 1WUGA 5IGNA 3MXFA 5AD2A 3JVKA 5IGKA 2R0SA 4OGIA 1E6IA 4QEUA 5A81A 5CQ6A 5LJ0A 3O34A 4XUAA 3MB3A 3SVFA 4LZ2A 5CTLA 5E3GA 5KHMA 2R10A 3K2JA 2YEMA 4DONA 4A9JA 5ENGA 4UYFB 2YELA 2DATA 4NR4A 3UVXA 4UYEA 4YYDA 3LXJA 5DYXA 4HBXA 5FFWA 2DVVA 5EM3A 5EWDA 3U5NA 3O35A 2G4AA 3S92A 2R0VA 4LRGA 4MEOA 5HENA 5FG6A 5KU3A 4HXSA 4CUUA 3O37A 3SVHA 3LJWA 3UVYA 4UIZA 4XUBA 5F61A 3AQAA 5HRWA 3UW9A 4YH4A 5C7NA 4X2IA 4ALGA 4QBMA 4CURA 4YABA 4CUPA 4KV1A 5BT3A 2DVSA 4LYSA 5CGPA 4NUEA 5EK9A 5A5RA 5I89A 4MR5A 4AKNA 3IU5A 4Z6IA 4NR8A 4KCXA 5LJ2A 4QB3A 2GRCA 5CY9A 3TLPA 5HQ5A 3UV2A 4ZQLA 4QC3A 4YATA 3MQMA 5DFDA 2DKWA 2RS9B 4J3IA 2MJVB 3ZYUA 5DLXA 4NYWA 5E9YA 4LZSA 3P1DA 5FB0A 4O72A 5A85A 4CL9A 2RNWA 5D25A 4LYWA 5LUUA 4TT6A 5CUGA 5FH7A 3ONIA 5F5ZA 5CRZA 5L99A 5DBMA 5EPRA 4PY6A 5LKZA 5JWMA 5KTWA 4QZSA 2OO1A 3JVLA 5CUEA 5A82A 4NR7A 3U5LA 4C67A 4TZ2A 5FE2A 5DYAA 5E9KA 5EWVA 4NQNA 4HXLA 4YYJA 5HRVA 4BW1A 5EISA 5D3RA 5FH8A 3G0LA 5KO4A 2RO1A 2L85A 3AADA 2DWWA 3MUKA 4GPJA 5CZGA 5I29A 5C87A 5ETBA 4YADA 5IG6A 5AMFA 4N4FA 5L98A 5DYCA 2RNXA 5BT4A 4CUTA 5E9LA 4QR3A 5DFBA 2RI7A 4HXNA 4YBMA 5G4SA 3HMEA 3JVMA 4NS5A 4J0SA 5A5QA 5TCMA 5FG4A 5DYUA 5EU1A 3LQJA 4YYNA 5FE5A 5ENFA 2E7OA 4A9NA 4NYXA 5IBNA 5ACYA 4O7FA 5I7XA 5I80A 4YBSA 5DLZA 3UV4A 5II1A 3G0JA 5IGLA 5HLSA 5DKDA 2YDWA 5E73A 4YYGA 5CFWA 3P1EA 5G4RA 4QR4A 4QSQA 3P5OA 4YAXA 5DW2A 2DVQA 5FE6A 3S91A 4CUSA 5LKUA 4A9FA 4PS5A 5FE4A 1JSPB 5CQ3A 4MR3A 4TT4A 4XYAA 3UVWA 4A9MA 5D24A 5E74A 4YC9A 5CQ4A 3HMHA 3NXBA 4HBWA 4ZC9A 5A5PA 3JVJA 5AMEA 5HEMA 5D3JA 3IU6A 5F2PA 2LSPB 4O75A 3U5KA 5DKCA 4LC2A 4OGJA 5A7CA 4O74A 4QEVA 4UIVA 4QSSA 5ENBA 4A9LA 3QZTA 4NUCA 4O7BA 5LKTA 2RFJA 4Q0NA 4WHWA 5HM0A 5C89A 4QSVA 5A5NA 3I3JA 5A5SA 4QR5A 5EA1A 4WHUA 5D0CA 3MB4A 5D3PA 4N3WA 5HFQA 4TYLA 4UYDA 4QSTA 4TT2A 4UIXA 5LVQA 4MR6A 5EQ1A 4UYFA 5FE7A 5C4QA 4TU4A 5I86A 4C66A 4O7AA 5E3DA 4A9HA 5CP5A 4YYHA 5DKHA 4RVRA 4TS8A 5CUDA 3FKMX 5I88A 3UV5A 4PKLA 2KTBB 5D3SA 4FLPA 4LYIA 5F3AA 5AD3A 5FE0A 5FE8A 5HFRA 2D82A 5JI8A 2WP2A 5CRMA 5CQ8A 4TQNA 5K29A 5ETDA 4QSPA 4CUQA 4N4IA 5ENJA 4HXOA 5E9IA 4QEWA 2YYNA 4UIUA 4F3IA 5EWWA 4CLBA 5EICA 4YYKA 4IORA 4BW4A 5FE3A 3LQHA 4TU6A 2F6JA 5FE9A 4TTEA 5HELA 5HRXA 4BJXA 5LKXA 3GG3A 3U5OA 2OUOA 5D3TA 5D7XA 4A9IA 3QZSA 5COIA 5IIDA 5F60A 1F68A 5FFVA 4LR6A 5LVRA 4UIYA 5CUAA 5I1QA 4Z93A 4YYMA 3P1FA 1JM4B 4LZRA 4A9OA 1ZS5A 5C85A 2I8NA 4QYLA 3QZVA 5LJ1A 5F1HA 5H1UA 5I40A 5H1TA 2DVRA 5II2A 4BW2A 2YW5A 4IOOA 5TB6A 4NQMA 3Q2EA 4IOQA 4QSRA 5E9VA 5EI4A 3Q2FA 5FFYA 4NYVA 5J0DA 4O7EA 5CUCA 2I7KA 3MULA 5FB1A 4YYIA 5CQ7A 2N9GA 2RNYA 4WIVA 5I83A 4QSWA 4YY4A 5F63A 5FDZA 4O70A 4QUTA 4YY6A 4QSUA 3HMFA 4YH3A 5EP7A 5CQ5A 5EVAA 4Z6HA 4HXPA 4QUUA 4J0RA 2E3KA 4IR4A 5EGUA 4O76A 5ENEA 5DX4A 2NXBA 4UITA 5HCLA 4O78A 4KV4A 4MEPA 4LDFA 5EV9A 5EPBA 5FE1A 4OUFA 4CFLA 5IGMA 5FH6A 4YK0A 2D9EA 4NXJA 2YEKA 4E96A 5CU8A 5A83A 4NR9A 1WUMA 4XY9A 5EWCA 5EWHA 4NRAA 5F62A 2OSSA 4TZ8A 4HXMA 5DW1A 4MEQA 5D3HA 4Z1QA 5D3LA 3LQIA 1X0JA 4PCEA 4NUDA
chains in the Genus database with same CATH superfamily
3D7CA 4MR4A 3UVDA 3U5PA 5KTXA 5H1VA 4NRCA 4MENA 5L8TA 4QC1A 3O36A 4HBYA 5CPEA 3O33A 5D3NA 4NR6A 4PTBA 4ALHA 2F6NA 4IR5A 5E7DA 4YBTA 3DWYA 4UIWA 5CS8A 2FSAA 3P1CA 2R0YA 4N4HA 3RCWA 2WP1A 3U5JA 4CFKA 5DY7A 4IR3A 1EQFA 5DFCA 5FBXA 4ZW1A 4BHWA 5HQ7A 5KTUA 4O7CA 2L5EA 2L84A 4HXKA 4NR5A 5E9MA 5F25A 5FG5A 5ENIA 4N4GA 4HBVA 4XY8A 4UYHA 4BW3A 5CQAA 4Y03A 5C8GA 5L97A 2YQDA 2E7NA 5BT5A 5HJCA 5F36A 4Z1SA 4QSXA 4A9EA 5EPSA 4HXRA 4UYGA 5E0RA 4QYDA 1N72A 4QY4A 4QNSA 4PCIA 5L96A 4A9KA 2H60A 4IR6A 3SVGA 4Q0OA 5HQ6A 5D26A 3ERRA 4NRBA 5CQTA 5CUBA 5A5OA 3U5MA 5ENHA 5L8UA 5I7YA 4O77A 4J1PA 4O71A 3DAIA 5ENCA 5H85A 5F1LA 4AI6A 1WUGA 5IGNA 3MXFA 5AD2A 3JVKA 1ZKRA 5IGKA 2R0SA 4OGIA 1E6IA 4QEUA 5A81A 5CQ6A 5LJ0A 3O34A 4XUAA 3MB3A 3SVFA 4LZ2A 5CTLA 5E3GA 5KHMA 2R10A 3K2JA 2YEMA 4DONA 4A9JA 5ENGA 4UYFB 2YELA 2DATA 4NR4A 3UVXA 4UYEA 4YYDA 3LXJA 5DYXA 4HBXA 5FFWA 2DVVA 5EM3A 5EWDA 3U5NA 3O35A 2G4AA 3S92A 2R0VA 4LRGA 4MEOA 5HENA 5FG6A 5KU3A 4HXSA 4CUUA 3O37A 3SVHA 3LJWA 3UVYA 4UIZA 4XUBA 5F61A 3AQAA 5HRWA 3UW9A 4YH4A 5C7NA 4X2IA 4ALGA 4QBMA 4CURA 4YABA 4CUPA 4KV1A 5BT3A 2DVSA 4LYSA 5CGPA 4NUEA 5EK9A 5A5RA 5I89A 4MR5A 4AKNA 3IU5A 4Z6IA 4NR8A 4KCXA 5LJ2A 4QB3A 2GRCA 5CY9A 3TLPA 5HQ5A 3UV2A 4ZQLA 4QC3A 4YATA 3MQMA 5DFDA 2DKWA 2RS9B 4J3IA 2MJVB 3ZYUA 5DLXA 4NYWA 5E9YA 4LZSA 3P1DA 5FB0A 4O72A 5A85A 4CL9A 2RNWA 5D25A 4LYWA 5LUUA 4TT6A 5CUGA 5FH7A 3ONIA 3D1BA 5F5ZA 5CRZA 5L99A 5DBMA 5EPRA 4PY6A 5LKZA 5JWMA 4AKGA 5KTWA 4QZSA 2OO1A 3JVLA 5CUEA 5A82A 4NR7A 3U5LA 4C67A 4TZ2A 5FE2A 5DYAA 5E9KA 5EWVA 4NQNA 4HXLA 4YYJA 5HRVA 4BW1A 5EISA 5D3RA 5FH8A 3G0LA 5KO4A 3VKGA 2RO1A 2L85A 3AADA 2DWWA 3MUKA 4GPJA 5CZGA 5I29A 5C87A 5ETBA 4YADA 5IG6A 5AMFA 4N4FA 5L98A 5DYCA 2RNXA 5BT4A 4CUTA 5E9LA 4QR3A 5DFBA 2RI7A 4HXNA 4YBMA 5G4SA 3HMEA 3JVMA 4NS5A 4J0SA 5A5QA 5TCMA 1PUOA 5FG4A 5DYUA 5EU1A 3LQJA 4YYNA 5FE5A 5ENFA 2E7OA 4A9NA 4NYXA 5IBNA 5ACYA 4O7FA 5I7XA 5I80A 4YBSA 5DLZA 3UV4A 5II1A 3G0JA 5IGLA 5HLSA 5DKDA 2YDWA 5E73A 4YYGA 5CFWA 3P1EA 5G4RA 4QR4A 4QSQA 3P5OA 4YAXA 5DW2A 2DVQA 5FE6A 3S91A 4CUSA 5LKUA 4A9FA 4PS5A 5FE4A 1JSPB 5CQ3A 4MR3A 4TT4A 4XYAA 3UVWA 4A9MA 5D24A 5E74A 4YC9A 5CQ4A 3HMHA 3NXBA 4HBWA 4ZC9A 5A5PA 3JVJA 5AMEA 5HEMA 5D3JA 3IU6A 5F2PA 2LSPB 4O75A 3U5KA 5DKCA 4LC2A 4OGJA 5A7CA 4O74A 4QEVA 4UIVA 4QSSA 5ENBA 4A9LA 3QZTA 4NUCA 4O7BA 5LKTA 2RFJA 4Q0NA 4WHWA 5HM0A 5C89A 4QSVA 5A5NA 3I3JA 5A5SA 4QR5A 5EA1A 4WHUA 5D0CA 3MB4A 5D3PA 4N3WA 5HFQA 4TYLA 4UYDA 4QSTA 4TT2A 4UIXA 5LVQA 4MR6A 5EQ1A 4UYFA 5FE7A 5C4QA 4TU4A 5I86A 4C66A 4O7AA 5E3DA 4A9HA 5CP5A 4YYHA 5DKHA 4RVRA 4TS8A 5CUDA 3FKMX 5I88A 3UV5A 4PKLA 2KTBB 5D3SA 4FLPA 4LYIA 5F3AA 5AD3A 5FE0A 5FE8A 5HFRA 2D82A 5JI8A 2WP2A 2EJNA 5CRMA 5CQ8A 4TQNA 5K29A 5ETDA 4QSPA 4CUQA 4N4IA 5ENJA 4HXOA 5E9IA 4QEWA 4AKIA 2YYNA 3D1DA 4UIUA 4F3IA 5EWWA 4CLBA 5EICA 4YYKA 4IORA 4BW4A 5FE3A 3LQHA 4TU6A 2F6JA 5FE9A 4TTEA 5HELA 5HRXA 4BJXA 5LKXA 3GG3A 3U5OA 2OUOA 5D3TA 5D7XA 4A9IA 3QZSA 5COIA 5IIDA 5F60A 4AKHA 1F68A 5FFVA 4LR6A 5LVRA 4UIYA 5CUAA 5I1QA 4Z93A 4YYMA 3P1FA 1JM4B 4LZRA 4A9OA 1ZS5A 5C85A 2I8NA 4QYLA 3QZVA 5LJ1A 5F1HA 5H1UA 5I40A 5H1TA 2DVRA 5II2A 4BW2A 3VKHA 2YW5A 4IOOA 5TB6A 4NQMA 3Q2EA 4IOQA 4QSRA 5E9VA 5EI4A 3Q2FA 5FFYA 4NYVA 5J0DA 4O7EA 5CUCA 2I7KA 3MULA 5FB1A 4YYIA 5CQ7A 2N9GA 2RNYA 4WIVA 5I83A 4QSWA 4YY4A 5F63A 5FDZA 4O70A 4QUTA 4YY6A 4QSUA 3HMFA 4YH3A 5EP7A 5CQ5A 5EVAA 4Z6HA 4HXPA 4QUUA 4J0RA 2E3KA 4IR4A 5EGUA 4O76A 5ENEA 5DX4A 2NXBA 4UITA 5HCLA 4O78A 4KV4A 4MEPA 4LDFA 5EV9A 5EPBA 5FE1A 4OUFA 4CFLA 5IGMA 5FH6A 4YK0A 2D9EA 4NXJA 2YEKA 4E96A 5CU8A 5A83A 4NR9A 1WUMA 4XY9A 5EWCA 5EWHA 4NRAA 5F62A 2OSSA 4TZ8A 4HXMA 5DW1A 4MEQA 5D3HA 4Z1QA 5D3LA 3LQIA 1X0JA 4PCEA 4NUDA
chains in the Genus database with same CATH topology
3D7CA 4MR4A 3UVDA 3U5PA 5KTXA 5H1VA 4NRCA 4MENA 5L8TA 4QC1A 3O36A 4HBYA 5CPEA 3O33A 5D3NA 4NR6A 4PTBA 4ALHA 2F6NA 4IR5A 5E7DA 4YBTA 3DWYA 4UIWA 5CS8A 2FSAA 3P1CA 2R0YA 4N4HA 3RCWA 2WP1A 3U5JA 4CFKA 5DY7A 4IR3A 1EQFA 5DFCA 5FBXA 4ZW1A 4BHWA 5HQ7A 5KTUA 4O7CA 2L5EA 2L84A 4HXKA 4NR5A 5E9MA 5F25A 5FG5A 5ENIA 4N4GA 4HBVA 4XY8A 4UYHA 4BW3A 5CQAA 4Y03A 5C8GA 5L97A 2YQDA 2E7NA 5BT5A 5HJCA 5F36A 4Z1SA 4QSXA 4A9EA 5EPSA 4HXRA 4UYGA 5E0RA 4QYDA 1N72A 4QY4A 4QNSA 4PCIA 5L96A 4A9KA 2H60A 4IR6A 3SVGA 4Q0OA 5HQ6A 5D26A 4NRBA 5CQTA 5CUBA 5A5OA 3U5MA 5ENHA 5L8UA 5I7YA 4O77A 4J1PA 4O71A 3DAIA 5ENCA 5H85A 5F1LA 1WUGA 5IGNA 3MXFA 5AD2A 3JVKA 5IGKA 2R0SA 4OGIA 1E6IA 4QEUA 5A81A 5CQ6A 5LJ0A 3O34A 4XUAA 3MB3A 3SVFA 4LZ2A 5CTLA 5E3GA 5KHMA 2R10A 3K2JA 2YEMA 4DONA 4A9JA 5ENGA 4UYFB 2YELA 2DATA 4NR4A 3UVXA 4UYEA 4YYDA 3LXJA 5DYXA 4HBXA 5FFWA 2DVVA 5EM3A 5EWDA 3U5NA 3O35A 2G4AA 3S92A 2R0VA 4LRGA 4MEOA 5HENA 5FG6A 5KU3A 4HXSA 4CUUA 3O37A 3SVHA 3LJWA 3UVYA 4UIZA 4XUBA 5F61A 3AQAA 5HRWA 3UW9A 4YH4A 5C7NA 4X2IA 4ALGA 4QBMA 4CURA 4YABA 4CUPA 4KV1A 5BT3A 2DVSA 4LYSA 5CGPA 4NUEA 5EK9A 5A5RA 5I89A 4MR5A 4AKNA 3IU5A 4Z6IA 4NR8A 4KCXA 5LJ2A 4QB3A 2GRCA 5CY9A 3TLPA 5HQ5A 3UV2A 4ZQLA 4QC3A 4YATA 3MQMA 5DFDA 2DKWA 2RS9B 4J3IA 2MJVB 3ZYUA 5DLXA 4NYWA 5E9YA 4LZSA 3P1DA 5FB0A 4O72A 5A85A 4CL9A 2RNWA 5D25A 4LYWA 5LUUA 4TT6A 5CUGA 5FH7A 3ONIA 5F5ZA 5CRZA 5L99A 5DBMA 5EPRA 4PY6A 5LKZA 5JWMA 5KTWA 4QZSA 2OO1A 3JVLA 5CUEA 5A82A 4NR7A 3U5LA 4C67A 4TZ2A 5FE2A 5DYAA 5E9KA 5EWVA 4NQNA 4HXLA 4YYJA 5HRVA 4BW1A 5EISA 5D3RA 5FH8A 3G0LA 5KO4A 2RO1A 2L85A 3AADA 2DWWA 3MUKA 4GPJA 5CZGA 5I29A 5C87A 5ETBA 4YADA 5IG6A 5AMFA 4N4FA 5L98A 5DYCA 2RNXA 5BT4A 4CUTA 5E9LA 4QR3A 5DFBA 2RI7A 4HXNA 4YBMA 5G4SA 3HMEA 3JVMA 4NS5A 4J0SA 5A5QA 5TCMA 5FG4A 5DYUA 5EU1A 3LQJA 4YYNA 5FE5A 5ENFA 2E7OA 4A9NA 4NYXA 5IBNA 5ACYA 4O7FA 5I7XA 5I80A 4YBSA 5DLZA 3UV4A 5II1A 3G0JA 5IGLA 5HLSA 5DKDA 2YDWA 5E73A 4YYGA 5CFWA 3P1EA 5G4RA 4QR4A 4QSQA 3P5OA 4YAXA 5DW2A 2DVQA 5FE6A 3S91A 4CUSA 5LKUA 4A9FA 4PS5A 5FE4A 1JSPB 5CQ3A 4MR3A 4TT4A 4XYAA 3UVWA 4A9MA 5D24A 5E74A 4YC9A 5CQ4A 3HMHA 3NXBA 4HBWA 4ZC9A 5A5PA 3JVJA 5AMEA 5HEMA 5D3JA 3IU6A 5F2PA 2LSPB 4O75A 3U5KA 5DKCA 4LC2A 4OGJA 5A7CA 4O74A 4QEVA 4UIVA 4QSSA 5ENBA 4A9LA 3QZTA 4NUCA 4O7BA 5LKTA 2RFJA 4Q0NA 4WHWA 5HM0A 5C89A 4QSVA 5A5NA 3I3JA 5A5SA 4QR5A 5EA1A 4WHUA 5D0CA 3MB4A 5D3PA 4N3WA 5HFQA 4TYLA 4UYDA 4QSTA 4TT2A 4UIXA 5LVQA 4MR6A 5EQ1A 4UYFA 5FE7A 5C4QA 4TU4A 5I86A 4C66A 4O7AA 5E3DA 4A9HA 5CP5A 4YYHA 5DKHA 4RVRA 4TS8A 5CUDA 3FKMX 5I88A 3UV5A 4PKLA 2KTBB 5D3SA 4FLPA 4LYIA 5F3AA 5AD3A 5FE0A 5FE8A 5HFRA 2D82A 5JI8A 2WP2A 5CRMA 5CQ8A 4TQNA 5K29A 5ETDA 4QSPA 4CUQA 4N4IA 5ENJA 4HXOA 5E9IA 4QEWA 2YYNA 4UIUA 4F3IA 5EWWA 4CLBA 5EICA 4YYKA 4IORA 4BW4A 5FE3A 3LQHA 4TU6A 2F6JA 5FE9A 4TTEA 5HELA 5HRXA 4BJXA 5LKXA 3GG3A 3U5OA 2OUOA 5D3TA 5D7XA 4A9IA 3QZSA 5COIA 5IIDA 5F60A 1F68A 5FFVA 4LR6A 5LVRA 4UIYA 5CUAA 5I1QA 4Z93A 4YYMA 3P1FA 1JM4B 4LZRA 4A9OA 1ZS5A 5C85A 2I8NA 4QYLA 3QZVA 5LJ1A 5F1HA 5H1UA 5I40A 5H1TA 2DVRA 5II2A 4BW2A 2YW5A 4IOOA 5TB6A 4NQMA 3Q2EA 4IOQA 4QSRA 5E9VA 5EI4A 3Q2FA 5FFYA 4NYVA 5J0DA 4O7EA 5CUCA 2I7KA 3MULA 5FB1A 4YYIA 5CQ7A 2N9GA 2RNYA 4WIVA 5I83A 4QSWA 4YY4A 5F63A 5FDZA 4O70A 4QUTA 4YY6A 4QSUA 3HMFA 4YH3A 5EP7A 5CQ5A 5EVAA 4Z6HA 4HXPA 4QUUA 4J0RA 2E3KA 4IR4A 5EGUA 4O76A 5ENEA 5DX4A 2NXBA 4UITA 5HCLA 4O78A 4KV4A 4MEPA 4LDFA 5EV9A 5EPBA 5FE1A 4OUFA 4CFLA 5IGMA 5FH6A 4YK0A 2D9EA 4NXJA 2YEKA 4E96A 5CU8A 5A83A 4NR9A 1WUMA 4XY9A 5EWCA 5EWHA 4NRAA 5F62A 2OSSA 4TZ8A 4HXMA 5DW1A 4MEQA 5D3HA 4Z1QA 5D3LA 3LQIA 1X0JA 4PCEA 4NUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7C A;  4MR4 A;  3UVD A;  3U5P A;  5KTX A;  5H1V A;  4NRC A;  4MEN A;  5L8T A;  4QC1 A;  3O36 A;  4HBY A;  5CPE A;  3O33 A;  5D3N A;  4NR6 A;  4PTB A;  4ALH A;  2F6N A;  4IR5 A;  5E7D A;  4YBT A;  3DWY A;  4UIW A;  5CS8 A;  2FSA A;  3P1C A;  2R0Y A;  4N4H A;  3RCW A;  2WP1 A;  3U5J A;  4CFK A;  5DY7 A;  4IR3 A;  1EQF A;  5DFC A;  5FBX A;  4ZW1 A;  4BHW A;  5HQ7 A;  5KTU A;  4O7C A;  2L5E A;  2L84 A;  4HXK A;  4NR5 A;  5E9M A;  5F25 A;  5FG5 A;  5ENI A;  4N4G A;  4HBV A;  4XY8 A;  4UYH A;  4BW3 A;  5CQA A;  4Y03 A;  5C8G A;  5L97 A;  2YQD A;  2E7N A;  5BT5 A;  5HJC A;  5F36 A;  4Z1S A;  4QSX A;  4A9E A;  5EPS A;  4HXR A;  4UYG A;  5E0R A;  4QYD A;  1N72 A;  4QY4 A;  4QNS A;  4PCI A;  5L96 A;  4A9K A;  2H60 A;  4IR6 A;  3SVG A;  4Q0O A;  5HQ6 A;  5D26 A;  4NRB A;  5CQT A;  5CUB A;  5A5O A;  3U5M A;  5ENH A;  5L8U A;  5I7Y A;  4O77 A;  4J1P A;  4O71 A;  3DAI A;  5ENC A;  5H85 A;  5F1L A;  1WUG A;  5IGN A;  3MXF A;  5AD2 A;  3JVK A;  5IGK A;  2R0S A;  4OGI A;  1E6I A;  4QEU A;  5A81 A;  5CQ6 A;  5LJ0 A;  3O34 A;  4XUA A;  3MB3 A;  3SVF A;  4LZ2 A;  5CTL A;  5E3G A;  5KHM A;  2R10 A;  3K2J A;  2YEM A;  4DON A;  4A9J A;  5ENG A;  4UYF B;  2YEL A;  2DAT A;  4NR4 A;  3UVX A;  4UYE A;  4YYD A;  3LXJ A;  5DYX A;  4HBX A;  5FFW A;  2DVV A;  5EM3 A;  5EWD A;  3U5N A;  3O35 A;  2G4A A;  3S92 A;  2R0V A;  4LRG A;  4MEO A;  5HEN A;  5FG6 A;  5KU3 A;  4HXS A;  4CUU A;  3O37 A;  3SVH A;  3LJW A;  3UVY A;  4UIZ A;  4XUB A;  5F61 A;  3AQA A;  5HRW A;  3UW9 A;  4YH4 A;  5C7N A;  4X2I A;  4ALG A;  4QBM A;  4CUR A;  4YAB A;  4CUP A;  4KV1 A;  5BT3 A;  2DVS A;  4LYS A;  5CGP A;  4NUE A;  5EK9 A;  5A5R A;  5I89 A;  4MR5 A;  4AKN A;  3IU5 A;  4Z6I A;  4NR8 A;  4KCX A;  5LJ2 A;  4QB3 A;  2GRC A;  5CY9 A;  3TLP A;  5HQ5 A;  3UV2 A;  4ZQL A;  4QC3 A;  4YAT A;  3MQM A;  5DFD A;  2DKW A;  2RS9 B;  4J3I A;  2MJV B;  3ZYU A;  5DLX A;  4NYW A;  5E9Y A;  4LZS A;  3P1D A;  5FB0 A;  4O72 A;  5A85 A;  4CL9 A;  2RNW A;  5D25 A;  4LYW A;  5LUU A;  4TT6 A;  5CUG A;  5FH7 A;  3ONI A;  5F5Z A;  5CRZ A;  5L99 A;  5DBM A;  5EPR A;  4PY6 A;  5LKZ A;  5JWM A;  5KTW A;  4QZS A;  2OO1 A;  3JVL A;  5CUE A;  5A82 A;  4NR7 A;  3U5L A;  4C67 A;  4TZ2 A;  5FE2 A;  5DYA A;  5E9K A;  5EWV A;  4NQN A;  4HXL A;  4YYJ A;  5HRV A;  4BW1 A;  5EIS A;  5D3R A;  5FH8 A;  3G0L A;  5KO4 A;  2RO1 A;  2L85 A;  3AAD A;  2DWW A;  3MUK A;  4GPJ A;  5CZG A;  5I29 A;  5C87 A;  5ETB A;  4YAD A;  5IG6 A;  5AMF A;  4N4F A;  5L98 A;  5DYC A;  2RNX A;  5BT4 A;  4CUT A;  5E9L A;  4QR3 A;  5DFB A;  2RI7 A;  4HXN A;  4YBM A;  5G4S A;  3HME A;  3JVM A;  4NS5 A;  4J0S A;  5A5Q A;  5TCM A;  5FG4 A;  5DYU A;  5EU1 A;  3LQJ A;  4YYN A;  5FE5 A;  5ENF A;  2E7O A;  4A9N A;  4NYX A;  5IBN A;  5ACY A;  4O7F A;  5I7X A;  5I80 A;  4YBS A;  5DLZ A;  3UV4 A;  5II1 A;  3G0J A;  5IGL A;  5HLS A;  5DKD A;  2YDW A;  5E73 A;  4YYG A;  5CFW A;  3P1E A;  5G4R A;  4QR4 A;  4QSQ A;  3P5O A;  4YAX A;  5DW2 A;  2DVQ A;  5FE6 A;  3S91 A;  4CUS A;  5LKU A;  4A9F A;  4PS5 A;  5FE4 A;  1JSP B;  5CQ3 A;  4MR3 A;  4TT4 A;  4XYA A;  3UVW A;  4A9M A;  5D24 A;  5E74 A;  4YC9 A;  5CQ4 A;  3HMH A;  3NXB A;  4HBW A;  4ZC9 A;  5A5P A;  3JVJ A;  5AME A;  5HEM A;  5D3J A;  3IU6 A;  5F2P A;  2LSP B;  4O75 A;  3U5K A;  5DKC A;  4LC2 A;  4OGJ A;  5A7C A;  4O74 A;  4QEV A;  4UIV A;  4QSS A;  5ENB A;  4A9L A;  3QZT A;  4NUC A;  4O7B A;  5LKT A;  2RFJ A;  4Q0N A;  4WHW A;  5HM0 A;  5C89 A;  4QSV A;  5A5N A;  3I3J A;  5A5S A;  4QR5 A;  5EA1 A;  4WHU A;  5D0C A;  3MB4 A;  5D3P A;  4N3W A;  5HFQ A;  4TYL A;  4UYD A;  4QST A;  4TT2 A;  4UIX A;  5LVQ A;  4MR6 A;  5EQ1 A;  4UYF A;  5FE7 A;  5C4Q A;  4TU4 A;  5I86 A;  4C66 A;  4O7A A;  5E3D A;  4A9H A;  5CP5 A;  4YYH A;  5DKH A;  4RVR A;  4TS8 A;  5CUD A;  3FKM X;  5I88 A;  3UV5 A;  4PKL A;  2KTB B;  5D3S A;  4FLP A;  4LYI A;  5F3A A;  5AD3 A;  5FE0 A;  5FE8 A;  5HFR A;  2D82 A;  5JI8 A;  2WP2 A;  5CRM A;  5CQ8 A;  4TQN A;  5K29 A;  5ETD A;  4QSP A;  4CUQ A;  4N4I A;  5ENJ A;  4HXO A;  5E9I A;  4QEW A;  2YYN A;  4UIU A;  4F3I A;  5EWW A;  4CLB A;  5EIC A;  4YYK A;  4IOR A;  4BW4 A;  5FE3 A;  3LQH A;  4TU6 A;  2F6J A;  5FE9 A;  4TTE A;  5HEL A;  5HRX A;  4BJX A;  5LKX A;  3GG3 A;  3U5O A;  2OUO A;  5D3T A;  5D7X A;  4A9I A;  3QZS A;  5COI A;  5IID A;  5F60 A;  1F68 A;  5FFV A;  4LR6 A;  5LVR A;  4UIY A;  5CUA A;  5I1Q A;  4Z93 A;  4YYM A;  3P1F A;  1JM4 B;  4LZR A;  4A9O A;  1ZS5 A;  5C85 A;  2I8N A;  4QYL A;  3QZV A;  5LJ1 A;  5F1H A;  5H1U A;  5I40 A;  5H1T A;  2DVR A;  5II2 A;  4BW2 A;  2YW5 A;  4IOO A;  5TB6 A;  4NQM A;  3Q2E A;  4IOQ A;  4QSR A;  5E9V A;  5EI4 A;  3Q2F A;  5FFY A;  4NYV A;  5J0D A;  4O7E A;  5CUC A;  2I7K A;  3MUL A;  5FB1 A;  4YYI A;  5CQ7 A;  2N9G A;  2RNY A;  4WIV A;  5I83 A;  4QSW A;  4YY4 A;  5F63 A;  5FDZ A;  4O70 A;  4QUT A;  4YY6 A;  4QSU A;  3HMF A;  4YH3 A;  5EP7 A;  5CQ5 A;  5EVA A;  4Z6H A;  4HXP A;  4QUU A;  4J0R A;  2E3K A;  4IR4 A;  5EGU A;  4O76 A;  5ENE A;  5DX4 A;  2NXB A;  4UIT A;  5HCL A;  4O78 A;  4KV4 A;  4MEP A;  4LDF A;  5EV9 A;  5EPB A;  5FE1 A;  4OUF A;  4CFL A;  5IGM A;  5FH6 A;  4YK0 A;  2D9E A;  4NXJ A;  2YEK A;  4E96 A;  5CU8 A;  5A83 A;  4NR9 A;  1WUM A;  4XY9 A;  5EWC A;  5EWH A;  4NRA A;  5F62 A;  2OSS A;  4TZ8 A;  4HXM A;  5DW1 A;  4MEQ A;  5D3H A;  4Z1Q A;  5D3L A;  3LQI A;  1X0J A;  4PCE A;  4NUD A; 
#chains in the Genus database with same CATH topology
 3D7C A;  4MR4 A;  3UVD A;  3U5P A;  5KTX A;  5H1V A;  4NRC A;  4MEN A;  5L8T A;  4QC1 A;  3O36 A;  4HBY A;  5CPE A;  3O33 A;  5D3N A;  4NR6 A;  4PTB A;  4ALH A;  2F6N A;  4IR5 A;  5E7D A;  4YBT A;  3DWY A;  4UIW A;  5CS8 A;  2FSA A;  3P1C A;  2R0Y A;  4N4H A;  3RCW A;  2WP1 A;  3U5J A;  4CFK A;  5DY7 A;  4IR3 A;  1EQF A;  5DFC A;  5FBX A;  4ZW1 A;  4BHW A;  5HQ7 A;  5KTU A;  4O7C A;  2L5E A;  2L84 A;  4HXK A;  4NR5 A;  5E9M A;  5F25 A;  5FG5 A;  5ENI A;  4N4G A;  4HBV A;  4XY8 A;  4UYH A;  4BW3 A;  5CQA A;  4Y03 A;  5C8G A;  5L97 A;  2YQD A;  2E7N A;  5BT5 A;  5HJC A;  5F36 A;  4Z1S A;  4QSX A;  4A9E A;  5EPS A;  4HXR A;  4UYG A;  5E0R A;  4QYD A;  1N72 A;  4QY4 A;  4QNS A;  4PCI A;  5L96 A;  4A9K A;  2H60 A;  4IR6 A;  3SVG A;  4Q0O A;  5HQ6 A;  5D26 A;  3ERR A;  4NRB A;  5CQT A;  5CUB A;  5A5O A;  3U5M A;  5ENH A;  5L8U A;  5I7Y A;  4O77 A;  4J1P A;  4O71 A;  3DAI A;  5ENC A;  5H85 A;  5F1L A;  4AI6 A;  1WUG A;  5IGN A;  3MXF A;  5AD2 A;  3JVK A;  1ZKR A;  5IGK A;  2R0S A;  4OGI A;  1E6I A;  4QEU A;  5A81 A;  5CQ6 A;  5LJ0 A;  3O34 A;  4XUA A;  3MB3 A;  3SVF A;  4LZ2 A;  5CTL A;  5E3G A;  5KHM A;  2R10 A;  3K2J A;  2YEM A;  4DON A;  4A9J A;  5ENG A;  4UYF B;  2YEL A;  2DAT A;  4NR4 A;  3UVX A;  4UYE A;  4YYD A;  3LXJ A;  5DYX A;  4HBX A;  5FFW A;  2DVV A;  5EM3 A;  5EWD A;  3U5N A;  3O35 A;  2G4A A;  3S92 A;  2R0V A;  4LRG A;  4MEO A;  5HEN A;  5FG6 A;  5KU3 A;  4HXS A;  4CUU A;  3O37 A;  3SVH A;  3LJW A;  3UVY A;  4UIZ A;  4XUB A;  5F61 A;  3AQA A;  5HRW A;  3UW9 A;  4YH4 A;  5C7N A;  4X2I A;  4ALG A;  4QBM A;  4CUR A;  4YAB A;  4CUP A;  4KV1 A;  5BT3 A;  2DVS A;  4LYS A;  5CGP A;  4NUE A;  5EK9 A;  5A5R A;  5I89 A;  4MR5 A;  4AKN A;  3IU5 A;  4Z6I A;  4NR8 A;  4KCX A;  5LJ2 A;  4QB3 A;  2GRC A;  5CY9 A;  3TLP A;  5HQ5 A;  3UV2 A;  4ZQL A;  4QC3 A;  4YAT A;  3MQM A;  5DFD A;  2DKW A;  2RS9 B;  4J3I A;  2MJV B;  3ZYU A;  5DLX A;  4NYW A;  5E9Y A;  4LZS A;  3P1D A;  5FB0 A;  4O72 A;  5A85 A;  4CL9 A;  2RNW A;  5D25 A;  4LYW A;  5LUU A;  4TT6 A;  5CUG A;  5FH7 A;  3ONI A;  3D1B A;  5F5Z A;  5CRZ A;  5L99 A;  5DBM A;  5EPR A;  4PY6 A;  5LKZ A;  5JWM A;  4AKG A;  5KTW A;  4QZS A;  2OO1 A;  3JVL A;  5CUE A;  5A82 A;  4NR7 A;  3U5L A;  4C67 A;  4TZ2 A;  5FE2 A;  5DYA A;  5E9K A;  5EWV A;  4NQN A;  4HXL A;  4YYJ A;  5HRV A;  4BW1 A;  5EIS A;  5D3R A;  5FH8 A;  3G0L A;  5KO4 A;  3VKG A;  2RO1 A;  2L85 A;  3AAD A;  2DWW A;  3MUK A;  4GPJ A;  5CZG A;  5I29 A;  5C87 A;  5ETB A;  4YAD A;  5IG6 A;  5AMF A;  4N4F A;  5L98 A;  5DYC A;  2RNX A;  5BT4 A;  4CUT A;  5E9L A;  4QR3 A;  5DFB A;  2RI7 A;  4HXN A;  4YBM A;  5G4S A;  3HME A;  3JVM A;  4NS5 A;  4J0S A;  5A5Q A;  5TCM A;  1PUO A;  5FG4 A;  5DYU A;  5EU1 A;  3LQJ A;  4YYN A;  5FE5 A;  5ENF A;  2E7O A;  4A9N A;  4NYX A;  5IBN A;  5ACY A;  4O7F A;  5I7X A;  5I80 A;  4YBS A;  5DLZ A;  3UV4 A;  5II1 A;  3G0J A;  5IGL A;  5HLS A;  5DKD A;  2YDW A;  5E73 A;  4YYG A;  5CFW A;  3P1E A;  5G4R A;  4QR4 A;  4QSQ A;  3P5O A;  4YAX A;  5DW2 A;  2DVQ A;  5FE6 A;  3S91 A;  4CUS A;  5LKU A;  4A9F A;  4PS5 A;  5FE4 A;  1JSP B;  5CQ3 A;  4MR3 A;  4TT4 A;  4XYA A;  3UVW A;  4A9M A;  5D24 A;  5E74 A;  4YC9 A;  5CQ4 A;  3HMH A;  3NXB A;  4HBW A;  4ZC9 A;  5A5P A;  3JVJ A;  5AME A;  5HEM A;  5D3J A;  3IU6 A;  5F2P A;  2LSP B;  4O75 A;  3U5K A;  5DKC A;  4LC2 A;  4OGJ A;  5A7C A;  4O74 A;  4QEV A;  4UIV A;  4QSS A;  5ENB A;  4A9L A;  3QZT A;  4NUC A;  4O7B A;  5LKT A;  2RFJ A;  4Q0N A;  4WHW A;  5HM0 A;  5C89 A;  4QSV A;  5A5N A;  3I3J A;  5A5S A;  4QR5 A;  5EA1 A;  4WHU A;  5D0C A;  3MB4 A;  5D3P A;  4N3W A;  5HFQ A;  4TYL A;  4UYD A;  4QST A;  4TT2 A;  4UIX A;  5LVQ A;  4MR6 A;  5EQ1 A;  4UYF A;  5FE7 A;  5C4Q A;  4TU4 A;  5I86 A;  4C66 A;  4O7A A;  5E3D A;  4A9H A;  5CP5 A;  4YYH A;  5DKH A;  4RVR A;  4TS8 A;  5CUD A;  3FKM X;  5I88 A;  3UV5 A;  4PKL A;  2KTB B;  5D3S A;  4FLP A;  4LYI A;  5F3A A;  5AD3 A;  5FE0 A;  5FE8 A;  5HFR A;  2D82 A;  5JI8 A;  2WP2 A;  2EJN A;  5CRM A;  5CQ8 A;  4TQN A;  5K29 A;  5ETD A;  4QSP A;  4CUQ A;  4N4I A;  5ENJ A;  4HXO A;  5E9I A;  4QEW A;  4AKI A;  2YYN A;  3D1D A;  4UIU A;  4F3I A;  5EWW A;  4CLB A;  5EIC A;  4YYK A;  4IOR A;  4BW4 A;  5FE3 A;  3LQH A;  4TU6 A;  2F6J A;  5FE9 A;  4TTE A;  5HEL A;  5HRX A;  4BJX A;  5LKX A;  3GG3 A;  3U5O A;  2OUO A;  5D3T A;  5D7X A;  4A9I A;  3QZS A;  5COI A;  5IID A;  5F60 A;  4AKH A;  1F68 A;  5FFV A;  4LR6 A;  5LVR A;  4UIY A;  5CUA A;  5I1Q A;  4Z93 A;  4YYM A;  3P1F A;  1JM4 B;  4LZR A;  4A9O A;  1ZS5 A;  5C85 A;  2I8N A;  4QYL A;  3QZV A;  5LJ1 A;  5F1H A;  5H1U A;  5I40 A;  5H1T A;  2DVR A;  5II2 A;  4BW2 A;  3VKH A;  2YW5 A;  4IOO A;  5TB6 A;  4NQM A;  3Q2E A;  4IOQ A;  4QSR A;  5E9V A;  5EI4 A;  3Q2F A;  5FFY A;  4NYV A;  5J0D A;  4O7E A;  5CUC A;  2I7K A;  3MUL A;  5FB1 A;  4YYI A;  5CQ7 A;  2N9G A;  2RNY A;  4WIV A;  5I83 A;  4QSW A;  4YY4 A;  5F63 A;  5FDZ A;  4O70 A;  4QUT A;  4YY6 A;  4QSU A;  3HMF A;  4YH3 A;  5EP7 A;  5CQ5 A;  5EVA A;  4Z6H A;  4HXP A;  4QUU A;  4J0R A;  2E3K A;  4IR4 A;  5EGU A;  4O76 A;  5ENE A;  5DX4 A;  2NXB A;  4UIT A;  5HCL A;  4O78 A;  4KV4 A;  4MEP A;  4LDF A;  5EV9 A;  5EPB A;  5FE1 A;  4OUF A;  4CFL A;  5IGM A;  5FH6 A;  4YK0 A;  2D9E A;  4NXJ A;  2YEK A;  4E96 A;  5CU8 A;  5A83 A;  4NR9 A;  1WUM A;  4XY9 A;  5EWC A;  5EWH A;  4NRA A;  5F62 A;  2OSS A;  4TZ8 A;  4HXM A;  5DW1 A;  4MEQ A;  5D3H A;  4Z1Q A;  5D3L A;  3LQI A;  1X0J A;  4PCE A;  4NUD A; 
#chains in the Genus database with same CATH homology
 3D7C A;  4MR4 A;  3UVD A;  3U5P A;  5KTX A;  5H1V A;  4NRC A;  4MEN A;  5L8T A;  4QC1 A;  3O36 A;  4HBY A;  5CPE A;  3O33 A;  5D3N A;  4NR6 A;  4PTB A;  4ALH A;  2F6N A;  4IR5 A;  5E7D A;  4YBT A;  3DWY A;  4UIW A;  5CS8 A;  2FSA A;  3P1C A;  2R0Y A;  4N4H A;  3RCW A;  2WP1 A;  3U5J A;  4CFK A;  5DY7 A;  4IR3 A;  1EQF A;  5DFC A;  5FBX A;  4ZW1 A;  4BHW A;  5HQ7 A;  5KTU A;  4O7C A;  2L5E A;  2L84 A;  4HXK A;  4NR5 A;  5E9M A;  5F25 A;  5FG5 A;  5ENI A;  4N4G A;  4HBV A;  4XY8 A;  4UYH A;  4BW3 A;  5CQA A;  4Y03 A;  5C8G A;  5L97 A;  2YQD A;  2E7N A;  5BT5 A;  5HJC A;  5F36 A;  4Z1S A;  4QSX A;  4A9E A;  5EPS A;  4HXR A;  4UYG A;  5E0R A;  4QYD A;  1N72 A;  4QY4 A;  4QNS A;  4PCI A;  5L96 A;  4A9K A;  2H60 A;  4IR6 A;  3SVG A;  4Q0O A;  5HQ6 A;  5D26 A;  4NRB A;  5CQT A;  5CUB A;  5A5O A;  3U5M A;  5ENH A;  5L8U A;  5I7Y A;  4O77 A;  4J1P A;  4O71 A;  3DAI A;  5ENC A;  5H85 A;  5F1L A;  1WUG A;  5IGN A;  3MXF A;  5AD2 A;  3JVK A;  5IGK A;  2R0S A;  4OGI A;  1E6I A;  4QEU A;  5A81 A;  5CQ6 A;  5LJ0 A;  3O34 A;  4XUA A;  3MB3 A;  3SVF A;  4LZ2 A;  5CTL A;  5E3G A;  5KHM A;  2R10 A;  3K2J A;  2YEM A;  4DON A;  4A9J A;  5ENG A;  4UYF B;  2YEL A;  2DAT A;  4NR4 A;  3UVX A;  4UYE A;  4YYD A;  3LXJ A;  5DYX A;  4HBX A;  5FFW A;  2DVV A;  5EM3 A;  5EWD A;  3U5N A;  3O35 A;  2G4A A;  3S92 A;  2R0V A;  4LRG A;  4MEO A;  5HEN A;  5FG6 A;  5KU3 A;  4HXS A;  4CUU A;  3O37 A;  3SVH A;  3LJW A;  3UVY A;  4UIZ A;  4XUB A;  5F61 A;  3AQA A;  5HRW A;  3UW9 A;  4YH4 A;  5C7N A;  4X2I A;  4ALG A;  4QBM A;  4CUR A;  4YAB A;  4CUP A;  4KV1 A;  5BT3 A;  2DVS A;  4LYS A;  5CGP A;  4NUE A;  5EK9 A;  5A5R A;  5I89 A;  4MR5 A;  4AKN A;  3IU5 A;  4Z6I A;  4NR8 A;  4KCX A;  5LJ2 A;  4QB3 A;  2GRC A;  5CY9 A;  3TLP A;  5HQ5 A;  3UV2 A;  4ZQL A;  4QC3 A;  4YAT A;  3MQM A;  5DFD A;  2DKW A;  2RS9 B;  4J3I A;  2MJV B;  3ZYU A;  5DLX A;  4NYW A;  5E9Y A;  4LZS A;  3P1D A;  5FB0 A;  4O72 A;  5A85 A;  4CL9 A;  2RNW A;  5D25 A;  4LYW A;  5LUU A;  4TT6 A;  5CUG A;  5FH7 A;  3ONI A;  5F5Z A;  5CRZ A;  5L99 A;  5DBM A;  5EPR A;  4PY6 A;  5LKZ A;  5JWM A;  5KTW A;  4QZS A;  2OO1 A;  3JVL A;  5CUE A;  5A82 A;  4NR7 A;  3U5L A;  4C67 A;  4TZ2 A;  5FE2 A;  5DYA A;  5E9K A;  5EWV A;  4NQN A;  4HXL A;  4YYJ A;  5HRV A;  4BW1 A;  5EIS A;  5D3R A;  5FH8 A;  3G0L A;  5KO4 A;  2RO1 A;  2L85 A;  3AAD A;  2DWW A;  3MUK A;  4GPJ A;  5CZG A;  5I29 A;  5C87 A;  5ETB A;  4YAD A;  5IG6 A;  5AMF A;  4N4F A;  5L98 A;  5DYC A;  2RNX A;  5BT4 A;  4CUT A;  5E9L A;  4QR3 A;  5DFB A;  2RI7 A;  4HXN A;  4YBM A;  5G4S A;  3HME A;  3JVM A;  4NS5 A;  4J0S A;  5A5Q A;  5TCM A;  5FG4 A;  5DYU A;  5EU1 A;  3LQJ A;  4YYN A;  5FE5 A;  5ENF A;  2E7O A;  4A9N A;  4NYX A;  5IBN A;  5ACY A;  4O7F A;  5I7X A;  5I80 A;  4YBS A;  5DLZ A;  3UV4 A;  5II1 A;  3G0J A;  5IGL A;  5HLS A;  5DKD A;  2YDW A;  5E73 A;  4YYG A;  5CFW A;  3P1E A;  5G4R A;  4QR4 A;  4QSQ A;  3P5O A;  4YAX A;  5DW2 A;  2DVQ A;  5FE6 A;  3S91 A;  4CUS A;  5LKU A;  4A9F A;  4PS5 A;  5FE4 A;  1JSP B;  5CQ3 A;  4MR3 A;  4TT4 A;  4XYA A;  3UVW A;  4A9M A;  5D24 A;  5E74 A;  4YC9 A;  5CQ4 A;  3HMH A;  3NXB A;  4HBW A;  4ZC9 A;  5A5P A;  3JVJ A;  5AME A;  5HEM A;  5D3J A;  3IU6 A;  5F2P A;  2LSP B;  4O75 A;  3U5K A;  5DKC A;  4LC2 A;  4OGJ A;  5A7C A;  4O74 A;  4QEV A;  4UIV A;  4QSS A;  5ENB A;  4A9L A;  3QZT A;  4NUC A;  4O7B A;  5LKT A;  2RFJ A;  4Q0N A;  4WHW A;  5HM0 A;  5C89 A;  4QSV A;  5A5N A;  3I3J A;  5A5S A;  4QR5 A;  5EA1 A;  4WHU A;  5D0C A;  3MB4 A;  5D3P A;  4N3W A;  5HFQ A;  4TYL A;  4UYD A;  4QST A;  4TT2 A;  4UIX A;  5LVQ A;  4MR6 A;  5EQ1 A;  4UYF A;  5FE7 A;  5C4Q A;  4TU4 A;  5I86 A;  4C66 A;  4O7A A;  5E3D A;  4A9H A;  5CP5 A;  4YYH A;  5DKH A;  4RVR A;  4TS8 A;  5CUD A;  3FKM X;  5I88 A;  3UV5 A;  4PKL A;  2KTB B;  5D3S A;  4FLP A;  4LYI A;  5F3A A;  5AD3 A;  5FE0 A;  5FE8 A;  5HFR A;  2D82 A;  5JI8 A;  2WP2 A;  5CRM A;  5CQ8 A;  4TQN A;  5K29 A;  5ETD A;  4QSP A;  4CUQ A;  4N4I A;  5ENJ A;  4HXO A;  5E9I A;  4QEW A;  2YYN A;  4UIU A;  4F3I A;  5EWW A;  4CLB A;  5EIC A;  4YYK A;  4IOR A;  4BW4 A;  5FE3 A;  3LQH A;  4TU6 A;  2F6J A;  5FE9 A;  4TTE A;  5HEL A;  5HRX A;  4BJX A;  5LKX A;  3GG3 A;  3U5O A;  2OUO A;  5D3T A;  5D7X A;  4A9I A;  3QZS A;  5COI A;  5IID A;  5F60 A;  1F68 A;  5FFV A;  4LR6 A;  5LVR A;  4UIY A;  5CUA A;  5I1Q A;  4Z93 A;  4YYM A;  3P1F A;  1JM4 B;  4LZR A;  4A9O A;  1ZS5 A;  5C85 A;  2I8N A;  4QYL A;  3QZV A;  5LJ1 A;  5F1H A;  5H1U A;  5I40 A;  5H1T A;  2DVR A;  5II2 A;  4BW2 A;  2YW5 A;  4IOO A;  5TB6 A;  4NQM A;  3Q2E A;  4IOQ A;  4QSR A;  5E9V A;  5EI4 A;  3Q2F A;  5FFY A;  4NYV A;  5J0D A;  4O7E A;  5CUC A;  2I7K A;  3MUL A;  5FB1 A;  4YYI A;  5CQ7 A;  2N9G A;  2RNY A;  4WIV A;  5I83 A;  4QSW A;  4YY4 A;  5F63 A;  5FDZ A;  4O70 A;  4QUT A;  4YY6 A;  4QSU A;  3HMF A;  4YH3 A;  5EP7 A;  5CQ5 A;  5EVA A;  4Z6H A;  4HXP A;  4QUU A;  4J0R A;  2E3K A;  4IR4 A;  5EGU A;  4O76 A;  5ENE A;  5DX4 A;  2NXB A;  4UIT A;  5HCL A;  4O78 A;  4KV4 A;  4MEP A;  4LDF A;  5EV9 A;  5EPB A;  5FE1 A;  4OUF A;  4CFL A;  5IGM A;  5FH6 A;  4YK0 A;  2D9E A;  4NXJ A;  2YEK A;  4E96 A;  5CU8 A;  5A83 A;  4NR9 A;  1WUM A;  4XY9 A;  5EWC A;  5EWH A;  4NRA A;  5F62 A;  2OSS A;  4TZ8 A;  4HXM A;  5DW1 A;  4MEQ A;  5D3H A;  4Z1Q A;  5D3L A;  3LQI A;  1X0J A;  4PCE A;  4NUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...