3MB3A

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
116
structure length
116
Chain Sequence
YDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PH-interacting protein
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 40
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3mb3A00
4J0RA 4IR4A 4QSUA 5AMFA 3QZTA 5HRXA 3Q2EA 4QSQA 4CURA 3HMHA 4IOQA 4ZC9A 5BT3A 4HXNA 1ZS5A 4TTEA 5CQ4A 4YADA 5BT5A 3SVHA 5KTUA 5EK9A 4UITA 5FFVA 5I1QA 5CUEA 4J3IA 5CUBA 4NR9A 5LJ2A 4QUTA 5A85A 4KV4A 5CRMA 4O76A 2OO1A 3S91A 4NUEA 4WIVA 3MUKA 5FE1A 5TB6A 4MR3A 5C87A 5CQTA 3O37A 4QYLA 4YBTA 2GRCA 5C8GA 2L5EA 4A9KA 5A5SA 5CY9A 2I7KA 3AADA 4QSXA 3SVFA 3U5JA 4MEQA 5I40A 5C7NA 5CUAA 5E9YA 4O7AA 4HXLA 4CUTA 5I86A 5I83A 4QC3A 3QZVA 4QSVA 5CS8A 5IIDA 4LYSA 4YBSA 4PS5A 4TT6A 3MQMA 4NYWA 4N3WA 4NR7A 4IR5A 5E9KA 4QNSA 5KHMA 4TT4A 5JWMA 4NRAA 4TZ2A 2YW5A 5EPRA 5E9LA 4A9EA 4QSWA 2R0YA 5IBNA 4HXPA 4Q0NA 4O7EA 3P1EA 5F1LA 4Z6HA 5FG4A 4IR3A 4HXRA 5CFWA 3ZYUA 2LSPB 5FH7A 4UYDA 4N4GA 4HXMA 1EQFA 4O71A 3P1CA 5II2A 4XY9A 5ETDA 2R0VA 5FE2A 5E74A 4XUAA 5HELA 1JSPB 5DFDA 2DVQA 3JVLA 5D24A 5LKTA 2L84A 5HEMA 4YH3A 4C66A 2DWWA 4YYHA 3JVMA 2YELA 4BW4A 5EU1A 4QEWA 4LR6A 2E3KA 4LYWA 4YY6A 2DVVA 4YYIA 2F6NA 3IU5A 2R10A 4Z1QA 4TYLA 5F62A 5FE0A 4Z93A 3P5OA 4NYVA 5HENA 5EP7A 4UIYA 4IOOA 2RNWA 4CUUA 5E0RA 5A5PA 5E9VA 2G4AA 5EISA 5CQAA 5ENBA 5FE8A 4QB3A 2OSSA 3U5LA 2DVRA 5CUDA 5F60A 5DX4A 5E9MA 4LZRA 5D7XA 4BW3A 5LJ0A 5IGNA 5CPEA 5A5NA 4CUQA 2D82A 5FFYA 4O7FA 5EWVA 4UYHA 4HBVA 2YEKA 1F68A 5FH8A 4UYGA 4A9MA 4QR3A 4N4HA 3K2JA 4O77A 5ETBA 5ENGA 4CUPA 5DKHA 5HCLA 3UVXA 5D3LA 2RNXA 3LXJA 5I29A 5KU3A 4YYGA 3G0JA 2RFJA 5L97A 5A81A 4TS8A 5CU8A 4QR5A 2RS9B 3TLPA 5I7YA 5L8TA 3P1FA 2L85A 3DAIA 5E3DA 4AKNA 4QY4A 4LDFA 5LKXA 3MB4A 5CTLA 5DFBA 5A5QA 5ENFA 5F63A 4QYDA 2YQDA 4QR4A 4NR6A 4NR5A 5KTWA 5EWCA 5D3NA 2H60A 4HXKA 4N4FA 4HBXA 5FE4A 5AD2A 5IGLA 3I3JA 5FH6A 5DY7A 4YK0A 5FBXA 5F5ZA 3U5PA 5HQ7A 4YATA 4NR4A 4QSTA 5I88A 2YDWA 5LVQA 2I8NA 3UV5A 1WUGA 4NRCA 4O70A 4ALGA 5IGMA 5ACYA 2DKWA 5E7DA 4CFKA 5A82A 3HMFA 5D3SA 1WUMA 5AMEA 4Z1SA 2OUOA 4F3IA 4TT2A 5EWDA 4HBWA 5HQ5A 5LVRA 4FLPA 4PTBA 5EQ1A 2RNYA 5EPSA 5I80A 5HRVA 4UIZA 3O36A 4XYAA 4YY4A 5DYUA 5KTXA 5CUCA 5EA1A 4ZW1A 4N4IA 4TU4A 3O35A 5L96A 5LKUA 4O78A 3UV4A 4XUBA 5K29A 5A7CA 3LQJA 4UIWA 4Z6IA 4J0SA 3S92A 3U5OA 5LJ1A 5HLSA 4UYFB 4CUSA 3IU6A 4O7CA 5D0CA 5DW2A 5EWHA 3O33A 3LJWA 3QZSA 3U5MA 1X0JA 5H85A 2D9EA 4MR5A 1E6IA 5A5OA 3DWYA 4A9HA 3MXFA 2NXBA 5DYAA 3HMEA 5F36A 5HQ6A 2F6JA 4OGIA 5A5RA 5L99A 4BHWA 5FFWA 4QZSA 5DBMA 5DKDA 3LQHA 4PCIA 4WHWA 4YYDA 5LUUA 4QSPA 3JVKA 1N72A 3MB3A 4NUDA 4O7BA 5CZGA 5DW1A 4MEOA 3LQIA 4E96A 4KCXA 4QSRA 4QUUA 1JM4B 4TZ8A 5E9IA 5EV9A 4MENA 4UIVA 3JVJA 4O74A 5CQ3A 5FB0A 4PCEA 4LYIA 4O75A 5F25A 5FE3A 4LZ2A 4A9NA 3G0LA 4CFLA 5EICA 4YH4A 5EWWA 5E73A 2N9GA 3UW9A 4UYFA 4NRBA 5D3PA 5HM0A 5KO4A 5LKZA 4X2IA 4ALHA 4A9FA 2E7OA 5CP5A 4BJXA 5COIA 5HRWA 5J0DA 2YEMA 4GPJA 4YYKA 5EPBA 5FDZA 3FKMX 5L98A 5FE6A 3Q2FA 5CQ7A 4NQMA 4O72A 4OUFA 4QEVA 5EM3A 5HFRA 5C85A 5EGUA 5DFCA 5CQ5A 5HFQA 2FSAA 4TU6A 5I89A 5JI8A 4XY8A 5ENEA 4NXJA 4YAXA 5F2PA 4TQNA 4YC9A 2E7NA 2MJVB 4UIUA 4J1PA 3UV2A 3RCWA 2DATA 3GG3A 4OGJA 4BW1A 2WP1A 2RI7A 5C4QA 4YYJA 4RVRA 5EVAA 5D25A 5D3JA 4HBYA 4A9IA 4MR4A 4CL9A 3UVWA 4MR6A 4NR8A 4A9LA 5CGPA 5II1A 5L8UA 3NXBA 5FE7A 4A9OA 4PY6A 4Y03A 2R0SA 3MULA 5D3HA 3D7CA 5TCMA 5DYCA 3O34A 5C89A 5F61A 5HJCA 3ONIA 4C67A 5I7XA 5G4SA 4A9JA 4MEPA 4NS5A 5G4RA 4PKLA 5D3TA 5F3AA 4LC2A 5CQ8A 5DLZA 5DYXA 4CLBA 3U5NA 5FG6A 4NUCA 2YYNA 4QSSA 4QEUA 3U5KA 5IG6A 5IGKA 2KTBB 4ZQLA 5H1TA 3P1DA 5DKCA 5FB1A 4DONA 4YBMA 4NYXA 3UVYA 4UIXA 5ENJA 5ENCA 5A83A 5EI4A 5FE5A 4IR6A 3SVGA 3AQAA 4QBMA 4YYNA 4LZSA 4UYEA 5D3RA 5H1VA 5CUGA 4LRGA 5AD3A 5ENIA 3UVDA 5F1HA 5FG5A 5H1UA 5BT4A 4HXSA 4IORA 5FE9A 4Q0OA 4WHUA 4HXOA 2DVSA 4YABA 5ENHA 2WP2A 4BW2A 4NQNA 5CQ6A 4KV1A 4QC1A 5CRZA 5E3GA 5D26A 4YYMA 2RO1A 5DLXA
chains in the Genus database with same CATH superfamily
4J0RA 4IR4A 4QSUA 5AMFA 3QZTA 5HRXA 3Q2EA 4QSQA 4CURA 3HMHA 4IOQA 4ZC9A 5BT3A 4HXNA 1ZS5A 4TTEA 5CQ4A 4YADA 5BT5A 3SVHA 5KTUA 5EK9A 4UITA 5FFVA 5I1QA 5CUEA 4J3IA 5CUBA 4NR9A 5LJ2A 4AKHA 4QUTA 5A85A 4KV4A 5CRMA 4O76A 2OO1A 3S91A 4NUEA 4WIVA 3MUKA 5FE1A 5TB6A 4MR3A 5C87A 5CQTA 3O37A 4QYLA 4YBTA 2GRCA 5C8GA 2L5EA 4A9KA 5A5SA 5CY9A 2I7KA 3AADA 4QSXA 3SVFA 3U5JA 4MEQA 5I40A 5C7NA 5CUAA 5E9YA 4O7AA 4HXLA 4CUTA 5I86A 5I83A 4QC3A 3QZVA 4QSVA 5CS8A 5IIDA 4LYSA 4YBSA 4PS5A 4TT6A 3MQMA 4NYWA 4N3WA 4NR7A 4IR5A 5E9KA 4QNSA 5KHMA 4TT4A 5JWMA 4NRAA 4TZ2A 2YW5A 5EPRA 5E9LA 4A9EA 4QSWA 2R0YA 5IBNA 4HXPA 4Q0NA 4O7EA 3P1EA 5F1LA 4Z6HA 5FG4A 4IR3A 4HXRA 5CFWA 3ZYUA 2LSPB 5FH7A 4UYDA 4N4GA 4HXMA 1EQFA 4O71A 3P1CA 5II2A 4XY9A 5ETDA 2R0VA 5FE2A 5E74A 4XUAA 5HELA 1JSPB 5DFDA 2DVQA 3JVLA 5D24A 5LKTA 2L84A 5HEMA 4YH3A 4C66A 2DWWA 4YYHA 3JVMA 2YELA 4BW4A 5EU1A 4QEWA 4LR6A 2E3KA 4LYWA 4YY6A 2DVVA 4YYIA 2F6NA 3IU5A 2R10A 4Z1QA 4TYLA 5F62A 5FE0A 3P5OA 4Z93A 4NYVA 5HENA 5EP7A 4UIYA 4IOOA 2RNWA 4CUUA 5E0RA 5A5PA 5E9VA 2G4AA 5EISA 5CQAA 5ENBA 5FE8A 4QB3A 2OSSA 3U5LA 2DVRA 5CUDA 5F60A 5DX4A 5E9MA 4LZRA 5D7XA 4BW3A 1PUOA 5LJ0A 5IGNA 5CPEA 5A5NA 4CUQA 2D82A 5FFYA 4O7FA 5EWVA 4UYHA 4HBVA 2YEKA 1F68A 5FH8A 4UYGA 4A9MA 4QR3A 4N4HA 3K2JA 4O77A 5ETBA 5ENGA 4CUPA 5DKHA 5HCLA 3UVXA 5D3LA 2RNXA 3LXJA 5I29A 5KU3A 4YYGA 3G0JA 2RFJA 5L97A 5A81A 4TS8A 5CU8A 4QR5A 2RS9B 3TLPA 5I7YA 5L8TA 3P1FA 2L85A 3DAIA 5E3DA 4AKNA 4QY4A 4LDFA 5LKXA 3MB4A 5CTLA 5DFBA 4AKGA 3ERRA 5A5QA 5ENFA 5F63A 4QYDA 2YQDA 4QR4A 4NR6A 4NR5A 5KTWA 5EWCA 5D3NA 2H60A 4HXKA 4N4FA 4HBXA 5FE4A 5AD2A 5IGLA 3I3JA 5FH6A 5DY7A 4YK0A 5FBXA 5F5ZA 3U5PA 5HQ7A 4YATA 4NR4A 4QSTA 5I88A 2YDWA 5LVQA 2I8NA 3UV5A 1WUGA 4NRCA 4O70A 4ALGA 5IGMA 5ACYA 2DKWA 5E7DA 4CFKA 5A82A 3HMFA 5D3SA 1WUMA 5AMEA 4Z1SA 2OUOA 4F3IA 4TT2A 5EWDA 4HBWA 5HQ5A 5LVRA 4FLPA 4PTBA 5EQ1A 2RNYA 5EPSA 5I80A 5HRVA 4UIZA 3O36A 4XYAA 4YY4A 5DYUA 5KTXA 5CUCA 5EA1A 4ZW1A 4N4IA 4TU4A 3O35A 5L96A 5LKUA 4O78A 3UV4A 4XUBA 5K29A 5A7CA 3LQJA 4UIWA 4Z6IA 4J0SA 3S92A 3U5OA 5LJ1A 5HLSA 4UYFB 4CUSA 3IU6A 4O7CA 5D0CA 5DW2A 5EWHA 3O33A 3LJWA 3QZSA 3U5MA 1X0JA 5H85A 2D9EA 4MR5A 1E6IA 5A5OA 3DWYA 4A9HA 3MXFA 2NXBA 5DYAA 3HMEA 5F36A 5HQ6A 2F6JA 4OGIA 5A5RA 5L99A 4BHWA 5FFWA 4QZSA 3D1DA 5DBMA 5DKDA 3LQHA 4PCIA 4WHWA 4YYDA 5LUUA 4QSPA 3JVKA 1N72A 3MB3A 4NUDA 4O7BA 5CZGA 5DW1A 4MEOA 3LQIA 4E96A 4AI6A 4KCXA 4QSRA 4QUUA 1JM4B 4TZ8A 5E9IA 5EV9A 4MENA 4UIVA 3JVJA 4O74A 5CQ3A 5FB0A 4PCEA 4LYIA 4O75A 5F25A 5FE3A 4LZ2A 4A9NA 3G0LA 4CFLA 5EICA 4YH4A 5EWWA 5E73A 2N9GA 3UW9A 4UYFA 4NRBA 5D3PA 5HM0A 5KO4A 5LKZA 4X2IA 4ALHA 4A9FA 2E7OA 5CP5A 4BJXA 5COIA 5HRWA 5J0DA 2YEMA 4GPJA 4YYKA 5EPBA 5FDZA 3FKMX 3VKHA 5L98A 5FE6A 3Q2FA 5CQ7A 4NQMA 4O72A 4OUFA 4QEVA 5EM3A 5HFRA 5C85A 5EGUA 5DFCA 5CQ5A 5HFQA 2FSAA 4TU6A 5I89A 5JI8A 4XY8A 5ENEA 4NXJA 4YAXA 5F2PA 3VKGA 4TQNA 4YC9A 2E7NA 2MJVB 4UIUA 4J1PA 3UV2A 3RCWA 2DATA 3GG3A 4OGJA 4BW1A 2WP1A 2RI7A 5C4QA 4YYJA 4RVRA 3D1BA 5EVAA 5D25A 5D3JA 4HBYA 4A9IA 4MR4A 4CL9A 3UVWA 4MR6A 4NR8A 4A9LA 5CGPA 5II1A 5L8UA 3NXBA 5FE7A 4A9OA 4PY6A 4Y03A 2R0SA 3MULA 5D3HA 3D7CA 5TCMA 5DYCA 4AKIA 3O34A 5C89A 5F61A 5HJCA 3ONIA 4C67A 5I7XA 5G4SA 4A9JA 4MEPA 4NS5A 5G4RA 4PKLA 5D3TA 5F3AA 4LC2A 5CQ8A 5DLZA 5DYXA 4CLBA 3U5NA 5FG6A 4NUCA 1ZKRA 2YYNA 4QSSA 4QEUA 3U5KA 5IG6A 5IGKA 2KTBB 4ZQLA 5H1TA 3P1DA 5DKCA 5FB1A 4DONA 4YBMA 4NYXA 3UVYA 4UIXA 5ENJA 5ENCA 5A83A 5EI4A 5FE5A 4IR6A 3SVGA 3AQAA 4QBMA 4YYNA 4LZSA 4UYEA 5D3RA 5H1VA 5CUGA 4LRGA 5AD3A 5ENIA 3UVDA 5F1HA 5FG5A 5H1UA 5BT4A 4HXSA 4IORA 5FE9A 4Q0OA 4WHUA 4HXOA 2DVSA 4YABA 5ENHA 2WP2A 4BW2A 4NQNA 5CQ6A 4KV1A 4QC1A 5CRZA 5E3GA 2EJNA 5D26A 4YYMA 2RO1A 5DLXA
chains in the Genus database with same CATH topology
4J0RA 4IR4A 4QSUA 5AMFA 3QZTA 5HRXA 3Q2EA 4QSQA 4CURA 3HMHA 4IOQA 4ZC9A 5BT3A 4HXNA 1ZS5A 4TTEA 5CQ4A 4YADA 5BT5A 3SVHA 5KTUA 5EK9A 4UITA 5FFVA 5I1QA 5CUEA 4J3IA 5CUBA 4NR9A 5LJ2A 4QUTA 5A85A 4KV4A 5CRMA 4O76A 2OO1A 3S91A 4NUEA 4WIVA 3MUKA 5FE1A 5TB6A 4MR3A 5C87A 5CQTA 3O37A 4QYLA 4YBTA 2GRCA 5C8GA 2L5EA 4A9KA 5A5SA 5CY9A 2I7KA 3AADA 4QSXA 3SVFA 3U5JA 4MEQA 5I40A 5C7NA 5CUAA 5E9YA 4O7AA 4HXLA 4CUTA 5I86A 5I83A 4QC3A 3QZVA 4QSVA 5CS8A 5IIDA 4LYSA 4YBSA 4PS5A 4TT6A 3MQMA 4NYWA 4N3WA 4NR7A 4IR5A 5E9KA 4QNSA 5KHMA 4TT4A 5JWMA 4NRAA 4TZ2A 2YW5A 5EPRA 5E9LA 4A9EA 4QSWA 2R0YA 5IBNA 4HXPA 4Q0NA 4O7EA 3P1EA 5F1LA 4Z6HA 5FG4A 4IR3A 4HXRA 5CFWA 3ZYUA 2LSPB 5FH7A 4UYDA 4N4GA 4HXMA 1EQFA 4O71A 3P1CA 5II2A 4XY9A 5ETDA 2R0VA 5FE2A 5E74A 4XUAA 5HELA 1JSPB 5DFDA 2DVQA 3JVLA 5D24A 5LKTA 2L84A 5HEMA 4YH3A 4C66A 2DWWA 4YYHA 3JVMA 2YELA 4BW4A 5EU1A 4QEWA 4LR6A 2E3KA 4LYWA 4YY6A 2DVVA 4YYIA 2F6NA 3IU5A 2R10A 4Z1QA 4TYLA 5F62A 5FE0A 4Z93A 3P5OA 4NYVA 5HENA 5EP7A 4UIYA 4IOOA 2RNWA 4CUUA 5E0RA 5A5PA 5E9VA 2G4AA 5EISA 5CQAA 5ENBA 5FE8A 4QB3A 2OSSA 3U5LA 2DVRA 5CUDA 5F60A 5DX4A 5E9MA 4LZRA 5D7XA 4BW3A 5LJ0A 5IGNA 5CPEA 5A5NA 4CUQA 2D82A 5FFYA 4O7FA 5EWVA 4UYHA 4HBVA 2YEKA 1F68A 5FH8A 4UYGA 4A9MA 4QR3A 4N4HA 3K2JA 4O77A 5ETBA 5ENGA 4CUPA 5DKHA 5HCLA 3UVXA 5D3LA 2RNXA 3LXJA 5I29A 5KU3A 4YYGA 3G0JA 2RFJA 5L97A 5A81A 4TS8A 5CU8A 4QR5A 2RS9B 3TLPA 5I7YA 5L8TA 3P1FA 2L85A 3DAIA 5E3DA 4AKNA 4QY4A 4LDFA 5LKXA 3MB4A 5CTLA 5DFBA 5A5QA 5ENFA 5F63A 4QYDA 2YQDA 4QR4A 4NR6A 4NR5A 5KTWA 5EWCA 5D3NA 2H60A 4HXKA 4N4FA 4HBXA 5FE4A 5AD2A 5IGLA 3I3JA 5FH6A 5DY7A 4YK0A 5FBXA 5F5ZA 3U5PA 5HQ7A 4YATA 4NR4A 4QSTA 5I88A 2YDWA 5LVQA 2I8NA 3UV5A 1WUGA 4NRCA 4O70A 4ALGA 5IGMA 5ACYA 2DKWA 5E7DA 4CFKA 5A82A 3HMFA 5D3SA 1WUMA 5AMEA 4Z1SA 2OUOA 4F3IA 4TT2A 5EWDA 4HBWA 5HQ5A 5LVRA 4FLPA 4PTBA 5EQ1A 2RNYA 5EPSA 5I80A 5HRVA 4UIZA 3O36A 4XYAA 4YY4A 5DYUA 5KTXA 5CUCA 5EA1A 4ZW1A 4N4IA 4TU4A 3O35A 5L96A 5LKUA 4O78A 3UV4A 4XUBA 5K29A 5A7CA 3LQJA 4UIWA 4Z6IA 4J0SA 3S92A 3U5OA 5LJ1A 5HLSA 4UYFB 4CUSA 3IU6A 4O7CA 5D0CA 5DW2A 5EWHA 3O33A 3LJWA 3QZSA 3U5MA 1X0JA 5H85A 2D9EA 4MR5A 1E6IA 5A5OA 3DWYA 4A9HA 3MXFA 2NXBA 5DYAA 3HMEA 5F36A 5HQ6A 2F6JA 4OGIA 5A5RA 5L99A 4BHWA 5FFWA 4QZSA 5DBMA 5DKDA 3LQHA 4PCIA 4WHWA 4YYDA 5LUUA 4QSPA 3JVKA 1N72A 3MB3A 4NUDA 4O7BA 5CZGA 5DW1A 4MEOA 3LQIA 4E96A 4KCXA 4QSRA 4QUUA 1JM4B 4TZ8A 5E9IA 5EV9A 4MENA 4UIVA 3JVJA 4O74A 5CQ3A 5FB0A 4PCEA 4LYIA 4O75A 5F25A 5FE3A 4LZ2A 4A9NA 3G0LA 4CFLA 5EICA 4YH4A 5EWWA 5E73A 2N9GA 3UW9A 4UYFA 4NRBA 5D3PA 5HM0A 5KO4A 5LKZA 4X2IA 4ALHA 4A9FA 2E7OA 5CP5A 4BJXA 5COIA 5HRWA 5J0DA 2YEMA 4GPJA 4YYKA 5EPBA 5FDZA 3FKMX 5L98A 5FE6A 3Q2FA 5CQ7A 4NQMA 4O72A 4OUFA 4QEVA 5EM3A 5HFRA 5C85A 5EGUA 5DFCA 5CQ5A 5HFQA 2FSAA 4TU6A 5I89A 5JI8A 4XY8A 5ENEA 4NXJA 4YAXA 5F2PA 4TQNA 4YC9A 2E7NA 2MJVB 4UIUA 4J1PA 3UV2A 3RCWA 2DATA 3GG3A 4OGJA 4BW1A 2WP1A 2RI7A 5C4QA 4YYJA 4RVRA 5EVAA 5D25A 5D3JA 4HBYA 4A9IA 4MR4A 4CL9A 3UVWA 4MR6A 4NR8A 4A9LA 5CGPA 5II1A 5L8UA 3NXBA 5FE7A 4A9OA 4PY6A 4Y03A 2R0SA 3MULA 5D3HA 3D7CA 5TCMA 5DYCA 3O34A 5C89A 5F61A 5HJCA 3ONIA 4C67A 5I7XA 5G4SA 4A9JA 4MEPA 4NS5A 5G4RA 4PKLA 5D3TA 5F3AA 4LC2A 5CQ8A 5DLZA 5DYXA 4CLBA 3U5NA 5FG6A 4NUCA 2YYNA 4QSSA 4QEUA 3U5KA 5IG6A 5IGKA 2KTBB 4ZQLA 5H1TA 3P1DA 5DKCA 5FB1A 4DONA 4YBMA 4NYXA 3UVYA 4UIXA 5ENJA 5ENCA 5A83A 5EI4A 5FE5A 4IR6A 3SVGA 3AQAA 4QBMA 4YYNA 4LZSA 4UYEA 5D3RA 5H1VA 5CUGA 4LRGA 5AD3A 5ENIA 3UVDA 5F1HA 5FG5A 5H1UA 5BT4A 4HXSA 4IORA 5FE9A 4Q0OA 4WHUA 4HXOA 2DVSA 4YABA 5ENHA 2WP2A 4BW2A 4NQNA 5CQ6A 4KV1A 4QC1A 5CRZA 5E3GA 5D26A 4YYMA 2RO1A 5DLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0R A;  4IR4 A;  4QSU A;  5AMF A;  3QZT A;  5HRX A;  3Q2E A;  4QSQ A;  4CUR A;  3HMH A;  4IOQ A;  4ZC9 A;  5BT3 A;  4HXN A;  1ZS5 A;  4TTE A;  5CQ4 A;  4YAD A;  5BT5 A;  3SVH A;  5KTU A;  5EK9 A;  4UIT A;  5FFV A;  5I1Q A;  5CUE A;  4J3I A;  5CUB A;  4NR9 A;  5LJ2 A;  4QUT A;  5A85 A;  4KV4 A;  5CRM A;  4O76 A;  2OO1 A;  3S91 A;  4NUE A;  4WIV A;  3MUK A;  5FE1 A;  5TB6 A;  4MR3 A;  5C87 A;  5CQT A;  3O37 A;  4QYL A;  4YBT A;  2GRC A;  5C8G A;  2L5E A;  4A9K A;  5A5S A;  5CY9 A;  2I7K A;  3AAD A;  4QSX A;  3SVF A;  3U5J A;  4MEQ A;  5I40 A;  5C7N A;  5CUA A;  5E9Y A;  4O7A A;  4HXL A;  4CUT A;  5I86 A;  5I83 A;  4QC3 A;  3QZV A;  4QSV A;  5CS8 A;  5IID A;  4LYS A;  4YBS A;  4PS5 A;  4TT6 A;  3MQM A;  4NYW A;  4N3W A;  4NR7 A;  4IR5 A;  5E9K A;  4QNS A;  5KHM A;  4TT4 A;  5JWM A;  4NRA A;  4TZ2 A;  2YW5 A;  5EPR A;  5E9L A;  4A9E A;  4QSW A;  2R0Y A;  5IBN A;  4HXP A;  4Q0N A;  4O7E A;  3P1E A;  5F1L A;  4Z6H A;  5FG4 A;  4IR3 A;  4HXR A;  5CFW A;  3ZYU A;  2LSP B;  5FH7 A;  4UYD A;  4N4G A;  4HXM A;  1EQF A;  4O71 A;  3P1C A;  5II2 A;  4XY9 A;  5ETD A;  2R0V A;  5FE2 A;  5E74 A;  4XUA A;  5HEL A;  1JSP B;  5DFD A;  2DVQ A;  3JVL A;  5D24 A;  5LKT A;  2L84 A;  5HEM A;  4YH3 A;  4C66 A;  2DWW A;  4YYH A;  3JVM A;  2YEL A;  4BW4 A;  5EU1 A;  4QEW A;  4LR6 A;  2E3K A;  4LYW A;  4YY6 A;  2DVV A;  4YYI A;  2F6N A;  3IU5 A;  2R10 A;  4Z1Q A;  4TYL A;  5F62 A;  5FE0 A;  4Z93 A;  3P5O A;  4NYV A;  5HEN A;  5EP7 A;  4UIY A;  4IOO A;  2RNW A;  4CUU A;  5E0R A;  5A5P A;  5E9V A;  2G4A A;  5EIS A;  5CQA A;  5ENB A;  5FE8 A;  4QB3 A;  2OSS A;  3U5L A;  2DVR A;  5CUD A;  5F60 A;  5DX4 A;  5E9M A;  4LZR A;  5D7X A;  4BW3 A;  5LJ0 A;  5IGN A;  5CPE A;  5A5N A;  4CUQ A;  2D82 A;  5FFY A;  4O7F A;  5EWV A;  4UYH A;  4HBV A;  2YEK A;  1F68 A;  5FH8 A;  4UYG A;  4A9M A;  4QR3 A;  4N4H A;  3K2J A;  4O77 A;  5ETB A;  5ENG A;  4CUP A;  5DKH A;  5HCL A;  3UVX A;  5D3L A;  2RNX A;  3LXJ A;  5I29 A;  5KU3 A;  4YYG A;  3G0J A;  2RFJ A;  5L97 A;  5A81 A;  4TS8 A;  5CU8 A;  4QR5 A;  2RS9 B;  3TLP A;  5I7Y A;  5L8T A;  3P1F A;  2L85 A;  3DAI A;  5E3D A;  4AKN A;  4QY4 A;  4LDF A;  5LKX A;  3MB4 A;  5CTL A;  5DFB A;  5A5Q A;  5ENF A;  5F63 A;  4QYD A;  2YQD A;  4QR4 A;  4NR6 A;  4NR5 A;  5KTW A;  5EWC A;  5D3N A;  2H60 A;  4HXK A;  4N4F A;  4HBX A;  5FE4 A;  5AD2 A;  5IGL A;  3I3J A;  5FH6 A;  5DY7 A;  4YK0 A;  5FBX A;  5F5Z A;  3U5P A;  5HQ7 A;  4YAT A;  4NR4 A;  4QST A;  5I88 A;  2YDW A;  5LVQ A;  2I8N A;  3UV5 A;  1WUG A;  4NRC A;  4O70 A;  4ALG A;  5IGM A;  5ACY A;  2DKW A;  5E7D A;  4CFK A;  5A82 A;  3HMF A;  5D3S A;  1WUM A;  5AME A;  4Z1S A;  2OUO A;  4F3I A;  4TT2 A;  5EWD A;  4HBW A;  5HQ5 A;  5LVR A;  4FLP A;  4PTB A;  5EQ1 A;  2RNY A;  5EPS A;  5I80 A;  5HRV A;  4UIZ A;  3O36 A;  4XYA A;  4YY4 A;  5DYU A;  5KTX A;  5CUC A;  5EA1 A;  4ZW1 A;  4N4I A;  4TU4 A;  3O35 A;  5L96 A;  5LKU A;  4O78 A;  3UV4 A;  4XUB A;  5K29 A;  5A7C A;  3LQJ A;  4UIW A;  4Z6I A;  4J0S A;  3S92 A;  3U5O A;  5LJ1 A;  5HLS A;  4UYF B;  4CUS A;  3IU6 A;  4O7C A;  5D0C A;  5DW2 A;  5EWH A;  3O33 A;  3LJW A;  3QZS A;  3U5M A;  1X0J A;  5H85 A;  2D9E A;  4MR5 A;  1E6I A;  5A5O A;  3DWY A;  4A9H A;  3MXF A;  2NXB A;  5DYA A;  3HME A;  5F36 A;  5HQ6 A;  2F6J A;  4OGI A;  5A5R A;  5L99 A;  4BHW A;  5FFW A;  4QZS A;  5DBM A;  5DKD A;  3LQH A;  4PCI A;  4WHW A;  4YYD A;  5LUU A;  4QSP A;  3JVK A;  1N72 A;  3MB3 A;  4NUD A;  4O7B A;  5CZG A;  5DW1 A;  4MEO A;  3LQI A;  4E96 A;  4KCX A;  4QSR A;  4QUU A;  1JM4 B;  4TZ8 A;  5E9I A;  5EV9 A;  4MEN A;  4UIV A;  3JVJ A;  4O74 A;  5CQ3 A;  5FB0 A;  4PCE A;  4LYI A;  4O75 A;  5F25 A;  5FE3 A;  4LZ2 A;  4A9N A;  3G0L A;  4CFL A;  5EIC A;  4YH4 A;  5EWW A;  5E73 A;  2N9G A;  3UW9 A;  4UYF A;  4NRB A;  5D3P A;  5HM0 A;  5KO4 A;  5LKZ A;  4X2I A;  4ALH A;  4A9F A;  2E7O A;  5CP5 A;  4BJX A;  5COI A;  5HRW A;  5J0D A;  2YEM A;  4GPJ A;  4YYK A;  5EPB A;  5FDZ A;  3FKM X;  5L98 A;  5FE6 A;  3Q2F A;  5CQ7 A;  4NQM A;  4O72 A;  4OUF A;  4QEV A;  5EM3 A;  5HFR A;  5C85 A;  5EGU A;  5DFC A;  5CQ5 A;  5HFQ A;  2FSA A;  4TU6 A;  5I89 A;  5JI8 A;  4XY8 A;  5ENE A;  4NXJ A;  4YAX A;  5F2P A;  4TQN A;  4YC9 A;  2E7N A;  2MJV B;  4UIU A;  4J1P A;  3UV2 A;  3RCW A;  2DAT A;  3GG3 A;  4OGJ A;  4BW1 A;  2WP1 A;  2RI7 A;  5C4Q A;  4YYJ A;  4RVR A;  5EVA A;  5D25 A;  5D3J A;  4HBY A;  4A9I A;  4MR4 A;  4CL9 A;  3UVW A;  4MR6 A;  4NR8 A;  4A9L A;  5CGP A;  5II1 A;  5L8U A;  3NXB A;  5FE7 A;  4A9O A;  4PY6 A;  4Y03 A;  2R0S A;  3MUL A;  5D3H A;  3D7C A;  5TCM A;  5DYC A;  3O34 A;  5C89 A;  5F61 A;  5HJC A;  3ONI A;  4C67 A;  5I7X A;  5G4S A;  4A9J A;  4MEP A;  4NS5 A;  5G4R A;  4PKL A;  5D3T A;  5F3A A;  4LC2 A;  5CQ8 A;  5DLZ A;  5DYX A;  4CLB A;  3U5N A;  5FG6 A;  4NUC A;  2YYN A;  4QSS A;  4QEU A;  3U5K A;  5IG6 A;  5IGK A;  2KTB B;  4ZQL A;  5H1T A;  3P1D A;  5DKC A;  5FB1 A;  4DON A;  4YBM A;  4NYX A;  3UVY A;  4UIX A;  5ENJ A;  5ENC A;  5A83 A;  5EI4 A;  5FE5 A;  4IR6 A;  3SVG A;  3AQA A;  4QBM A;  4YYN A;  4LZS A;  4UYE A;  5D3R A;  5H1V A;  5CUG A;  4LRG A;  5AD3 A;  5ENI A;  3UVD A;  5F1H A;  5FG5 A;  5H1U A;  5BT4 A;  4HXS A;  4IOR A;  5FE9 A;  4Q0O A;  4WHU A;  4HXO A;  2DVS A;  4YAB A;  5ENH A;  2WP2 A;  4BW2 A;  4NQN A;  5CQ6 A;  4KV1 A;  4QC1 A;  5CRZ A;  5E3G A;  5D26 A;  4YYM A;  2RO1 A;  5DLX A; 
#chains in the Genus database with same CATH topology
 4J0R A;  4IR4 A;  4QSU A;  5AMF A;  3QZT A;  5HRX A;  3Q2E A;  4QSQ A;  4CUR A;  3HMH A;  4IOQ A;  4ZC9 A;  5BT3 A;  4HXN A;  1ZS5 A;  4TTE A;  5CQ4 A;  4YAD A;  5BT5 A;  3SVH A;  5KTU A;  5EK9 A;  4UIT A;  5FFV A;  5I1Q A;  5CUE A;  4J3I A;  5CUB A;  4NR9 A;  5LJ2 A;  4AKH A;  4QUT A;  5A85 A;  4KV4 A;  5CRM A;  4O76 A;  2OO1 A;  3S91 A;  4NUE A;  4WIV A;  3MUK A;  5FE1 A;  5TB6 A;  4MR3 A;  5C87 A;  5CQT A;  3O37 A;  4QYL A;  4YBT A;  2GRC A;  5C8G A;  2L5E A;  4A9K A;  5A5S A;  5CY9 A;  2I7K A;  3AAD A;  4QSX A;  3SVF A;  3U5J A;  4MEQ A;  5I40 A;  5C7N A;  5CUA A;  5E9Y A;  4O7A A;  4HXL A;  4CUT A;  5I86 A;  5I83 A;  4QC3 A;  3QZV A;  4QSV A;  5CS8 A;  5IID A;  4LYS A;  4YBS A;  4PS5 A;  4TT6 A;  3MQM A;  4NYW A;  4N3W A;  4NR7 A;  4IR5 A;  5E9K A;  4QNS A;  5KHM A;  4TT4 A;  5JWM A;  4NRA A;  4TZ2 A;  2YW5 A;  5EPR A;  5E9L A;  4A9E A;  4QSW A;  2R0Y A;  5IBN A;  4HXP A;  4Q0N A;  4O7E A;  3P1E A;  5F1L A;  4Z6H A;  5FG4 A;  4IR3 A;  4HXR A;  5CFW A;  3ZYU A;  2LSP B;  5FH7 A;  4UYD A;  4N4G A;  4HXM A;  1EQF A;  4O71 A;  3P1C A;  5II2 A;  4XY9 A;  5ETD A;  2R0V A;  5FE2 A;  5E74 A;  4XUA A;  5HEL A;  1JSP B;  5DFD A;  2DVQ A;  3JVL A;  5D24 A;  5LKT A;  2L84 A;  5HEM A;  4YH3 A;  4C66 A;  2DWW A;  4YYH A;  3JVM A;  2YEL A;  4BW4 A;  5EU1 A;  4QEW A;  4LR6 A;  2E3K A;  4LYW A;  4YY6 A;  2DVV A;  4YYI A;  2F6N A;  3IU5 A;  2R10 A;  4Z1Q A;  4TYL A;  5F62 A;  5FE0 A;  3P5O A;  4Z93 A;  4NYV A;  5HEN A;  5EP7 A;  4UIY A;  4IOO A;  2RNW A;  4CUU A;  5E0R A;  5A5P A;  5E9V A;  2G4A A;  5EIS A;  5CQA A;  5ENB A;  5FE8 A;  4QB3 A;  2OSS A;  3U5L A;  2DVR A;  5CUD A;  5F60 A;  5DX4 A;  5E9M A;  4LZR A;  5D7X A;  4BW3 A;  1PUO A;  5LJ0 A;  5IGN A;  5CPE A;  5A5N A;  4CUQ A;  2D82 A;  5FFY A;  4O7F A;  5EWV A;  4UYH A;  4HBV A;  2YEK A;  1F68 A;  5FH8 A;  4UYG A;  4A9M A;  4QR3 A;  4N4H A;  3K2J A;  4O77 A;  5ETB A;  5ENG A;  4CUP A;  5DKH A;  5HCL A;  3UVX A;  5D3L A;  2RNX A;  3LXJ A;  5I29 A;  5KU3 A;  4YYG A;  3G0J A;  2RFJ A;  5L97 A;  5A81 A;  4TS8 A;  5CU8 A;  4QR5 A;  2RS9 B;  3TLP A;  5I7Y A;  5L8T A;  3P1F A;  2L85 A;  3DAI A;  5E3D A;  4AKN A;  4QY4 A;  4LDF A;  5LKX A;  3MB4 A;  5CTL A;  5DFB A;  4AKG A;  3ERR A;  5A5Q A;  5ENF A;  5F63 A;  4QYD A;  2YQD A;  4QR4 A;  4NR6 A;  4NR5 A;  5KTW A;  5EWC A;  5D3N A;  2H60 A;  4HXK A;  4N4F A;  4HBX A;  5FE4 A;  5AD2 A;  5IGL A;  3I3J A;  5FH6 A;  5DY7 A;  4YK0 A;  5FBX A;  5F5Z A;  3U5P A;  5HQ7 A;  4YAT A;  4NR4 A;  4QST A;  5I88 A;  2YDW A;  5LVQ A;  2I8N A;  3UV5 A;  1WUG A;  4NRC A;  4O70 A;  4ALG A;  5IGM A;  5ACY A;  2DKW A;  5E7D A;  4CFK A;  5A82 A;  3HMF A;  5D3S A;  1WUM A;  5AME A;  4Z1S A;  2OUO A;  4F3I A;  4TT2 A;  5EWD A;  4HBW A;  5HQ5 A;  5LVR A;  4FLP A;  4PTB A;  5EQ1 A;  2RNY A;  5EPS A;  5I80 A;  5HRV A;  4UIZ A;  3O36 A;  4XYA A;  4YY4 A;  5DYU A;  5KTX A;  5CUC A;  5EA1 A;  4ZW1 A;  4N4I A;  4TU4 A;  3O35 A;  5L96 A;  5LKU A;  4O78 A;  3UV4 A;  4XUB A;  5K29 A;  5A7C A;  3LQJ A;  4UIW A;  4Z6I A;  4J0S A;  3S92 A;  3U5O A;  5LJ1 A;  5HLS A;  4UYF B;  4CUS A;  3IU6 A;  4O7C A;  5D0C A;  5DW2 A;  5EWH A;  3O33 A;  3LJW A;  3QZS A;  3U5M A;  1X0J A;  5H85 A;  2D9E A;  4MR5 A;  1E6I A;  5A5O A;  3DWY A;  4A9H A;  3MXF A;  2NXB A;  5DYA A;  3HME A;  5F36 A;  5HQ6 A;  2F6J A;  4OGI A;  5A5R A;  5L99 A;  4BHW A;  5FFW A;  4QZS A;  3D1D A;  5DBM A;  5DKD A;  3LQH A;  4PCI A;  4WHW A;  4YYD A;  5LUU A;  4QSP A;  3JVK A;  1N72 A;  3MB3 A;  4NUD A;  4O7B A;  5CZG A;  5DW1 A;  4MEO A;  3LQI A;  4E96 A;  4AI6 A;  4KCX A;  4QSR A;  4QUU A;  1JM4 B;  4TZ8 A;  5E9I A;  5EV9 A;  4MEN A;  4UIV A;  3JVJ A;  4O74 A;  5CQ3 A;  5FB0 A;  4PCE A;  4LYI A;  4O75 A;  5F25 A;  5FE3 A;  4LZ2 A;  4A9N A;  3G0L A;  4CFL A;  5EIC A;  4YH4 A;  5EWW A;  5E73 A;  2N9G A;  3UW9 A;  4UYF A;  4NRB A;  5D3P A;  5HM0 A;  5KO4 A;  5LKZ A;  4X2I A;  4ALH A;  4A9F A;  2E7O A;  5CP5 A;  4BJX A;  5COI A;  5HRW A;  5J0D A;  2YEM A;  4GPJ A;  4YYK A;  5EPB A;  5FDZ A;  3FKM X;  3VKH A;  5L98 A;  5FE6 A;  3Q2F A;  5CQ7 A;  4NQM A;  4O72 A;  4OUF A;  4QEV A;  5EM3 A;  5HFR A;  5C85 A;  5EGU A;  5DFC A;  5CQ5 A;  5HFQ A;  2FSA A;  4TU6 A;  5I89 A;  5JI8 A;  4XY8 A;  5ENE A;  4NXJ A;  4YAX A;  5F2P A;  3VKG A;  4TQN A;  4YC9 A;  2E7N A;  2MJV B;  4UIU A;  4J1P A;  3UV2 A;  3RCW A;  2DAT A;  3GG3 A;  4OGJ A;  4BW1 A;  2WP1 A;  2RI7 A;  5C4Q A;  4YYJ A;  4RVR A;  3D1B A;  5EVA A;  5D25 A;  5D3J A;  4HBY A;  4A9I A;  4MR4 A;  4CL9 A;  3UVW A;  4MR6 A;  4NR8 A;  4A9L A;  5CGP A;  5II1 A;  5L8U A;  3NXB A;  5FE7 A;  4A9O A;  4PY6 A;  4Y03 A;  2R0S A;  3MUL A;  5D3H A;  3D7C A;  5TCM A;  5DYC A;  4AKI A;  3O34 A;  5C89 A;  5F61 A;  5HJC A;  3ONI A;  4C67 A;  5I7X A;  5G4S A;  4A9J A;  4MEP A;  4NS5 A;  5G4R A;  4PKL A;  5D3T A;  5F3A A;  4LC2 A;  5CQ8 A;  5DLZ A;  5DYX A;  4CLB A;  3U5N A;  5FG6 A;  4NUC A;  1ZKR A;  2YYN A;  4QSS A;  4QEU A;  3U5K A;  5IG6 A;  5IGK A;  2KTB B;  4ZQL A;  5H1T A;  3P1D A;  5DKC A;  5FB1 A;  4DON A;  4YBM A;  4NYX A;  3UVY A;  4UIX A;  5ENJ A;  5ENC A;  5A83 A;  5EI4 A;  5FE5 A;  4IR6 A;  3SVG A;  3AQA A;  4QBM A;  4YYN A;  4LZS A;  4UYE A;  5D3R A;  5H1V A;  5CUG A;  4LRG A;  5AD3 A;  5ENI A;  3UVD A;  5F1H A;  5FG5 A;  5H1U A;  5BT4 A;  4HXS A;  4IOR A;  5FE9 A;  4Q0O A;  4WHU A;  4HXO A;  2DVS A;  4YAB A;  5ENH A;  2WP2 A;  4BW2 A;  4NQN A;  5CQ6 A;  4KV1 A;  4QC1 A;  5CRZ A;  5E3G A;  2EJN A;  5D26 A;  4YYM A;  2RO1 A;  5DLX A; 
#chains in the Genus database with same CATH homology
 4J0R A;  4IR4 A;  4QSU A;  5AMF A;  3QZT A;  5HRX A;  3Q2E A;  4QSQ A;  4CUR A;  3HMH A;  4IOQ A;  4ZC9 A;  5BT3 A;  4HXN A;  1ZS5 A;  4TTE A;  5CQ4 A;  4YAD A;  5BT5 A;  3SVH A;  5KTU A;  5EK9 A;  4UIT A;  5FFV A;  5I1Q A;  5CUE A;  4J3I A;  5CUB A;  4NR9 A;  5LJ2 A;  4QUT A;  5A85 A;  4KV4 A;  5CRM A;  4O76 A;  2OO1 A;  3S91 A;  4NUE A;  4WIV A;  3MUK A;  5FE1 A;  5TB6 A;  4MR3 A;  5C87 A;  5CQT A;  3O37 A;  4QYL A;  4YBT A;  2GRC A;  5C8G A;  2L5E A;  4A9K A;  5A5S A;  5CY9 A;  2I7K A;  3AAD A;  4QSX A;  3SVF A;  3U5J A;  4MEQ A;  5I40 A;  5C7N A;  5CUA A;  5E9Y A;  4O7A A;  4HXL A;  4CUT A;  5I86 A;  5I83 A;  4QC3 A;  3QZV A;  4QSV A;  5CS8 A;  5IID A;  4LYS A;  4YBS A;  4PS5 A;  4TT6 A;  3MQM A;  4NYW A;  4N3W A;  4NR7 A;  4IR5 A;  5E9K A;  4QNS A;  5KHM A;  4TT4 A;  5JWM A;  4NRA A;  4TZ2 A;  2YW5 A;  5EPR A;  5E9L A;  4A9E A;  4QSW A;  2R0Y A;  5IBN A;  4HXP A;  4Q0N A;  4O7E A;  3P1E A;  5F1L A;  4Z6H A;  5FG4 A;  4IR3 A;  4HXR A;  5CFW A;  3ZYU A;  2LSP B;  5FH7 A;  4UYD A;  4N4G A;  4HXM A;  1EQF A;  4O71 A;  3P1C A;  5II2 A;  4XY9 A;  5ETD A;  2R0V A;  5FE2 A;  5E74 A;  4XUA A;  5HEL A;  1JSP B;  5DFD A;  2DVQ A;  3JVL A;  5D24 A;  5LKT A;  2L84 A;  5HEM A;  4YH3 A;  4C66 A;  2DWW A;  4YYH A;  3JVM A;  2YEL A;  4BW4 A;  5EU1 A;  4QEW A;  4LR6 A;  2E3K A;  4LYW A;  4YY6 A;  2DVV A;  4YYI A;  2F6N A;  3IU5 A;  2R10 A;  4Z1Q A;  4TYL A;  5F62 A;  5FE0 A;  4Z93 A;  3P5O A;  4NYV A;  5HEN A;  5EP7 A;  4UIY A;  4IOO A;  2RNW A;  4CUU A;  5E0R A;  5A5P A;  5E9V A;  2G4A A;  5EIS A;  5CQA A;  5ENB A;  5FE8 A;  4QB3 A;  2OSS A;  3U5L A;  2DVR A;  5CUD A;  5F60 A;  5DX4 A;  5E9M A;  4LZR A;  5D7X A;  4BW3 A;  5LJ0 A;  5IGN A;  5CPE A;  5A5N A;  4CUQ A;  2D82 A;  5FFY A;  4O7F A;  5EWV A;  4UYH A;  4HBV A;  2YEK A;  1F68 A;  5FH8 A;  4UYG A;  4A9M A;  4QR3 A;  4N4H A;  3K2J A;  4O77 A;  5ETB A;  5ENG A;  4CUP A;  5DKH A;  5HCL A;  3UVX A;  5D3L A;  2RNX A;  3LXJ A;  5I29 A;  5KU3 A;  4YYG A;  3G0J A;  2RFJ A;  5L97 A;  5A81 A;  4TS8 A;  5CU8 A;  4QR5 A;  2RS9 B;  3TLP A;  5I7Y A;  5L8T A;  3P1F A;  2L85 A;  3DAI A;  5E3D A;  4AKN A;  4QY4 A;  4LDF A;  5LKX A;  3MB4 A;  5CTL A;  5DFB A;  5A5Q A;  5ENF A;  5F63 A;  4QYD A;  2YQD A;  4QR4 A;  4NR6 A;  4NR5 A;  5KTW A;  5EWC A;  5D3N A;  2H60 A;  4HXK A;  4N4F A;  4HBX A;  5FE4 A;  5AD2 A;  5IGL A;  3I3J A;  5FH6 A;  5DY7 A;  4YK0 A;  5FBX A;  5F5Z A;  3U5P A;  5HQ7 A;  4YAT A;  4NR4 A;  4QST A;  5I88 A;  2YDW A;  5LVQ A;  2I8N A;  3UV5 A;  1WUG A;  4NRC A;  4O70 A;  4ALG A;  5IGM A;  5ACY A;  2DKW A;  5E7D A;  4CFK A;  5A82 A;  3HMF A;  5D3S A;  1WUM A;  5AME A;  4Z1S A;  2OUO A;  4F3I A;  4TT2 A;  5EWD A;  4HBW A;  5HQ5 A;  5LVR A;  4FLP A;  4PTB A;  5EQ1 A;  2RNY A;  5EPS A;  5I80 A;  5HRV A;  4UIZ A;  3O36 A;  4XYA A;  4YY4 A;  5DYU A;  5KTX A;  5CUC A;  5EA1 A;  4ZW1 A;  4N4I A;  4TU4 A;  3O35 A;  5L96 A;  5LKU A;  4O78 A;  3UV4 A;  4XUB A;  5K29 A;  5A7C A;  3LQJ A;  4UIW A;  4Z6I A;  4J0S A;  3S92 A;  3U5O A;  5LJ1 A;  5HLS A;  4UYF B;  4CUS A;  3IU6 A;  4O7C A;  5D0C A;  5DW2 A;  5EWH A;  3O33 A;  3LJW A;  3QZS A;  3U5M A;  1X0J A;  5H85 A;  2D9E A;  4MR5 A;  1E6I A;  5A5O A;  3DWY A;  4A9H A;  3MXF A;  2NXB A;  5DYA A;  3HME A;  5F36 A;  5HQ6 A;  2F6J A;  4OGI A;  5A5R A;  5L99 A;  4BHW A;  5FFW A;  4QZS A;  5DBM A;  5DKD A;  3LQH A;  4PCI A;  4WHW A;  4YYD A;  5LUU A;  4QSP A;  3JVK A;  1N72 A;  3MB3 A;  4NUD A;  4O7B A;  5CZG A;  5DW1 A;  4MEO A;  3LQI A;  4E96 A;  4KCX A;  4QSR A;  4QUU A;  1JM4 B;  4TZ8 A;  5E9I A;  5EV9 A;  4MEN A;  4UIV A;  3JVJ A;  4O74 A;  5CQ3 A;  5FB0 A;  4PCE A;  4LYI A;  4O75 A;  5F25 A;  5FE3 A;  4LZ2 A;  4A9N A;  3G0L A;  4CFL A;  5EIC A;  4YH4 A;  5EWW A;  5E73 A;  2N9G A;  3UW9 A;  4UYF A;  4NRB A;  5D3P A;  5HM0 A;  5KO4 A;  5LKZ A;  4X2I A;  4ALH A;  4A9F A;  2E7O A;  5CP5 A;  4BJX A;  5COI A;  5HRW A;  5J0D A;  2YEM A;  4GPJ A;  4YYK A;  5EPB A;  5FDZ A;  3FKM X;  5L98 A;  5FE6 A;  3Q2F A;  5CQ7 A;  4NQM A;  4O72 A;  4OUF A;  4QEV A;  5EM3 A;  5HFR A;  5C85 A;  5EGU A;  5DFC A;  5CQ5 A;  5HFQ A;  2FSA A;  4TU6 A;  5I89 A;  5JI8 A;  4XY8 A;  5ENE A;  4NXJ A;  4YAX A;  5F2P A;  4TQN A;  4YC9 A;  2E7N A;  2MJV B;  4UIU A;  4J1P A;  3UV2 A;  3RCW A;  2DAT A;  3GG3 A;  4OGJ A;  4BW1 A;  2WP1 A;  2RI7 A;  5C4Q A;  4YYJ A;  4RVR A;  5EVA A;  5D25 A;  5D3J A;  4HBY A;  4A9I A;  4MR4 A;  4CL9 A;  3UVW A;  4MR6 A;  4NR8 A;  4A9L A;  5CGP A;  5II1 A;  5L8U A;  3NXB A;  5FE7 A;  4A9O A;  4PY6 A;  4Y03 A;  2R0S A;  3MUL A;  5D3H A;  3D7C A;  5TCM A;  5DYC A;  3O34 A;  5C89 A;  5F61 A;  5HJC A;  3ONI A;  4C67 A;  5I7X A;  5G4S A;  4A9J A;  4MEP A;  4NS5 A;  5G4R A;  4PKL A;  5D3T A;  5F3A A;  4LC2 A;  5CQ8 A;  5DLZ A;  5DYX A;  4CLB A;  3U5N A;  5FG6 A;  4NUC A;  2YYN A;  4QSS A;  4QEU A;  3U5K A;  5IG6 A;  5IGK A;  2KTB B;  4ZQL A;  5H1T A;  3P1D A;  5DKC A;  5FB1 A;  4DON A;  4YBM A;  4NYX A;  3UVY A;  4UIX A;  5ENJ A;  5ENC A;  5A83 A;  5EI4 A;  5FE5 A;  4IR6 A;  3SVG A;  3AQA A;  4QBM A;  4YYN A;  4LZS A;  4UYE A;  5D3R A;  5H1V A;  5CUG A;  4LRG A;  5AD3 A;  5ENI A;  3UVD A;  5F1H A;  5FG5 A;  5H1U A;  5BT4 A;  4HXS A;  4IOR A;  5FE9 A;  4Q0O A;  4WHU A;  4HXO A;  2DVS A;  4YAB A;  5ENH A;  2WP2 A;  4BW2 A;  4NQN A;  5CQ6 A;  4KV1 A;  4QC1 A;  5CRZ A;  5E3G A;  5D26 A;  4YYM A;  2RO1 A;  5DLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...