3MB3A

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
116
structure length
116
Chain Sequence
YDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PH-interacting protein
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3mb3A00
5JI8A 5EQ1A 5CP5A 1E6IA 3O37A 5I7YA 3LQJA 4LC2A 4QBMA 3JVKA 5ENIA 4HXOA 4A9HA 5HM0A 2RS9B 4NR5A 4QSTA 5ENJA 4QR3A 4TT4A 4LDFA 4YY6A 5LJ2A 2R10A 4O76A 5CUBA 5EVAA 4HXSA 1JM4B 4YYDA 5E73A 4YY4A 2WP1A 4UYGA 5CQ7A 5LVQA 5CS8A 4HBVA 2GRCA 2E7NA 5I1QA 4MEQA 4N4IA 3ONIA 5HELA 2YDWA 5D3PA 4IR4A 2DATA 3UV2A 2R0YA 4UYHA 5G4SA 4WIVA 4OGJA 5E3GA 5IGLA 5BT3A 5L97A 5DLXA 5DYXA 4DONA 5C89A 4XYAA 5ACYA 3MUKA 5IIDA 4N3WA 4NYVA 4A9IA 3JVLA 3UV4A 5II2A 3P1CA 3D7CA 2MJVB 5LKTA 4OGIA 4HXRA 5DYCA 5HLSA 5FBXA 5F1LA 5DKHA 4QEWA 4CUSA 2RO1A 4QC3A 3HMFA 5FG5A 4PKLA 4UYEA 5FE2A 5D3RA 4MR5A 5D3NA 4YYGA 5CQ8A 5F36A 5CZGA 4ZQLA 4MR4A 2E3KA 1JSPB 5D3TA 4OUFA 4CFLA 4HBXA 5CY9A 4QY4A 4IOQA 5CQ6A 4BJXA 4QYDA 1X0JA 4IR3A 4TTEA 5EWWA 4LZSA 4HXMA 5A83A 5KTUA 4NYWA 5L8UA 2RNXA 4IOOA 5EGUA 4QEVA 5ENHA 4O7BA 4MEOA 5F5ZA 2G4AA 5H1UA 5CFWA 5CGPA 5DYUA 5I29A 4Z6IA 5HQ6A 2FSAA 5H1TA 5II1A 4N4GA 5C8GA 4NS5A 5A5PA 4UYFA 5HENA 5A81A 4IR5A 4F3IA 5D3JA 5E9LA 2DKWA 3LXJA 4UIUA 4XUAA 5DX4A 4LRGA 5FB0A 5A82A 5TCMA 1N72A 3QZTA 5FH8A 4TZ2A 4YYMA 4J0RA 4PCEA 4LYIA 2YW5A 5DW1A 3MB4A 4O7AA 5JWMA 5TB6A 4CFKA 5HJCA 5D0CA 5F63A 4QR4A 4YYHA 4KV4A 4Q0OA 4QZSA 2D82A 5KO4A 4TT6A 5CUCA 1WUGA 5F62A 4UYDA 4O77A 4YBMA 5EWHA 5FFWA 4IR6A 4QSWA 5E9VA 4A9FA 4O7FA 4O7EA 5FE0A 4BW2A 3O33A 4X2IA 4Z6HA 4PTBA 5IGKA 4QC1A 5A7CA 5AMEA 5CQ5A 5L8TA 4NR9A 5AMFA 2WP2A 5EU1A 5IGMA 5D24A 4LYWA 4LYSA 5C85A 4QYLA 5E9MA 4PCIA 5H85A 5E74A 4HXKA 2DVVA 4TS8A 2YEKA 4LZRA 5I88A 3HMEA 4ZW1A 2DVSA 4NYXA 5C4QA 5ENBA 5ENGA 5HCLA 4NUDA 5EPBA 5KTXA 4ALGA 5A85A 5FE9A 2D9EA 5CTLA 4A9LA 4BW3A 5HRWA 5G4RA 4YH3A 5D3SA 5HQ5A 4NRCA 4NR6A 5CPEA 4NRBA 5LUUA 4HXNA 5CU8A 5ETDA 4YAXA 2NXBA 3P5OA 3K2JA 4Z1SA 4A9KA 5FE4A 4YC9A 3SVFA 2F6JA 5I83A 5I80A 3QZVA 4MR6A 4QSRA 5HFRA 5CQAA 4HBYA 5IGNA 2LSPB 3JVJA 5D7XA 5DFDA 2H60A 3O34A 5DKCA 3SVGA 4Z1QA 5CUAA 3SVHA 5EK9A 2OSSA 2DWWA 3LJWA 5EWDA 3ZYUA 4TYLA 2RI7A 4XY8A 3JVMA 3I3JA 4HXPA 4N4FA 5CUGA 3UV5A 5HRVA 5D3HA 4O7CA 5A5RA 5EWCA 5EWVA 4AKNA 5KHMA 4N4HA 2YEMA 5DYAA 2R0VA 5D3LA 5IBNA 4YYNA 4CUUA 3O36A 4TT2A 4UYFB 4NUEA 5DFCA 5AD3A 5E0RA 3UVWA 5FFYA 5F60A 5I7XA 5L98A 3GG3A 4A9NA 2RFJA 4BW1A 5HFQA 3IU6A 5FH6A 3MULA 2DVRA 3U5PA 4NQNA 5E3DA 5FG6A 5LKZA 4TU6A 5KTWA 4QSUA 3MXFA 4NQMA 4C66A 3DAIA 1WUMA 5CQ4A 5LKXA 5BT5A 4QEUA 2KTBB 4NR8A 5ENFA 5FFVA 4QR5A 3NXBA 4WHWA 4UIXA 4MR3A 5CQ3A 4O74A 4UIZA 5ENCA 5DFBA 4QB3A 5H1VA 1F68A 3O35A 5CRMA 4RVRA 5F25A 5AD2A 4MEPA 4QUTA 5C7NA 4CL9A 4CUQA 4UIWA 4CUPA 4YBTA 3MB3A 4CURA 5FDZA 4QSSA 5FE8A 5EPSA 4UITA 5F3AA 4MENA 4WHUA 4LR6A 4ZC9A 4YBSA 5EV9A 5CUDA 3DWYA 5COIA 3Q2FA 4NUCA 5DLZA 5KU3A 5LJ1A 2OUOA 4J0SA 5FE3A 5FH7A 4TZ8A 3AADA 5FG4A 3P1FA 5E7DA 2I7KA 5EI4A 4BW4A 1EQFA 3G0LA 4C67A 5C87A 3TLPA 5I89A 5F2PA 5LJ0A 4UIYA 4Y03A 2F6NA 4LZ2A 3S91A 5F1HA 2L5EA 4YYJA 4KV1A 4O75A 4QSXA 3U5LA 4O70A 4QNSA 5I40A 3UW9A 5EP7A 3P1EA 4TQNA 5ENEA 4QSPA 4IORA 3Q2EA 5A5SA 4J1PA 5FE5A 4O71A 3UVDA 2OO1A 2RNWA 4A9MA 3U5OA 4YABA 5FE7A 4ALHA 5F61A 5LVRA 5ETBA 3UVYA 3FKMX 2R0SA 4BHWA 4J3IA 4QUUA 3U5JA 2RNYA 2E7OA 4QSQA 5CQTA 3P1DA 2L84A 4HXLA 5DY7A 2YYNA 3G0JA 5EM3A 5A5QA 4A9JA 2N9GA 5DW2A 3UVXA 4QSVA 4YATA 5EISA 5EA1A 5A5OA 4FLPA 3U5KA 5BT4A 1ZS5A 3U5MA 5D26A 5L99A 3U5NA 4Z93A 5K29A 4TU4A 4XY9A 5E9YA 2I8NA 4PY6A 4KCXA 5IG6A 4GPJA 4Q0NA 5FE1A 5EPRA 4O78A 5HEMA 5CRZA 5E9KA 5J0DA 5HQ7A 4YYIA 4YK0A 4YADA 2L85A 3AQAA 4YYKA 2DVQA 4O72A 3IU5A 2YQDA 5LKUA 5FE6A 5A5NA 3LQHA 5EICA 5HRXA 4NRAA 4PS5A 4A9OA 4YH4A 3RCWA 5E9IA 4HBWA 5DBMA 4E96A 4XUBA 4UIVA 3S92A 3HMHA 3QZSA 5DKDA 2YELA 4NR7A 5FB1A 5D25A 4CUTA 5I86A 4NXJA 4A9EA 5CUEA 5L96A 4CLBA 4NR4A 3MQMA 3LQIA
chains in the Genus database with same CATH superfamily
5JI8A 5EQ1A 5CP5A 1E6IA 3O37A 5I7YA 3LQJA 4LC2A 4QBMA 3JVKA 5ENIA 4HXOA 4A9HA 5HM0A 2RS9B 4NR5A 4QSTA 5ENJA 4QR3A 4TT4A 4LDFA 4YY6A 5LJ2A 2R10A 4O76A 5CUBA 5EVAA 4HXSA 1JM4B 4YYDA 5E73A 4YY4A 2WP1A 4UYGA 5CQ7A 5LVQA 5CS8A 4HBVA 2GRCA 2E7NA 5I1QA 4MEQA 4N4IA 3ONIA 5HELA 2YDWA 5D3PA 4IR4A 3D1DA 2DATA 3UV2A 2R0YA 4UYHA 5G4SA 4WIVA 4OGJA 5E3GA 5IGLA 5BT3A 5L97A 5DLXA 5DYXA 4DONA 5C89A 4XYAA 5ACYA 3MUKA 5IIDA 4N3WA 4NYVA 4A9IA 3JVLA 3UV4A 5II2A 3P1CA 3D7CA 2MJVB 5LKTA 4OGIA 4HXRA 5DYCA 5HLSA 5FBXA 5F1LA 5DKHA 4QEWA 4CUSA 2RO1A 4QC3A 3HMFA 5FG5A 4PKLA 4UYEA 5FE2A 5D3RA 4MR5A 5D3NA 4YYGA 5CQ8A 5F36A 5CZGA 4ZQLA 4MR4A 2E3KA 1JSPB 5D3TA 4OUFA 4CFLA 4HBXA 5CY9A 4QY4A 4IOQA 5CQ6A 4BJXA 4QYDA 1X0JA 4IR3A 4TTEA 5EWWA 4LZSA 4HXMA 5A83A 5KTUA 4AI6A 4NYWA 5L8UA 2RNXA 4IOOA 5EGUA 4QEVA 5ENHA 4O7BA 4MEOA 5F5ZA 2G4AA 5H1UA 5CFWA 5CGPA 5DYUA 5I29A 4Z6IA 5HQ6A 2FSAA 5H1TA 5II1A 4N4GA 5C8GA 4NS5A 5A5PA 4UYFA 5HENA 5A81A 4IR5A 4F3IA 5D3JA 5E9LA 2DKWA 3LXJA 4UIUA 4XUAA 5DX4A 4LRGA 4AKIA 5FB0A 5A82A 5TCMA 1N72A 3QZTA 5FH8A 4TZ2A 3ERRA 4YYMA 4J0RA 4PCEA 4LYIA 2YW5A 5DW1A 3MB4A 4O7AA 5JWMA 5TB6A 4CFKA 5HJCA 5D0CA 5F63A 4QR4A 4YYHA 4KV4A 4Q0OA 4QZSA 2D82A 5KO4A 4TT6A 5CUCA 1WUGA 5F62A 4UYDA 4O77A 4YBMA 5EWHA 5FFWA 4IR6A 4QSWA 5E9VA 4A9FA 4O7FA 4O7EA 5FE0A 4BW2A 3O33A 4X2IA 4Z6HA 4PTBA 5IGKA 4QC1A 5A7CA 5AMEA 5CQ5A 5L8TA 4NR9A 5AMFA 2WP2A 5EU1A 5IGMA 5D24A 4LYWA 4LYSA 5C85A 4QYLA 5E9MA 4PCIA 5H85A 5E74A 4HXKA 2DVVA 4TS8A 2YEKA 4LZRA 5I88A 3HMEA 4ZW1A 2DVSA 4NYXA 5C4QA 5ENBA 5ENGA 5HCLA 4NUDA 5EPBA 5KTXA 4ALGA 5A85A 5FE9A 2D9EA 5CTLA 4A9LA 4BW3A 5HRWA 5G4RA 4YH3A 5D3SA 5HQ5A 4NRCA 4NR6A 5CPEA 4NRBA 5LUUA 4HXNA 5CU8A 5ETDA 4YAXA 2NXBA 3P5OA 3K2JA 4Z1SA 4A9KA 5FE4A 4YC9A 3SVFA 2F6JA 5I83A 5I80A 3QZVA 4MR6A 4QSRA 5HFRA 5CQAA 4HBYA 5IGNA 2LSPB 3JVJA 5D7XA 5DFDA 2H60A 3O34A 5DKCA 3SVGA 4Z1QA 5CUAA 3SVHA 5EK9A 2OSSA 2DWWA 3LJWA 5EWDA 3ZYUA 4TYLA 2RI7A 4XY8A 3JVMA 3I3JA 4HXPA 4N4FA 5CUGA 3UV5A 5HRVA 5D3HA 4O7CA 5A5RA 5EWCA 4AKHA 5EWVA 4AKNA 5KHMA 4N4HA 2YEMA 5DYAA 2R0VA 5D3LA 5IBNA 4YYNA 4CUUA 2EJNA 3O36A 4TT2A 4UYFB 4NUEA 5DFCA 5AD3A 5E0RA 3UVWA 5FFYA 5F60A 5I7XA 1ZKRA 5L98A 3GG3A 4A9NA 2RFJA 4BW1A 5HFQA 3IU6A 5FH6A 3MULA 2DVRA 3U5PA 4NQNA 5E3DA 5FG6A 5LKZA 4TU6A 5KTWA 4QSUA 3MXFA 4NQMA 4C66A 3DAIA 1WUMA 5CQ4A 5LKXA 5BT5A 4QEUA 2KTBB 4NR8A 5ENFA 5FFVA 4QR5A 3NXBA 4WHWA 4UIXA 4MR3A 5CQ3A 4O74A 4UIZA 5ENCA 5DFBA 4QB3A 5H1VA 3D1BA 1F68A 3O35A 5CRMA 4RVRA 5F25A 5AD2A 4MEPA 4QUTA 5C7NA 4CL9A 4CUQA 4UIWA 4CUPA 4YBTA 3MB3A 4CURA 5FDZA 4QSSA 5FE8A 5EPSA 4UITA 5F3AA 4MENA 4WHUA 4LR6A 4ZC9A 4YBSA 1PUOA 5EV9A 5CUDA 3DWYA 5COIA 3Q2FA 4NUCA 5DLZA 5KU3A 5LJ1A 2OUOA 4J0SA 5FE3A 5FH7A 4TZ8A 3AADA 5FG4A 3P1FA 5E7DA 2I7KA 5EI4A 4BW4A 1EQFA 3G0LA 4C67A 5C87A 3TLPA 5I89A 5F2PA 5LJ0A 4UIYA 4Y03A 2F6NA 4LZ2A 3S91A 5F1HA 2L5EA 4YYJA 4KV1A 4O75A 4QSXA 3U5LA 4O70A 4QNSA 5I40A 3UW9A 5EP7A 3P1EA 4TQNA 5ENEA 4QSPA 4IORA 3Q2EA 5A5SA 4J1PA 5FE5A 4O71A 3UVDA 2OO1A 2RNWA 4A9MA 3U5OA 4YABA 5FE7A 4ALHA 5F61A 5LVRA 5ETBA 3UVYA 3FKMX 2R0SA 4BHWA 4J3IA 4QUUA 3U5JA 2RNYA 2E7OA 4QSQA 5CQTA 3P1DA 2L84A 4HXLA 5DY7A 2YYNA 3G0JA 5EM3A 5A5QA 3VKGA 4A9JA 2N9GA 5DW2A 3UVXA 4QSVA 4YATA 5EISA 5EA1A 4AKGA 5A5OA 4FLPA 3U5KA 5BT4A 1ZS5A 3U5MA 5D26A 5L99A 3U5NA 4Z93A 5K29A 4TU4A 4XY9A 5E9YA 2I8NA 4PY6A 4KCXA 5IG6A 4GPJA 4Q0NA 5FE1A 5EPRA 4O78A 5HEMA 3VKHA 5CRZA 5E9KA 5J0DA 5HQ7A 4YYIA 4YK0A 4YADA 2L85A 3AQAA 4YYKA 2DVQA 4O72A 3IU5A 2YQDA 5LKUA 5FE6A 5A5NA 3LQHA 5EICA 5HRXA 4NRAA 4PS5A 4A9OA 4YH4A 3RCWA 5E9IA 4HBWA 5DBMA 4E96A 4XUBA 4UIVA 3S92A 3HMHA 3QZSA 5DKDA 2YELA 4NR7A 5FB1A 5D25A 4CUTA 5I86A 4NXJA 4A9EA 5CUEA 5L96A 4CLBA 4NR4A 3MQMA 3LQIA
chains in the Genus database with same CATH topology
5JI8A 5EQ1A 5CP5A 1E6IA 3O37A 5I7YA 3LQJA 4LC2A 4QBMA 3JVKA 5ENIA 4HXOA 4A9HA 5HM0A 2RS9B 4NR5A 4QSTA 5ENJA 4QR3A 4TT4A 4LDFA 4YY6A 5LJ2A 2R10A 4O76A 5CUBA 5EVAA 4HXSA 1JM4B 4YYDA 5E73A 4YY4A 2WP1A 4UYGA 5CQ7A 5LVQA 5CS8A 4HBVA 2GRCA 2E7NA 5I1QA 4MEQA 4N4IA 3ONIA 5HELA 2YDWA 5D3PA 4IR4A 2DATA 3UV2A 2R0YA 4UYHA 5G4SA 4WIVA 4OGJA 5E3GA 5IGLA 5BT3A 5L97A 5DLXA 5DYXA 4DONA 5C89A 4XYAA 5ACYA 3MUKA 5IIDA 4N3WA 4NYVA 4A9IA 3JVLA 3UV4A 5II2A 3P1CA 3D7CA 2MJVB 5LKTA 4OGIA 4HXRA 5DYCA 5HLSA 5FBXA 5F1LA 5DKHA 4QEWA 4CUSA 2RO1A 4QC3A 3HMFA 5FG5A 4PKLA 4UYEA 5FE2A 5D3RA 4MR5A 5D3NA 4YYGA 5CQ8A 5F36A 5CZGA 4ZQLA 4MR4A 2E3KA 1JSPB 5D3TA 4OUFA 4CFLA 4HBXA 5CY9A 4QY4A 4IOQA 5CQ6A 4BJXA 4QYDA 1X0JA 4IR3A 4TTEA 5EWWA 4LZSA 4HXMA 5A83A 5KTUA 4NYWA 5L8UA 2RNXA 4IOOA 5EGUA 4QEVA 5ENHA 4O7BA 4MEOA 5F5ZA 2G4AA 5H1UA 5CFWA 5CGPA 5DYUA 5I29A 4Z6IA 5HQ6A 2FSAA 5H1TA 5II1A 4N4GA 5C8GA 4NS5A 5A5PA 4UYFA 5HENA 5A81A 4IR5A 4F3IA 5D3JA 5E9LA 2DKWA 3LXJA 4UIUA 4XUAA 5DX4A 4LRGA 5FB0A 5A82A 5TCMA 1N72A 3QZTA 5FH8A 4TZ2A 4YYMA 4J0RA 4PCEA 4LYIA 2YW5A 5DW1A 3MB4A 4O7AA 5JWMA 5TB6A 4CFKA 5HJCA 5D0CA 5F63A 4QR4A 4YYHA 4KV4A 4Q0OA 4QZSA 2D82A 5KO4A 4TT6A 5CUCA 1WUGA 5F62A 4UYDA 4O77A 4YBMA 5EWHA 5FFWA 4IR6A 4QSWA 5E9VA 4A9FA 4O7FA 4O7EA 5FE0A 4BW2A 3O33A 4X2IA 4Z6HA 4PTBA 5IGKA 4QC1A 5A7CA 5AMEA 5CQ5A 5L8TA 4NR9A 5AMFA 2WP2A 5EU1A 5IGMA 5D24A 4LYWA 4LYSA 5C85A 4QYLA 5E9MA 4PCIA 5H85A 5E74A 4HXKA 2DVVA 4TS8A 2YEKA 4LZRA 5I88A 3HMEA 4ZW1A 2DVSA 4NYXA 5C4QA 5ENBA 5ENGA 5HCLA 4NUDA 5EPBA 5KTXA 4ALGA 5A85A 5FE9A 2D9EA 5CTLA 4A9LA 4BW3A 5HRWA 5G4RA 4YH3A 5D3SA 5HQ5A 4NRCA 4NR6A 5CPEA 4NRBA 5LUUA 4HXNA 5CU8A 5ETDA 4YAXA 2NXBA 3P5OA 3K2JA 4Z1SA 4A9KA 5FE4A 4YC9A 3SVFA 2F6JA 5I83A 5I80A 3QZVA 4MR6A 4QSRA 5HFRA 5CQAA 4HBYA 5IGNA 2LSPB 3JVJA 5D7XA 5DFDA 2H60A 3O34A 5DKCA 3SVGA 4Z1QA 5CUAA 3SVHA 5EK9A 2OSSA 2DWWA 3LJWA 5EWDA 3ZYUA 4TYLA 2RI7A 4XY8A 3JVMA 3I3JA 4HXPA 4N4FA 5CUGA 3UV5A 5HRVA 5D3HA 4O7CA 5A5RA 5EWCA 5EWVA 4AKNA 5KHMA 4N4HA 2YEMA 5DYAA 2R0VA 5D3LA 5IBNA 4YYNA 4CUUA 3O36A 4TT2A 4UYFB 4NUEA 5DFCA 5AD3A 5E0RA 3UVWA 5FFYA 5F60A 5I7XA 5L98A 3GG3A 4A9NA 2RFJA 4BW1A 5HFQA 3IU6A 5FH6A 3MULA 2DVRA 3U5PA 4NQNA 5E3DA 5FG6A 5LKZA 4TU6A 5KTWA 4QSUA 3MXFA 4NQMA 4C66A 3DAIA 1WUMA 5CQ4A 5LKXA 5BT5A 4QEUA 2KTBB 4NR8A 5ENFA 5FFVA 4QR5A 3NXBA 4WHWA 4UIXA 4MR3A 5CQ3A 4O74A 4UIZA 5ENCA 5DFBA 4QB3A 5H1VA 1F68A 3O35A 5CRMA 4RVRA 5F25A 5AD2A 4MEPA 4QUTA 5C7NA 4CL9A 4CUQA 4UIWA 4CUPA 4YBTA 3MB3A 4CURA 5FDZA 4QSSA 5FE8A 5EPSA 4UITA 5F3AA 4MENA 4WHUA 4LR6A 4ZC9A 4YBSA 5EV9A 5CUDA 3DWYA 5COIA 3Q2FA 4NUCA 5DLZA 5KU3A 5LJ1A 2OUOA 4J0SA 5FE3A 5FH7A 4TZ8A 3AADA 5FG4A 3P1FA 5E7DA 2I7KA 5EI4A 4BW4A 1EQFA 3G0LA 4C67A 5C87A 3TLPA 5I89A 5F2PA 5LJ0A 4UIYA 4Y03A 2F6NA 4LZ2A 3S91A 5F1HA 2L5EA 4YYJA 4KV1A 4O75A 4QSXA 3U5LA 4O70A 4QNSA 5I40A 3UW9A 5EP7A 3P1EA 4TQNA 5ENEA 4QSPA 4IORA 3Q2EA 5A5SA 4J1PA 5FE5A 4O71A 3UVDA 2OO1A 2RNWA 4A9MA 3U5OA 4YABA 5FE7A 4ALHA 5F61A 5LVRA 5ETBA 3UVYA 3FKMX 2R0SA 4BHWA 4J3IA 4QUUA 3U5JA 2RNYA 2E7OA 4QSQA 5CQTA 3P1DA 2L84A 4HXLA 5DY7A 2YYNA 3G0JA 5EM3A 5A5QA 4A9JA 2N9GA 5DW2A 3UVXA 4QSVA 4YATA 5EISA 5EA1A 5A5OA 4FLPA 3U5KA 5BT4A 1ZS5A 3U5MA 5D26A 5L99A 3U5NA 4Z93A 5K29A 4TU4A 4XY9A 5E9YA 2I8NA 4PY6A 4KCXA 5IG6A 4GPJA 4Q0NA 5FE1A 5EPRA 4O78A 5HEMA 5CRZA 5E9KA 5J0DA 5HQ7A 4YYIA 4YK0A 4YADA 2L85A 3AQAA 4YYKA 2DVQA 4O72A 3IU5A 2YQDA 5LKUA 5FE6A 5A5NA 3LQHA 5EICA 5HRXA 4NRAA 4PS5A 4A9OA 4YH4A 3RCWA 5E9IA 4HBWA 5DBMA 4E96A 4XUBA 4UIVA 3S92A 3HMHA 3QZSA 5DKDA 2YELA 4NR7A 5FB1A 5D25A 4CUTA 5I86A 4NXJA 4A9EA 5CUEA 5L96A 4CLBA 4NR4A 3MQMA 3LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JI8 A;  5EQ1 A;  5CP5 A;  1E6I A;  3O37 A;  5I7Y A;  3LQJ A;  4LC2 A;  4QBM A;  3JVK A;  5ENI A;  4HXO A;  4A9H A;  5HM0 A;  2RS9 B;  4NR5 A;  4QST A;  5ENJ A;  4QR3 A;  4TT4 A;  4LDF A;  4YY6 A;  5LJ2 A;  2R10 A;  4O76 A;  5CUB A;  5EVA A;  4HXS A;  1JM4 B;  4YYD A;  5E73 A;  4YY4 A;  2WP1 A;  4UYG A;  5CQ7 A;  5LVQ A;  5CS8 A;  4HBV A;  2GRC A;  2E7N A;  5I1Q A;  4MEQ A;  4N4I A;  3ONI A;  5HEL A;  2YDW A;  5D3P A;  4IR4 A;  2DAT A;  3UV2 A;  2R0Y A;  4UYH A;  5G4S A;  4WIV A;  4OGJ A;  5E3G A;  5IGL A;  5BT3 A;  5L97 A;  5DLX A;  5DYX A;  4DON A;  5C89 A;  4XYA A;  5ACY A;  3MUK A;  5IID A;  4N3W A;  4NYV A;  4A9I A;  3JVL A;  3UV4 A;  5II2 A;  3P1C A;  3D7C A;  2MJV B;  5LKT A;  4OGI A;  4HXR A;  5DYC A;  5HLS A;  5FBX A;  5F1L A;  5DKH A;  4QEW A;  4CUS A;  2RO1 A;  4QC3 A;  3HMF A;  5FG5 A;  4PKL A;  4UYE A;  5FE2 A;  5D3R A;  4MR5 A;  5D3N A;  4YYG A;  5CQ8 A;  5F36 A;  5CZG A;  4ZQL A;  4MR4 A;  2E3K A;  1JSP B;  5D3T A;  4OUF A;  4CFL A;  4HBX A;  5CY9 A;  4QY4 A;  4IOQ A;  5CQ6 A;  4BJX A;  4QYD A;  1X0J A;  4IR3 A;  4TTE A;  5EWW A;  4LZS A;  4HXM A;  5A83 A;  5KTU A;  4NYW A;  5L8U A;  2RNX A;  4IOO A;  5EGU A;  4QEV A;  5ENH A;  4O7B A;  4MEO A;  5F5Z A;  2G4A A;  5H1U A;  5CFW A;  5CGP A;  5DYU A;  5I29 A;  4Z6I A;  5HQ6 A;  2FSA A;  5H1T A;  5II1 A;  4N4G A;  5C8G A;  4NS5 A;  5A5P A;  4UYF A;  5HEN A;  5A81 A;  4IR5 A;  4F3I A;  5D3J A;  5E9L A;  2DKW A;  3LXJ A;  4UIU A;  4XUA A;  5DX4 A;  4LRG A;  5FB0 A;  5A82 A;  5TCM A;  1N72 A;  3QZT A;  5FH8 A;  4TZ2 A;  4YYM A;  4J0R A;  4PCE A;  4LYI A;  2YW5 A;  5DW1 A;  3MB4 A;  4O7A A;  5JWM A;  5TB6 A;  4CFK A;  5HJC A;  5D0C A;  5F63 A;  4QR4 A;  4YYH A;  4KV4 A;  4Q0O A;  4QZS A;  2D82 A;  5KO4 A;  4TT6 A;  5CUC A;  1WUG A;  5F62 A;  4UYD A;  4O77 A;  4YBM A;  5EWH A;  5FFW A;  4IR6 A;  4QSW A;  5E9V A;  4A9F A;  4O7F A;  4O7E A;  5FE0 A;  4BW2 A;  3O33 A;  4X2I A;  4Z6H A;  4PTB A;  5IGK A;  4QC1 A;  5A7C A;  5AME A;  5CQ5 A;  5L8T A;  4NR9 A;  5AMF A;  2WP2 A;  5EU1 A;  5IGM A;  5D24 A;  4LYW A;  4LYS A;  5C85 A;  4QYL A;  5E9M A;  4PCI A;  5H85 A;  5E74 A;  4HXK A;  2DVV A;  4TS8 A;  2YEK A;  4LZR A;  5I88 A;  3HME A;  4ZW1 A;  2DVS A;  4NYX A;  5C4Q A;  5ENB A;  5ENG A;  5HCL A;  4NUD A;  5EPB A;  5KTX A;  4ALG A;  5A85 A;  5FE9 A;  2D9E A;  5CTL A;  4A9L A;  4BW3 A;  5HRW A;  5G4R A;  4YH3 A;  5D3S A;  5HQ5 A;  4NRC A;  4NR6 A;  5CPE A;  4NRB A;  5LUU A;  4HXN A;  5CU8 A;  5ETD A;  4YAX A;  2NXB A;  3P5O A;  3K2J A;  4Z1S A;  4A9K A;  5FE4 A;  4YC9 A;  3SVF A;  2F6J A;  5I83 A;  5I80 A;  3QZV A;  4MR6 A;  4QSR A;  5HFR A;  5CQA A;  4HBY A;  5IGN A;  2LSP B;  3JVJ A;  5D7X A;  5DFD A;  2H60 A;  3O34 A;  5DKC A;  3SVG A;  4Z1Q A;  5CUA A;  3SVH A;  5EK9 A;  2OSS A;  2DWW A;  3LJW A;  5EWD A;  3ZYU A;  4TYL A;  2RI7 A;  4XY8 A;  3JVM A;  3I3J A;  4HXP A;  4N4F A;  5CUG A;  3UV5 A;  5HRV A;  5D3H A;  4O7C A;  5A5R A;  5EWC A;  5EWV A;  4AKN A;  5KHM A;  4N4H A;  2YEM A;  5DYA A;  2R0V A;  5D3L A;  5IBN A;  4YYN A;  4CUU A;  3O36 A;  4TT2 A;  4UYF B;  4NUE A;  5DFC A;  5AD3 A;  5E0R A;  3UVW A;  5FFY A;  5F60 A;  5I7X A;  5L98 A;  3GG3 A;  4A9N A;  2RFJ A;  4BW1 A;  5HFQ A;  3IU6 A;  5FH6 A;  3MUL A;  2DVR A;  3U5P A;  4NQN A;  5E3D A;  5FG6 A;  5LKZ A;  4TU6 A;  5KTW A;  4QSU A;  3MXF A;  4NQM A;  4C66 A;  3DAI A;  1WUM A;  5CQ4 A;  5LKX A;  5BT5 A;  4QEU A;  2KTB B;  4NR8 A;  5ENF A;  5FFV A;  4QR5 A;  3NXB A;  4WHW A;  4UIX A;  4MR3 A;  5CQ3 A;  4O74 A;  4UIZ A;  5ENC A;  5DFB A;  4QB3 A;  5H1V A;  1F68 A;  3O35 A;  5CRM A;  4RVR A;  5F25 A;  5AD2 A;  4MEP A;  4QUT A;  5C7N A;  4CL9 A;  4CUQ A;  4UIW A;  4CUP A;  4YBT A;  3MB3 A;  4CUR A;  5FDZ A;  4QSS A;  5FE8 A;  5EPS A;  4UIT A;  5F3A A;  4MEN A;  4WHU A;  4LR6 A;  4ZC9 A;  4YBS A;  5EV9 A;  5CUD A;  3DWY A;  5COI A;  3Q2F A;  4NUC A;  5DLZ A;  5KU3 A;  5LJ1 A;  2OUO A;  4J0S A;  5FE3 A;  5FH7 A;  4TZ8 A;  3AAD A;  5FG4 A;  3P1F A;  5E7D A;  2I7K A;  5EI4 A;  4BW4 A;  1EQF A;  3G0L A;  4C67 A;  5C87 A;  3TLP A;  5I89 A;  5F2P A;  5LJ0 A;  4UIY A;  4Y03 A;  2F6N A;  4LZ2 A;  3S91 A;  5F1H A;  2L5E A;  4YYJ A;  4KV1 A;  4O75 A;  4QSX A;  3U5L A;  4O70 A;  4QNS A;  5I40 A;  3UW9 A;  5EP7 A;  3P1E A;  4TQN A;  5ENE A;  4QSP A;  4IOR A;  3Q2E A;  5A5S A;  4J1P A;  5FE5 A;  4O71 A;  3UVD A;  2OO1 A;  2RNW A;  4A9M A;  3U5O A;  4YAB A;  5FE7 A;  4ALH A;  5F61 A;  5LVR A;  5ETB A;  3UVY A;  3FKM X;  2R0S A;  4BHW A;  4J3I A;  4QUU A;  3U5J A;  2RNY A;  2E7O A;  4QSQ A;  5CQT A;  3P1D A;  2L84 A;  4HXL A;  5DY7 A;  2YYN A;  3G0J A;  5EM3 A;  5A5Q A;  4A9J A;  2N9G A;  5DW2 A;  3UVX A;  4QSV A;  4YAT A;  5EIS A;  5EA1 A;  5A5O A;  4FLP A;  3U5K A;  5BT4 A;  1ZS5 A;  3U5M A;  5D26 A;  5L99 A;  3U5N A;  4Z93 A;  5K29 A;  4TU4 A;  4XY9 A;  5E9Y A;  2I8N A;  4PY6 A;  4KCX A;  5IG6 A;  4GPJ A;  4Q0N A;  5FE1 A;  5EPR A;  4O78 A;  5HEM A;  5CRZ A;  5E9K A;  5J0D A;  5HQ7 A;  4YYI A;  4YK0 A;  4YAD A;  2L85 A;  3AQA A;  4YYK A;  2DVQ A;  4O72 A;  3IU5 A;  2YQD A;  5LKU A;  5FE6 A;  5A5N A;  3LQH A;  5EIC A;  5HRX A;  4NRA A;  4PS5 A;  4A9O A;  4YH4 A;  3RCW A;  5E9I A;  4HBW A;  5DBM A;  4E96 A;  4XUB A;  4UIV A;  3S92 A;  3HMH A;  3QZS A;  5DKD A;  2YEL A;  4NR7 A;  5FB1 A;  5D25 A;  4CUT A;  5I86 A;  4NXJ A;  4A9E A;  5CUE A;  5L96 A;  4CLB A;  4NR4 A;  3MQM A;  3LQI A; 
#chains in the Genus database with same CATH topology
 5JI8 A;  5EQ1 A;  5CP5 A;  1E6I A;  3O37 A;  5I7Y A;  3LQJ A;  4LC2 A;  4QBM A;  3JVK A;  5ENI A;  4HXO A;  4A9H A;  5HM0 A;  2RS9 B;  4NR5 A;  4QST A;  5ENJ A;  4QR3 A;  4TT4 A;  4LDF A;  4YY6 A;  5LJ2 A;  2R10 A;  4O76 A;  5CUB A;  5EVA A;  4HXS A;  1JM4 B;  4YYD A;  5E73 A;  4YY4 A;  2WP1 A;  4UYG A;  5CQ7 A;  5LVQ A;  5CS8 A;  4HBV A;  2GRC A;  2E7N A;  5I1Q A;  4MEQ A;  4N4I A;  3ONI A;  5HEL A;  2YDW A;  5D3P A;  4IR4 A;  3D1D A;  2DAT A;  3UV2 A;  2R0Y A;  4UYH A;  5G4S A;  4WIV A;  4OGJ A;  5E3G A;  5IGL A;  5BT3 A;  5L97 A;  5DLX A;  5DYX A;  4DON A;  5C89 A;  4XYA A;  5ACY A;  3MUK A;  5IID A;  4N3W A;  4NYV A;  4A9I A;  3JVL A;  3UV4 A;  5II2 A;  3P1C A;  3D7C A;  2MJV B;  5LKT A;  4OGI A;  4HXR A;  5DYC A;  5HLS A;  5FBX A;  5F1L A;  5DKH A;  4QEW A;  4CUS A;  2RO1 A;  4QC3 A;  3HMF A;  5FG5 A;  4PKL A;  4UYE A;  5FE2 A;  5D3R A;  4MR5 A;  5D3N A;  4YYG A;  5CQ8 A;  5F36 A;  5CZG A;  4ZQL A;  4MR4 A;  2E3K A;  1JSP B;  5D3T A;  4OUF A;  4CFL A;  4HBX A;  5CY9 A;  4QY4 A;  4IOQ A;  5CQ6 A;  4BJX A;  4QYD A;  1X0J A;  4IR3 A;  4TTE A;  5EWW A;  4LZS A;  4HXM A;  5A83 A;  5KTU A;  4AI6 A;  4NYW A;  5L8U A;  2RNX A;  4IOO A;  5EGU A;  4QEV A;  5ENH A;  4O7B A;  4MEO A;  5F5Z A;  2G4A A;  5H1U A;  5CFW A;  5CGP A;  5DYU A;  5I29 A;  4Z6I A;  5HQ6 A;  2FSA A;  5H1T A;  5II1 A;  4N4G A;  5C8G A;  4NS5 A;  5A5P A;  4UYF A;  5HEN A;  5A81 A;  4IR5 A;  4F3I A;  5D3J A;  5E9L A;  2DKW A;  3LXJ A;  4UIU A;  4XUA A;  5DX4 A;  4LRG A;  4AKI A;  5FB0 A;  5A82 A;  5TCM A;  1N72 A;  3QZT A;  5FH8 A;  4TZ2 A;  3ERR A;  4YYM A;  4J0R A;  4PCE A;  4LYI A;  2YW5 A;  5DW1 A;  3MB4 A;  4O7A A;  5JWM A;  5TB6 A;  4CFK A;  5HJC A;  5D0C A;  5F63 A;  4QR4 A;  4YYH A;  4KV4 A;  4Q0O A;  4QZS A;  2D82 A;  5KO4 A;  4TT6 A;  5CUC A;  1WUG A;  5F62 A;  4UYD A;  4O77 A;  4YBM A;  5EWH A;  5FFW A;  4IR6 A;  4QSW A;  5E9V A;  4A9F A;  4O7F A;  4O7E A;  5FE0 A;  4BW2 A;  3O33 A;  4X2I A;  4Z6H A;  4PTB A;  5IGK A;  4QC1 A;  5A7C A;  5AME A;  5CQ5 A;  5L8T A;  4NR9 A;  5AMF A;  2WP2 A;  5EU1 A;  5IGM A;  5D24 A;  4LYW A;  4LYS A;  5C85 A;  4QYL A;  5E9M A;  4PCI A;  5H85 A;  5E74 A;  4HXK A;  2DVV A;  4TS8 A;  2YEK A;  4LZR A;  5I88 A;  3HME A;  4ZW1 A;  2DVS A;  4NYX A;  5C4Q A;  5ENB A;  5ENG A;  5HCL A;  4NUD A;  5EPB A;  5KTX A;  4ALG A;  5A85 A;  5FE9 A;  2D9E A;  5CTL A;  4A9L A;  4BW3 A;  5HRW A;  5G4R A;  4YH3 A;  5D3S A;  5HQ5 A;  4NRC A;  4NR6 A;  5CPE A;  4NRB A;  5LUU A;  4HXN A;  5CU8 A;  5ETD A;  4YAX A;  2NXB A;  3P5O A;  3K2J A;  4Z1S A;  4A9K A;  5FE4 A;  4YC9 A;  3SVF A;  2F6J A;  5I83 A;  5I80 A;  3QZV A;  4MR6 A;  4QSR A;  5HFR A;  5CQA A;  4HBY A;  5IGN A;  2LSP B;  3JVJ A;  5D7X A;  5DFD A;  2H60 A;  3O34 A;  5DKC A;  3SVG A;  4Z1Q A;  5CUA A;  3SVH A;  5EK9 A;  2OSS A;  2DWW A;  3LJW A;  5EWD A;  3ZYU A;  4TYL A;  2RI7 A;  4XY8 A;  3JVM A;  3I3J A;  4HXP A;  4N4F A;  5CUG A;  3UV5 A;  5HRV A;  5D3H A;  4O7C A;  5A5R A;  5EWC A;  4AKH A;  5EWV A;  4AKN A;  5KHM A;  4N4H A;  2YEM A;  5DYA A;  2R0V A;  5D3L A;  5IBN A;  4YYN A;  4CUU A;  2EJN A;  3O36 A;  4TT2 A;  4UYF B;  4NUE A;  5DFC A;  5AD3 A;  5E0R A;  3UVW A;  5FFY A;  5F60 A;  5I7X A;  1ZKR A;  5L98 A;  3GG3 A;  4A9N A;  2RFJ A;  4BW1 A;  5HFQ A;  3IU6 A;  5FH6 A;  3MUL A;  2DVR A;  3U5P A;  4NQN A;  5E3D A;  5FG6 A;  5LKZ A;  4TU6 A;  5KTW A;  4QSU A;  3MXF A;  4NQM A;  4C66 A;  3DAI A;  1WUM A;  5CQ4 A;  5LKX A;  5BT5 A;  4QEU A;  2KTB B;  4NR8 A;  5ENF A;  5FFV A;  4QR5 A;  3NXB A;  4WHW A;  4UIX A;  4MR3 A;  5CQ3 A;  4O74 A;  4UIZ A;  5ENC A;  5DFB A;  4QB3 A;  5H1V A;  3D1B A;  1F68 A;  3O35 A;  5CRM A;  4RVR A;  5F25 A;  5AD2 A;  4MEP A;  4QUT A;  5C7N A;  4CL9 A;  4CUQ A;  4UIW A;  4CUP A;  4YBT A;  3MB3 A;  4CUR A;  5FDZ A;  4QSS A;  5FE8 A;  5EPS A;  4UIT A;  5F3A A;  4MEN A;  4WHU A;  4LR6 A;  4ZC9 A;  4YBS A;  1PUO A;  5EV9 A;  5CUD A;  3DWY A;  5COI A;  3Q2F A;  4NUC A;  5DLZ A;  5KU3 A;  5LJ1 A;  2OUO A;  4J0S A;  5FE3 A;  5FH7 A;  4TZ8 A;  3AAD A;  5FG4 A;  3P1F A;  5E7D A;  2I7K A;  5EI4 A;  4BW4 A;  1EQF A;  3G0L A;  4C67 A;  5C87 A;  3TLP A;  5I89 A;  5F2P A;  5LJ0 A;  4UIY A;  4Y03 A;  2F6N A;  4LZ2 A;  3S91 A;  5F1H A;  2L5E A;  4YYJ A;  4KV1 A;  4O75 A;  4QSX A;  3U5L A;  4O70 A;  4QNS A;  5I40 A;  3UW9 A;  5EP7 A;  3P1E A;  4TQN A;  5ENE A;  4QSP A;  4IOR A;  3Q2E A;  5A5S A;  4J1P A;  5FE5 A;  4O71 A;  3UVD A;  2OO1 A;  2RNW A;  4A9M A;  3U5O A;  4YAB A;  5FE7 A;  4ALH A;  5F61 A;  5LVR A;  5ETB A;  3UVY A;  3FKM X;  2R0S A;  4BHW A;  4J3I A;  4QUU A;  3U5J A;  2RNY A;  2E7O A;  4QSQ A;  5CQT A;  3P1D A;  2L84 A;  4HXL A;  5DY7 A;  2YYN A;  3G0J A;  5EM3 A;  5A5Q A;  3VKG A;  4A9J A;  2N9G A;  5DW2 A;  3UVX A;  4QSV A;  4YAT A;  5EIS A;  5EA1 A;  4AKG A;  5A5O A;  4FLP A;  3U5K A;  5BT4 A;  1ZS5 A;  3U5M A;  5D26 A;  5L99 A;  3U5N A;  4Z93 A;  5K29 A;  4TU4 A;  4XY9 A;  5E9Y A;  2I8N A;  4PY6 A;  4KCX A;  5IG6 A;  4GPJ A;  4Q0N A;  5FE1 A;  5EPR A;  4O78 A;  5HEM A;  3VKH A;  5CRZ A;  5E9K A;  5J0D A;  5HQ7 A;  4YYI A;  4YK0 A;  4YAD A;  2L85 A;  3AQA A;  4YYK A;  2DVQ A;  4O72 A;  3IU5 A;  2YQD A;  5LKU A;  5FE6 A;  5A5N A;  3LQH A;  5EIC A;  5HRX A;  4NRA A;  4PS5 A;  4A9O A;  4YH4 A;  3RCW A;  5E9I A;  4HBW A;  5DBM A;  4E96 A;  4XUB A;  4UIV A;  3S92 A;  3HMH A;  3QZS A;  5DKD A;  2YEL A;  4NR7 A;  5FB1 A;  5D25 A;  4CUT A;  5I86 A;  4NXJ A;  4A9E A;  5CUE A;  5L96 A;  4CLB A;  4NR4 A;  3MQM A;  3LQI A; 
#chains in the Genus database with same CATH homology
 5JI8 A;  5EQ1 A;  5CP5 A;  1E6I A;  3O37 A;  5I7Y A;  3LQJ A;  4LC2 A;  4QBM A;  3JVK A;  5ENI A;  4HXO A;  4A9H A;  5HM0 A;  2RS9 B;  4NR5 A;  4QST A;  5ENJ A;  4QR3 A;  4TT4 A;  4LDF A;  4YY6 A;  5LJ2 A;  2R10 A;  4O76 A;  5CUB A;  5EVA A;  4HXS A;  1JM4 B;  4YYD A;  5E73 A;  4YY4 A;  2WP1 A;  4UYG A;  5CQ7 A;  5LVQ A;  5CS8 A;  4HBV A;  2GRC A;  2E7N A;  5I1Q A;  4MEQ A;  4N4I A;  3ONI A;  5HEL A;  2YDW A;  5D3P A;  4IR4 A;  2DAT A;  3UV2 A;  2R0Y A;  4UYH A;  5G4S A;  4WIV A;  4OGJ A;  5E3G A;  5IGL A;  5BT3 A;  5L97 A;  5DLX A;  5DYX A;  4DON A;  5C89 A;  4XYA A;  5ACY A;  3MUK A;  5IID A;  4N3W A;  4NYV A;  4A9I A;  3JVL A;  3UV4 A;  5II2 A;  3P1C A;  3D7C A;  2MJV B;  5LKT A;  4OGI A;  4HXR A;  5DYC A;  5HLS A;  5FBX A;  5F1L A;  5DKH A;  4QEW A;  4CUS A;  2RO1 A;  4QC3 A;  3HMF A;  5FG5 A;  4PKL A;  4UYE A;  5FE2 A;  5D3R A;  4MR5 A;  5D3N A;  4YYG A;  5CQ8 A;  5F36 A;  5CZG A;  4ZQL A;  4MR4 A;  2E3K A;  1JSP B;  5D3T A;  4OUF A;  4CFL A;  4HBX A;  5CY9 A;  4QY4 A;  4IOQ A;  5CQ6 A;  4BJX A;  4QYD A;  1X0J A;  4IR3 A;  4TTE A;  5EWW A;  4LZS A;  4HXM A;  5A83 A;  5KTU A;  4NYW A;  5L8U A;  2RNX A;  4IOO A;  5EGU A;  4QEV A;  5ENH A;  4O7B A;  4MEO A;  5F5Z A;  2G4A A;  5H1U A;  5CFW A;  5CGP A;  5DYU A;  5I29 A;  4Z6I A;  5HQ6 A;  2FSA A;  5H1T A;  5II1 A;  4N4G A;  5C8G A;  4NS5 A;  5A5P A;  4UYF A;  5HEN A;  5A81 A;  4IR5 A;  4F3I A;  5D3J A;  5E9L A;  2DKW A;  3LXJ A;  4UIU A;  4XUA A;  5DX4 A;  4LRG A;  5FB0 A;  5A82 A;  5TCM A;  1N72 A;  3QZT A;  5FH8 A;  4TZ2 A;  4YYM A;  4J0R A;  4PCE A;  4LYI A;  2YW5 A;  5DW1 A;  3MB4 A;  4O7A A;  5JWM A;  5TB6 A;  4CFK A;  5HJC A;  5D0C A;  5F63 A;  4QR4 A;  4YYH A;  4KV4 A;  4Q0O A;  4QZS A;  2D82 A;  5KO4 A;  4TT6 A;  5CUC A;  1WUG A;  5F62 A;  4UYD A;  4O77 A;  4YBM A;  5EWH A;  5FFW A;  4IR6 A;  4QSW A;  5E9V A;  4A9F A;  4O7F A;  4O7E A;  5FE0 A;  4BW2 A;  3O33 A;  4X2I A;  4Z6H A;  4PTB A;  5IGK A;  4QC1 A;  5A7C A;  5AME A;  5CQ5 A;  5L8T A;  4NR9 A;  5AMF A;  2WP2 A;  5EU1 A;  5IGM A;  5D24 A;  4LYW A;  4LYS A;  5C85 A;  4QYL A;  5E9M A;  4PCI A;  5H85 A;  5E74 A;  4HXK A;  2DVV A;  4TS8 A;  2YEK A;  4LZR A;  5I88 A;  3HME A;  4ZW1 A;  2DVS A;  4NYX A;  5C4Q A;  5ENB A;  5ENG A;  5HCL A;  4NUD A;  5EPB A;  5KTX A;  4ALG A;  5A85 A;  5FE9 A;  2D9E A;  5CTL A;  4A9L A;  4BW3 A;  5HRW A;  5G4R A;  4YH3 A;  5D3S A;  5HQ5 A;  4NRC A;  4NR6 A;  5CPE A;  4NRB A;  5LUU A;  4HXN A;  5CU8 A;  5ETD A;  4YAX A;  2NXB A;  3P5O A;  3K2J A;  4Z1S A;  4A9K A;  5FE4 A;  4YC9 A;  3SVF A;  2F6J A;  5I83 A;  5I80 A;  3QZV A;  4MR6 A;  4QSR A;  5HFR A;  5CQA A;  4HBY A;  5IGN A;  2LSP B;  3JVJ A;  5D7X A;  5DFD A;  2H60 A;  3O34 A;  5DKC A;  3SVG A;  4Z1Q A;  5CUA A;  3SVH A;  5EK9 A;  2OSS A;  2DWW A;  3LJW A;  5EWD A;  3ZYU A;  4TYL A;  2RI7 A;  4XY8 A;  3JVM A;  3I3J A;  4HXP A;  4N4F A;  5CUG A;  3UV5 A;  5HRV A;  5D3H A;  4O7C A;  5A5R A;  5EWC A;  5EWV A;  4AKN A;  5KHM A;  4N4H A;  2YEM A;  5DYA A;  2R0V A;  5D3L A;  5IBN A;  4YYN A;  4CUU A;  3O36 A;  4TT2 A;  4UYF B;  4NUE A;  5DFC A;  5AD3 A;  5E0R A;  3UVW A;  5FFY A;  5F60 A;  5I7X A;  5L98 A;  3GG3 A;  4A9N A;  2RFJ A;  4BW1 A;  5HFQ A;  3IU6 A;  5FH6 A;  3MUL A;  2DVR A;  3U5P A;  4NQN A;  5E3D A;  5FG6 A;  5LKZ A;  4TU6 A;  5KTW A;  4QSU A;  3MXF A;  4NQM A;  4C66 A;  3DAI A;  1WUM A;  5CQ4 A;  5LKX A;  5BT5 A;  4QEU A;  2KTB B;  4NR8 A;  5ENF A;  5FFV A;  4QR5 A;  3NXB A;  4WHW A;  4UIX A;  4MR3 A;  5CQ3 A;  4O74 A;  4UIZ A;  5ENC A;  5DFB A;  4QB3 A;  5H1V A;  1F68 A;  3O35 A;  5CRM A;  4RVR A;  5F25 A;  5AD2 A;  4MEP A;  4QUT A;  5C7N A;  4CL9 A;  4CUQ A;  4UIW A;  4CUP A;  4YBT A;  3MB3 A;  4CUR A;  5FDZ A;  4QSS A;  5FE8 A;  5EPS A;  4UIT A;  5F3A A;  4MEN A;  4WHU A;  4LR6 A;  4ZC9 A;  4YBS A;  5EV9 A;  5CUD A;  3DWY A;  5COI A;  3Q2F A;  4NUC A;  5DLZ A;  5KU3 A;  5LJ1 A;  2OUO A;  4J0S A;  5FE3 A;  5FH7 A;  4TZ8 A;  3AAD A;  5FG4 A;  3P1F A;  5E7D A;  2I7K A;  5EI4 A;  4BW4 A;  1EQF A;  3G0L A;  4C67 A;  5C87 A;  3TLP A;  5I89 A;  5F2P A;  5LJ0 A;  4UIY A;  4Y03 A;  2F6N A;  4LZ2 A;  3S91 A;  5F1H A;  2L5E A;  4YYJ A;  4KV1 A;  4O75 A;  4QSX A;  3U5L A;  4O70 A;  4QNS A;  5I40 A;  3UW9 A;  5EP7 A;  3P1E A;  4TQN A;  5ENE A;  4QSP A;  4IOR A;  3Q2E A;  5A5S A;  4J1P A;  5FE5 A;  4O71 A;  3UVD A;  2OO1 A;  2RNW A;  4A9M A;  3U5O A;  4YAB A;  5FE7 A;  4ALH A;  5F61 A;  5LVR A;  5ETB A;  3UVY A;  3FKM X;  2R0S A;  4BHW A;  4J3I A;  4QUU A;  3U5J A;  2RNY A;  2E7O A;  4QSQ A;  5CQT A;  3P1D A;  2L84 A;  4HXL A;  5DY7 A;  2YYN A;  3G0J A;  5EM3 A;  5A5Q A;  4A9J A;  2N9G A;  5DW2 A;  3UVX A;  4QSV A;  4YAT A;  5EIS A;  5EA1 A;  5A5O A;  4FLP A;  3U5K A;  5BT4 A;  1ZS5 A;  3U5M A;  5D26 A;  5L99 A;  3U5N A;  4Z93 A;  5K29 A;  4TU4 A;  4XY9 A;  5E9Y A;  2I8N A;  4PY6 A;  4KCX A;  5IG6 A;  4GPJ A;  4Q0N A;  5FE1 A;  5EPR A;  4O78 A;  5HEM A;  5CRZ A;  5E9K A;  5J0D A;  5HQ7 A;  4YYI A;  4YK0 A;  4YAD A;  2L85 A;  3AQA A;  4YYK A;  2DVQ A;  4O72 A;  3IU5 A;  2YQD A;  5LKU A;  5FE6 A;  5A5N A;  3LQH A;  5EIC A;  5HRX A;  4NRA A;  4PS5 A;  4A9O A;  4YH4 A;  3RCW A;  5E9I A;  4HBW A;  5DBM A;  4E96 A;  4XUB A;  4UIV A;  3S92 A;  3HMH A;  3QZS A;  5DKD A;  2YEL A;  4NR7 A;  5FB1 A;  5D25 A;  4CUT A;  5I86 A;  4NXJ A;  4A9E A;  5CUE A;  5L96 A;  4CLB A;  4NR4 A;  3MQM A;  3LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...