4QSVA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) in complex with thymidine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Structure-based approaches towards identification of fragments for the low-druggability ATAD2 bromodomain
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 56
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qsvA00
2D82A 5FE5A 4A9LA 4O71A 3ONIA 3O37A 3O33A 4YYKA 4IR6A 4IR3A 4ALGA 5HRVA 5CQ4A 4YYIA 4KCXA 4N4HA 5EWCA 5FFWA 4N4GA 4MENA 4YY6A 4PS5A 5FFVA 3U5MA 4O70A 2LSPB 4ZC9A 5CQ8A 5F1LA 4CFKA 2FSAA 5CQTA 4OGIA 2RS9B 5E3DA 5LJ2A 4HXRA 5A83A 2DATA 4NR5A 1ZS5A 3U5LA 5DKHA 3U5KA 2R0VA 3P1EA 4N3WA 3U5JA 4A9HA 3QZTA 3I3JA 4A9OA 4QC3A 5E9YA 4YYGA 5HQ6A 4QR4A 5A81A 4MR3A 2L85A 5AMFA 4LC2A 5CUAA 5LJ1A 4IR4A 5LKUA 2DVQA 5A5RA 2DVSA 5F60A 5EPBA 3SVFA 4YBTA 3G0JA 4BW4A 3MQMA 3MULA 3O35A 5A85A 4TT4A 4QSXA 4HBVA 4YATA 1X0JA 5LKTA 4HXSA 5DYXA 4J3IA 4TZ2A 5D25A 4FLPA 2R10A 5CUGA 4E96A 5BT5A 5D24A 3UV5A 5DYUA 5DW2A 5FH6A 3IU5A 3U5NA 3FKMX 5LKXA 5CS8A 3JVKA 5L98A 4CUSA 4QYDA 5CQ7A 4O7EA 5EM3A 5CQ3A 3P1CA 5FG6A 5H1TA 4O74A 3UV4A 5DYAA 4KV1A 4NUEA 4MEOA 4J0RA 4YABA 5EPRA 4NS5A 5FFYA 4C66A 4NR8A 4WHWA 5EGUA 4A9JA 5IIDA 4YK0A 3UVDA 2WP1A 5DFCA 5II2A 5HLSA 5ACYA 5FBXA 3SVGA 4PCEA 4O7BA 5ENJA 5E9VA 5DX4A 5C85A 5HFQA 1N72A 3U5PA 3MXFA 4NR9A 4HXOA 5FDZA 4HBWA 4TT2A 4LZRA 5KO4A 3G0LA 5FH8A 5EPSA 5CFWA 5HQ5A 4XYAA 5H85A 2RNWA 5F5ZA 4QB3A 4HBXA 5I88A 5L96A 4A9MA 5FE0A 4HBYA 2D9EA 4MEQA 3HMEA 5D0CA 3AADA 5ENCA 2L84A 5JI8A 4UIVA 4NQNA 4NRAA 5C87A 4NYVA 2YEKA 2RFJA 4HXKA 5II1A 4NYWA 5L97A 5E9LA 5CQ6A 4CFLA 3Q2FA 1WUMA 4UYFB 5IGKA 4BHWA 5KTXA 4LYSA 5ENHA 4A9KA 3JVMA 4NYXA 2E3KA 2OSSA 2GRCA 4CUPA 3HMHA 4HXNA 5I80A 5KTUA 4YH3A 5A5NA 5HRWA 5FB0A 5CUEA 4TTEA 4LDFA 5H1VA 2N9GA 5FE3A 5CY9A 4HXLA 5C89A 5A5OA 5LUUA 4IOOA 5CQAA 5I1QA 2YEMA 5FB1A 3P1DA 5L8UA 2RNYA 4QBMA 5AD3A 5EWVA 4A9FA 2OO1A 2DKWA 3LQJA 5LVQA 4BW2A 2YW5A 5F63A 4LYWA 4O78A 4CUTA 4TS8A 4O77A 2I7KA 3JVJA 5CUBA 5EWHA 5F62A 2F6NA 2E7OA 4YH4A 5IGLA 5DFDA 5DW1A 5AD2A 5G4SA 5G4RA 5CZGA 4PY6A 5KHMA 4OUFA 5E73A 3MB3A 2MJVB 4BW1A 5ETDA 4YAXA 4UIUA 4TYLA 4YYJA 4RVRA 4HXMA 5FE6A 5I40A 4LZ2A 2E7NA 5AMEA 4UYGA 4QR3A 2DVRA 4YBSA 5HM0A 4QSSA 1EQFA 5COIA 1JM4B 2G4AA 5EVAA 4A9NA 4CLBA 4LZSA 5CQ5A 3RCWA 2NXBA 4WHUA 4X2IA 5KTWA 5LVRA 4LYIA 3O34A 4TT6A 4QUTA 4Z93A 4ALHA 4O7FA 3LQIA 5I7YA 5ETBA 4YYHA 1JSPB 4Z6HA 4TU6A 5ENFA 2RNXA 5ENGA 4XUBA 4QNSA 5CUCA 4LR6A 4QSTA 5FH7A 4O7AA 5I89A 4IOQA 4QSPA 4OGJA 3DAIA 5CRZA 4ZW1A 5EICA 4YADA 3LXJA 4CUQA 4NQMA 5DKCA 4QUUA 4NR4A 4UIXA 5DFBA 5H1UA 4UYFA 4NRBA 4YYMA 5D3TA 5ENEA 4J0SA 5D3HA 5DYCA 5E9IA 5DKDA 5D3LA 5EU1A 4MR4A 2OUOA 4QZSA 5ENBA 3TLPA 4TU4A 2RI7A 5FG4A 4UIYA 5E74A 5CPEA 4J1PA 5IG6A 3S92A 4PCIA 4IORA 4Z1SA 2DWWA 4XY9A 5I7XA 2F6JA 4MEPA 4QC1A 2YDWA 5TB6A 4O75A 5DBMA 5F3AA 5IGMA 4LRGA 4GPJA 4C67A 2R0SA 4UIWA 4A9EA 4XUAA 5HFRA 5CRMA 4MR5A 5HENA 5DLZA 3UV2A 5I29A 5EP7A 5A5PA 4UYEA 2L5EA 3MB4A 4Y03A 5EWDA 5F61A 3P1FA 3P5OA 3MUKA 4CURA 5DY7A 4IR5A 5CTLA 5F36A 5BT4A 5FG5A 4QSWA 5D3RA 5FE4A 5F1HA 3D7CA 5JWMA 4QSRA 5CP5A 4MR6A 3HMFA 4QY4A 5F25A 4BJXA 5D3NA 5FE7A 5D3JA 2H60A 4UYDA 5E7DA 3U5OA 4YY4A 4ZQLA 4A9IA 5IBNA 5HCLA 5HJCA 3O36A 5I86A 4YYNA 5HEMA 3ZYUA 3JVLA 5KU3A 5TCMA 3Q2EA 3UVWA 4O7CA 4WIVA 5K29A 4DONA 2RO1A 5IGNA 3DWYA 5ENIA 2YYNA 4PKLA 5D26A 5EISA 5F2PA 2R0YA 5CUDA 3IU6A 4UIZA 4NR6A 5I83A 3K2JA 3LQHA 4N4IA 4Z6IA 3NXBA 1F68A 5HELA 4NR7A 5FE2A 4BW3A 4KV4A 3UVXA 4QYLA 5EV9A 4NUCA 4QR5A 2YQDA 5E9MA 5EA1A 5HQ7A 4XY8A 4NXJA 1WUGA 4Q0OA 4QSQA 5A7CA 3QZVA 5HRXA 5J0DA 3AQAA 2KTBB 4O76A 5EI4A 4YC9A 2I8NA 4UYHA 5L99A 4TZ8A 4CL9A 3S91A 4QEWA 3UVYA 5D3SA 5FE8A 4QEUA 5EWWA 3UW9A 5EK9A 5CU8A 5C7NA 4PTBA 4O72A 5D7XA 4Z1QA 3LJWA 4TQNA 5LJ0A 4YYDA 4QEVA 4QSUA 3GG3A 4CUUA 3SVHA 4YBMA 5BT3A 4NRCA 2YELA 5D3PA 4QSVA 4Q0NA 4NUDA 5CGPA 4F3IA 5EQ1A 5E3GA 4UITA 2DVVA 5A5QA 5C4QA 5E0RA 3QZSA 5C8GA 5A82A 2WP2A 5LKZA 5A5SA 1E6IA 4AKNA 5E9KA 4HXPA 5DLXA 5FE1A 5FE9A 4N4FA 5L8TA
chains in the Genus database with same CATH superfamily
2D82A 5FE5A 4A9LA 4O71A 3ONIA 3O37A 3O33A 4YYKA 4IR6A 4IR3A 4ALGA 5HRVA 5CQ4A 4YYIA 4KCXA 4N4HA 5EWCA 5FFWA 4N4GA 4MENA 4YY6A 4PS5A 5FFVA 3U5MA 4AI6A 4O70A 2LSPB 4ZC9A 5CQ8A 5F1LA 4CFKA 2FSAA 5CQTA 4OGIA 2RS9B 5E3DA 5LJ2A 4HXRA 5A83A 2DATA 4NR5A 1ZS5A 3U5LA 4AKHA 5DKHA 3U5KA 2R0VA 3P1EA 4N3WA 3U5JA 4A9HA 3QZTA 3I3JA 4A9OA 4QC3A 5E9YA 4YYGA 5HQ6A 4QR4A 5A81A 4MR3A 2L85A 5AMFA 4LC2A 5CUAA 5LJ1A 4IR4A 5LKUA 2DVQA 5A5RA 2DVSA 5F60A 5EPBA 3SVFA 4YBTA 3G0JA 4BW4A 3MQMA 3MULA 3O35A 5A85A 4TT4A 4QSXA 4HBVA 4YATA 1X0JA 5LKTA 4HXSA 5DYXA 4J3IA 4TZ2A 5D25A 4FLPA 2R10A 5CUGA 4E96A 5BT5A 5D24A 3UV5A 5DYUA 5DW2A 5FH6A 3IU5A 3U5NA 3FKMX 5LKXA 5CS8A 3JVKA 5L98A 4CUSA 4QYDA 5CQ7A 4O7EA 5EM3A 5CQ3A 3VKHA 3P1CA 1ZKRA 5FG6A 5H1TA 4O74A 3UV4A 5DYAA 4KV1A 4NUEA 4MEOA 4J0RA 4YABA 5EPRA 4NS5A 5FFYA 4C66A 4NR8A 4WHWA 5EGUA 4A9JA 5IIDA 4YK0A 3UVDA 2WP1A 5DFCA 5II2A 5HLSA 5ACYA 5FBXA 3SVGA 4PCEA 4O7BA 5ENJA 5E9VA 5DX4A 3D1BA 5C85A 5HFQA 1N72A 3U5PA 3MXFA 4NR9A 4HXOA 5FDZA 4HBWA 4TT2A 4LZRA 5KO4A 3G0LA 5FH8A 5EPSA 5CFWA 5HQ5A 4XYAA 5H85A 2RNWA 5F5ZA 4QB3A 4HBXA 5I88A 5L96A 4A9MA 5FE0A 4HBYA 2D9EA 4MEQA 3HMEA 5D0CA 3AADA 5ENCA 2L84A 5JI8A 4UIVA 4NQNA 4NRAA 5C87A 4NYVA 2YEKA 2RFJA 4HXKA 5II1A 4NYWA 5L97A 5E9LA 5CQ6A 4CFLA 3Q2FA 1WUMA 4UYFB 5IGKA 4BHWA 5KTXA 4LYSA 5ENHA 4A9KA 3JVMA 4NYXA 2E3KA 2OSSA 2GRCA 4CUPA 3HMHA 4HXNA 5I80A 5KTUA 4YH3A 5A5NA 5HRWA 5FB0A 5CUEA 4TTEA 4LDFA 5H1VA 2N9GA 5FE3A 5CY9A 4HXLA 5C89A 5A5OA 5LUUA 4IOOA 5CQAA 5I1QA 2YEMA 5FB1A 3P1DA 5L8UA 2RNYA 4QBMA 5AD3A 5EWVA 4A9FA 2OO1A 2DKWA 3LQJA 5LVQA 4BW2A 2YW5A 5F63A 4LYWA 4O78A 4CUTA 4TS8A 4O77A 2I7KA 3JVJA 5CUBA 5EWHA 5F62A 2F6NA 2E7OA 4YH4A 5IGLA 5DFDA 5DW1A 5AD2A 5G4SA 5G4RA 5CZGA 4PY6A 5KHMA 4OUFA 5E73A 3MB3A 2MJVB 4BW1A 5ETDA 4YAXA 4UIUA 4TYLA 4YYJA 4RVRA 4HXMA 5FE6A 5I40A 4LZ2A 2E7NA 5AMEA 4UYGA 4QR3A 3ERRA 2DVRA 4YBSA 5HM0A 4QSSA 1EQFA 5COIA 1JM4B 2G4AA 5EVAA 4A9NA 4CLBA 4LZSA 5CQ5A 3RCWA 2NXBA 4WHUA 4X2IA 5KTWA 5LVRA 4LYIA 3O34A 4TT6A 4QUTA 4Z93A 4ALHA 4O7FA 3LQIA 5I7YA 5ETBA 1PUOA 4YYHA 1JSPB 4Z6HA 4TU6A 5ENFA 2RNXA 5ENGA 4XUBA 4QNSA 5CUCA 4LR6A 4QSTA 5FH7A 4O7AA 5I89A 4IOQA 4QSPA 4OGJA 3DAIA 5CRZA 4ZW1A 5EICA 4YADA 3LXJA 4CUQA 4NQMA 5DKCA 4QUUA 4NR4A 4UIXA 5DFBA 5H1UA 4UYFA 4NRBA 4YYMA 5D3TA 5ENEA 4J0SA 5D3HA 5DYCA 5E9IA 5DKDA 5D3LA 5EU1A 4MR4A 2OUOA 4QZSA 5ENBA 3TLPA 4TU4A 2RI7A 5FG4A 4UIYA 5E74A 5CPEA 4J1PA 5IG6A 3S92A 4PCIA 4IORA 4Z1SA 2DWWA 4XY9A 5I7XA 2F6JA 4MEPA 4QC1A 2YDWA 5TB6A 4O75A 5DBMA 5F3AA 5IGMA 4LRGA 4GPJA 4C67A 2R0SA 4UIWA 4A9EA 4XUAA 5HFRA 5CRMA 4MR5A 5HENA 5DLZA 3UV2A 5I29A 5EP7A 5A5PA 4UYEA 2L5EA 3MB4A 4Y03A 5EWDA 5F61A 3P1FA 3P5OA 3MUKA 3VKGA 4CURA 5DY7A 4IR5A 4AKGA 5CTLA 5F36A 5BT4A 5FG5A 4QSWA 5D3RA 5FE4A 5F1HA 3D7CA 5JWMA 4QSRA 5CP5A 4MR6A 3HMFA 4QY4A 5F25A 4BJXA 5D3NA 5FE7A 5D3JA 2H60A 4UYDA 5E7DA 3U5OA 4AKIA 4YY4A 4ZQLA 4A9IA 5IBNA 5HCLA 5HJCA 3O36A 5I86A 4YYNA 5HEMA 3ZYUA 3JVLA 5KU3A 5TCMA 3Q2EA 3UVWA 4O7CA 4WIVA 5K29A 4DONA 2RO1A 3D1DA 5IGNA 3DWYA 5ENIA 2YYNA 4PKLA 5D26A 5EISA 5F2PA 2R0YA 5CUDA 3IU6A 4UIZA 4NR6A 5I83A 3K2JA 3LQHA 4N4IA 4Z6IA 3NXBA 1F68A 5HELA 4NR7A 5FE2A 4BW3A 4KV4A 3UVXA 4QYLA 5EV9A 4NUCA 4QR5A 2YQDA 5E9MA 5EA1A 5HQ7A 4XY8A 4NXJA 1WUGA 4Q0OA 4QSQA 5A7CA 3QZVA 5HRXA 5J0DA 3AQAA 2KTBB 4O76A 5EI4A 4YC9A 2I8NA 4UYHA 5L99A 4TZ8A 4CL9A 3S91A 4QEWA 3UVYA 5D3SA 5FE8A 4QEUA 5EWWA 3UW9A 5EK9A 5CU8A 5C7NA 4PTBA 4O72A 5D7XA 4Z1QA 3LJWA 4TQNA 5LJ0A 4YYDA 4QEVA 4QSUA 3GG3A 4CUUA 3SVHA 4YBMA 5BT3A 4NRCA 2YELA 5D3PA 4QSVA 4Q0NA 4NUDA 5CGPA 4F3IA 5EQ1A 5E3GA 4UITA 2DVVA 5A5QA 5C4QA 5E0RA 3QZSA 5C8GA 5A82A 2WP2A 5LKZA 5A5SA 1E6IA 2EJNA 4AKNA 5E9KA 4HXPA 5DLXA 5FE1A 5FE9A 4N4FA 5L8TA
chains in the Genus database with same CATH topology
2D82A 5FE5A 4A9LA 4O71A 3ONIA 3O37A 3O33A 4YYKA 4IR6A 4IR3A 4ALGA 5HRVA 5CQ4A 4YYIA 4KCXA 4N4HA 5EWCA 5FFWA 4N4GA 4MENA 4YY6A 4PS5A 5FFVA 3U5MA 4O70A 2LSPB 4ZC9A 5CQ8A 5F1LA 4CFKA 2FSAA 5CQTA 4OGIA 2RS9B 5E3DA 5LJ2A 4HXRA 5A83A 2DATA 4NR5A 1ZS5A 3U5LA 5DKHA 3U5KA 2R0VA 3P1EA 4N3WA 3U5JA 4A9HA 3QZTA 3I3JA 4A9OA 4QC3A 5E9YA 4YYGA 5HQ6A 4QR4A 5A81A 4MR3A 2L85A 5AMFA 4LC2A 5CUAA 5LJ1A 4IR4A 5LKUA 2DVQA 5A5RA 2DVSA 5F60A 5EPBA 3SVFA 4YBTA 3G0JA 4BW4A 3MQMA 3MULA 3O35A 5A85A 4TT4A 4QSXA 4HBVA 4YATA 1X0JA 5LKTA 4HXSA 5DYXA 4J3IA 4TZ2A 5D25A 4FLPA 2R10A 5CUGA 4E96A 5BT5A 5D24A 3UV5A 5DYUA 5DW2A 5FH6A 3IU5A 3U5NA 3FKMX 5LKXA 5CS8A 3JVKA 5L98A 4CUSA 4QYDA 5CQ7A 4O7EA 5EM3A 5CQ3A 3P1CA 5FG6A 5H1TA 4O74A 3UV4A 5DYAA 4KV1A 4NUEA 4MEOA 4J0RA 4YABA 5EPRA 4NS5A 5FFYA 4C66A 4NR8A 4WHWA 5EGUA 4A9JA 5IIDA 4YK0A 3UVDA 2WP1A 5DFCA 5II2A 5HLSA 5ACYA 5FBXA 3SVGA 4PCEA 4O7BA 5ENJA 5E9VA 5DX4A 5C85A 5HFQA 1N72A 3U5PA 3MXFA 4NR9A 4HXOA 5FDZA 4HBWA 4TT2A 4LZRA 5KO4A 3G0LA 5FH8A 5EPSA 5CFWA 5HQ5A 4XYAA 5H85A 2RNWA 5F5ZA 4QB3A 4HBXA 5I88A 5L96A 4A9MA 5FE0A 4HBYA 2D9EA 4MEQA 3HMEA 5D0CA 3AADA 5ENCA 2L84A 5JI8A 4UIVA 4NQNA 4NRAA 5C87A 4NYVA 2YEKA 2RFJA 4HXKA 5II1A 4NYWA 5L97A 5E9LA 5CQ6A 4CFLA 3Q2FA 1WUMA 4UYFB 5IGKA 4BHWA 5KTXA 4LYSA 5ENHA 4A9KA 3JVMA 4NYXA 2E3KA 2OSSA 2GRCA 4CUPA 3HMHA 4HXNA 5I80A 5KTUA 4YH3A 5A5NA 5HRWA 5FB0A 5CUEA 4TTEA 4LDFA 5H1VA 2N9GA 5FE3A 5CY9A 4HXLA 5C89A 5A5OA 5LUUA 4IOOA 5CQAA 5I1QA 2YEMA 5FB1A 3P1DA 5L8UA 2RNYA 4QBMA 5AD3A 5EWVA 4A9FA 2OO1A 2DKWA 3LQJA 5LVQA 4BW2A 2YW5A 5F63A 4LYWA 4O78A 4CUTA 4TS8A 4O77A 2I7KA 3JVJA 5CUBA 5EWHA 5F62A 2F6NA 2E7OA 4YH4A 5IGLA 5DFDA 5DW1A 5AD2A 5G4SA 5G4RA 5CZGA 4PY6A 5KHMA 4OUFA 5E73A 3MB3A 2MJVB 4BW1A 5ETDA 4YAXA 4UIUA 4TYLA 4YYJA 4RVRA 4HXMA 5FE6A 5I40A 4LZ2A 2E7NA 5AMEA 4UYGA 4QR3A 2DVRA 4YBSA 5HM0A 4QSSA 1EQFA 5COIA 1JM4B 2G4AA 5EVAA 4A9NA 4CLBA 4LZSA 5CQ5A 3RCWA 2NXBA 4WHUA 4X2IA 5KTWA 5LVRA 4LYIA 3O34A 4TT6A 4QUTA 4Z93A 4ALHA 4O7FA 3LQIA 5I7YA 5ETBA 4YYHA 1JSPB 4Z6HA 4TU6A 5ENFA 2RNXA 5ENGA 4XUBA 4QNSA 5CUCA 4LR6A 4QSTA 5FH7A 4O7AA 5I89A 4IOQA 4QSPA 4OGJA 3DAIA 5CRZA 4ZW1A 5EICA 4YADA 3LXJA 4CUQA 4NQMA 5DKCA 4QUUA 4NR4A 4UIXA 5DFBA 5H1UA 4UYFA 4NRBA 4YYMA 5D3TA 5ENEA 4J0SA 5D3HA 5DYCA 5E9IA 5DKDA 5D3LA 5EU1A 4MR4A 2OUOA 4QZSA 5ENBA 3TLPA 4TU4A 2RI7A 5FG4A 4UIYA 5E74A 5CPEA 4J1PA 5IG6A 3S92A 4PCIA 4IORA 4Z1SA 2DWWA 4XY9A 5I7XA 2F6JA 4MEPA 4QC1A 2YDWA 5TB6A 4O75A 5DBMA 5F3AA 5IGMA 4LRGA 4GPJA 4C67A 2R0SA 4UIWA 4A9EA 4XUAA 5HFRA 5CRMA 4MR5A 5HENA 5DLZA 3UV2A 5I29A 5EP7A 5A5PA 4UYEA 2L5EA 3MB4A 4Y03A 5EWDA 5F61A 3P1FA 3P5OA 3MUKA 4CURA 5DY7A 4IR5A 5CTLA 5F36A 5BT4A 5FG5A 4QSWA 5D3RA 5FE4A 5F1HA 3D7CA 5JWMA 4QSRA 5CP5A 4MR6A 3HMFA 4QY4A 5F25A 4BJXA 5D3NA 5FE7A 5D3JA 2H60A 4UYDA 5E7DA 3U5OA 4YY4A 4ZQLA 4A9IA 5IBNA 5HCLA 5HJCA 3O36A 5I86A 4YYNA 5HEMA 3ZYUA 3JVLA 5KU3A 5TCMA 3Q2EA 3UVWA 4O7CA 4WIVA 5K29A 4DONA 2RO1A 5IGNA 3DWYA 5ENIA 2YYNA 4PKLA 5D26A 5EISA 5F2PA 2R0YA 5CUDA 3IU6A 4UIZA 4NR6A 5I83A 3K2JA 3LQHA 4N4IA 4Z6IA 3NXBA 1F68A 5HELA 4NR7A 5FE2A 4BW3A 4KV4A 3UVXA 4QYLA 5EV9A 4NUCA 4QR5A 2YQDA 5E9MA 5EA1A 5HQ7A 4XY8A 4NXJA 1WUGA 4Q0OA 4QSQA 5A7CA 3QZVA 5HRXA 5J0DA 3AQAA 2KTBB 4O76A 5EI4A 4YC9A 2I8NA 4UYHA 5L99A 4TZ8A 4CL9A 3S91A 4QEWA 3UVYA 5D3SA 5FE8A 4QEUA 5EWWA 3UW9A 5EK9A 5CU8A 5C7NA 4PTBA 4O72A 5D7XA 4Z1QA 3LJWA 4TQNA 5LJ0A 4YYDA 4QEVA 4QSUA 3GG3A 4CUUA 3SVHA 4YBMA 5BT3A 4NRCA 2YELA 5D3PA 4QSVA 4Q0NA 4NUDA 5CGPA 4F3IA 5EQ1A 5E3GA 4UITA 2DVVA 5A5QA 5C4QA 5E0RA 3QZSA 5C8GA 5A82A 2WP2A 5LKZA 5A5SA 1E6IA 4AKNA 5E9KA 4HXPA 5DLXA 5FE1A 5FE9A 4N4FA 5L8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D82 A;  5FE5 A;  4A9L A;  4O71 A;  3ONI A;  3O37 A;  3O33 A;  4YYK A;  4IR6 A;  4IR3 A;  4ALG A;  5HRV A;  5CQ4 A;  4YYI A;  4KCX A;  4N4H A;  5EWC A;  5FFW A;  4N4G A;  4MEN A;  4YY6 A;  4PS5 A;  5FFV A;  3U5M A;  4O70 A;  2LSP B;  4ZC9 A;  5CQ8 A;  5F1L A;  4CFK A;  2FSA A;  5CQT A;  4OGI A;  2RS9 B;  5E3D A;  5LJ2 A;  4HXR A;  5A83 A;  2DAT A;  4NR5 A;  1ZS5 A;  3U5L A;  5DKH A;  3U5K A;  2R0V A;  3P1E A;  4N3W A;  3U5J A;  4A9H A;  3QZT A;  3I3J A;  4A9O A;  4QC3 A;  5E9Y A;  4YYG A;  5HQ6 A;  4QR4 A;  5A81 A;  4MR3 A;  2L85 A;  5AMF A;  4LC2 A;  5CUA A;  5LJ1 A;  4IR4 A;  5LKU A;  2DVQ A;  5A5R A;  2DVS A;  5F60 A;  5EPB A;  3SVF A;  4YBT A;  3G0J A;  4BW4 A;  3MQM A;  3MUL A;  3O35 A;  5A85 A;  4TT4 A;  4QSX A;  4HBV A;  4YAT A;  1X0J A;  5LKT A;  4HXS A;  5DYX A;  4J3I A;  4TZ2 A;  5D25 A;  4FLP A;  2R10 A;  5CUG A;  4E96 A;  5BT5 A;  5D24 A;  3UV5 A;  5DYU A;  5DW2 A;  5FH6 A;  3IU5 A;  3U5N A;  3FKM X;  5LKX A;  5CS8 A;  3JVK A;  5L98 A;  4CUS A;  4QYD A;  5CQ7 A;  4O7E A;  5EM3 A;  5CQ3 A;  3P1C A;  5FG6 A;  5H1T A;  4O74 A;  3UV4 A;  5DYA A;  4KV1 A;  4NUE A;  4MEO A;  4J0R A;  4YAB A;  5EPR A;  4NS5 A;  5FFY A;  4C66 A;  4NR8 A;  4WHW A;  5EGU A;  4A9J A;  5IID A;  4YK0 A;  3UVD A;  2WP1 A;  5DFC A;  5II2 A;  5HLS A;  5ACY A;  5FBX A;  3SVG A;  4PCE A;  4O7B A;  5ENJ A;  5E9V A;  5DX4 A;  5C85 A;  5HFQ A;  1N72 A;  3U5P A;  3MXF A;  4NR9 A;  4HXO A;  5FDZ A;  4HBW A;  4TT2 A;  4LZR A;  5KO4 A;  3G0L A;  5FH8 A;  5EPS A;  5CFW A;  5HQ5 A;  4XYA A;  5H85 A;  2RNW A;  5F5Z A;  4QB3 A;  4HBX A;  5I88 A;  5L96 A;  4A9M A;  5FE0 A;  4HBY A;  2D9E A;  4MEQ A;  3HME A;  5D0C A;  3AAD A;  5ENC A;  2L84 A;  5JI8 A;  4UIV A;  4NQN A;  4NRA A;  5C87 A;  4NYV A;  2YEK A;  2RFJ A;  4HXK A;  5II1 A;  4NYW A;  5L97 A;  5E9L A;  5CQ6 A;  4CFL A;  3Q2F A;  1WUM A;  4UYF B;  5IGK A;  4BHW A;  5KTX A;  4LYS A;  5ENH A;  4A9K A;  3JVM A;  4NYX A;  2E3K A;  2OSS A;  2GRC A;  4CUP A;  3HMH A;  4HXN A;  5I80 A;  5KTU A;  4YH3 A;  5A5N A;  5HRW A;  5FB0 A;  5CUE A;  4TTE A;  4LDF A;  5H1V A;  2N9G A;  5FE3 A;  5CY9 A;  4HXL A;  5C89 A;  5A5O A;  5LUU A;  4IOO A;  5CQA A;  5I1Q A;  2YEM A;  5FB1 A;  3P1D A;  5L8U A;  2RNY A;  4QBM A;  5AD3 A;  5EWV A;  4A9F A;  2OO1 A;  2DKW A;  3LQJ A;  5LVQ A;  4BW2 A;  2YW5 A;  5F63 A;  4LYW A;  4O78 A;  4CUT A;  4TS8 A;  4O77 A;  2I7K A;  3JVJ A;  5CUB A;  5EWH A;  5F62 A;  2F6N A;  2E7O A;  4YH4 A;  5IGL A;  5DFD A;  5DW1 A;  5AD2 A;  5G4S A;  5G4R A;  5CZG A;  4PY6 A;  5KHM A;  4OUF A;  5E73 A;  3MB3 A;  2MJV B;  4BW1 A;  5ETD A;  4YAX A;  4UIU A;  4TYL A;  4YYJ A;  4RVR A;  4HXM A;  5FE6 A;  5I40 A;  4LZ2 A;  2E7N A;  5AME A;  4UYG A;  4QR3 A;  2DVR A;  4YBS A;  5HM0 A;  4QSS A;  1EQF A;  5COI A;  1JM4 B;  2G4A A;  5EVA A;  4A9N A;  4CLB A;  4LZS A;  5CQ5 A;  3RCW A;  2NXB A;  4WHU A;  4X2I A;  5KTW A;  5LVR A;  4LYI A;  3O34 A;  4TT6 A;  4QUT A;  4Z93 A;  4ALH A;  4O7F A;  3LQI A;  5I7Y A;  5ETB A;  4YYH A;  1JSP B;  4Z6H A;  4TU6 A;  5ENF A;  2RNX A;  5ENG A;  4XUB A;  4QNS A;  5CUC A;  4LR6 A;  4QST A;  5FH7 A;  4O7A A;  5I89 A;  4IOQ A;  4QSP A;  4OGJ A;  3DAI A;  5CRZ A;  4ZW1 A;  5EIC A;  4YAD A;  3LXJ A;  4CUQ A;  4NQM A;  5DKC A;  4QUU A;  4NR4 A;  4UIX A;  5DFB A;  5H1U A;  4UYF A;  4NRB A;  4YYM A;  5D3T A;  5ENE A;  4J0S A;  5D3H A;  5DYC A;  5E9I A;  5DKD A;  5D3L A;  5EU1 A;  4MR4 A;  2OUO A;  4QZS A;  5ENB A;  3TLP A;  4TU4 A;  2RI7 A;  5FG4 A;  4UIY A;  5E74 A;  5CPE A;  4J1P A;  5IG6 A;  3S92 A;  4PCI A;  4IOR A;  4Z1S A;  2DWW A;  4XY9 A;  5I7X A;  2F6J A;  4MEP A;  4QC1 A;  2YDW A;  5TB6 A;  4O75 A;  5DBM A;  5F3A A;  5IGM A;  4LRG A;  4GPJ A;  4C67 A;  2R0S A;  4UIW A;  4A9E A;  4XUA A;  5HFR A;  5CRM A;  4MR5 A;  5HEN A;  5DLZ A;  3UV2 A;  5I29 A;  5EP7 A;  5A5P A;  4UYE A;  2L5E A;  3MB4 A;  4Y03 A;  5EWD A;  5F61 A;  3P1F A;  3P5O A;  3MUK A;  4CUR A;  5DY7 A;  4IR5 A;  5CTL A;  5F36 A;  5BT4 A;  5FG5 A;  4QSW A;  5D3R A;  5FE4 A;  5F1H A;  3D7C A;  5JWM A;  4QSR A;  5CP5 A;  4MR6 A;  3HMF A;  4QY4 A;  5F25 A;  4BJX A;  5D3N A;  5FE7 A;  5D3J A;  2H60 A;  4UYD A;  5E7D A;  3U5O A;  4YY4 A;  4ZQL A;  4A9I A;  5IBN A;  5HCL A;  5HJC A;  3O36 A;  5I86 A;  4YYN A;  5HEM A;  3ZYU A;  3JVL A;  5KU3 A;  5TCM A;  3Q2E A;  3UVW A;  4O7C A;  4WIV A;  5K29 A;  4DON A;  2RO1 A;  5IGN A;  3DWY A;  5ENI A;  2YYN A;  4PKL A;  5D26 A;  5EIS A;  5F2P A;  2R0Y A;  5CUD A;  3IU6 A;  4UIZ A;  4NR6 A;  5I83 A;  3K2J A;  3LQH A;  4N4I A;  4Z6I A;  3NXB A;  1F68 A;  5HEL A;  4NR7 A;  5FE2 A;  4BW3 A;  4KV4 A;  3UVX A;  4QYL A;  5EV9 A;  4NUC A;  4QR5 A;  2YQD A;  5E9M A;  5EA1 A;  5HQ7 A;  4XY8 A;  4NXJ A;  1WUG A;  4Q0O A;  4QSQ A;  5A7C A;  3QZV A;  5HRX A;  5J0D A;  3AQA A;  2KTB B;  4O76 A;  5EI4 A;  4YC9 A;  2I8N A;  4UYH A;  5L99 A;  4TZ8 A;  4CL9 A;  3S91 A;  4QEW A;  3UVY A;  5D3S A;  5FE8 A;  4QEU A;  5EWW A;  3UW9 A;  5EK9 A;  5CU8 A;  5C7N A;  4PTB A;  4O72 A;  5D7X A;  4Z1Q A;  3LJW A;  4TQN A;  5LJ0 A;  4YYD A;  4QEV A;  4QSU A;  3GG3 A;  4CUU A;  3SVH A;  4YBM A;  5BT3 A;  4NRC A;  2YEL A;  5D3P A;  4QSV A;  4Q0N A;  4NUD A;  5CGP A;  4F3I A;  5EQ1 A;  5E3G A;  4UIT A;  2DVV A;  5A5Q A;  5C4Q A;  5E0R A;  3QZS A;  5C8G A;  5A82 A;  2WP2 A;  5LKZ A;  5A5S A;  1E6I A;  4AKN A;  5E9K A;  4HXP A;  5DLX A;  5FE1 A;  5FE9 A;  4N4F A;  5L8T A; 
#chains in the Genus database with same CATH topology
 2D82 A;  5FE5 A;  4A9L A;  4O71 A;  3ONI A;  3O37 A;  3O33 A;  4YYK A;  4IR6 A;  4IR3 A;  4ALG A;  5HRV A;  5CQ4 A;  4YYI A;  4KCX A;  4N4H A;  5EWC A;  5FFW A;  4N4G A;  4MEN A;  4YY6 A;  4PS5 A;  5FFV A;  3U5M A;  4AI6 A;  4O70 A;  2LSP B;  4ZC9 A;  5CQ8 A;  5F1L A;  4CFK A;  2FSA A;  5CQT A;  4OGI A;  2RS9 B;  5E3D A;  5LJ2 A;  4HXR A;  5A83 A;  2DAT A;  4NR5 A;  1ZS5 A;  3U5L A;  4AKH A;  5DKH A;  3U5K A;  2R0V A;  3P1E A;  4N3W A;  3U5J A;  4A9H A;  3QZT A;  3I3J A;  4A9O A;  4QC3 A;  5E9Y A;  4YYG A;  5HQ6 A;  4QR4 A;  5A81 A;  4MR3 A;  2L85 A;  5AMF A;  4LC2 A;  5CUA A;  5LJ1 A;  4IR4 A;  5LKU A;  2DVQ A;  5A5R A;  2DVS A;  5F60 A;  5EPB A;  3SVF A;  4YBT A;  3G0J A;  4BW4 A;  3MQM A;  3MUL A;  3O35 A;  5A85 A;  4TT4 A;  4QSX A;  4HBV A;  4YAT A;  1X0J A;  5LKT A;  4HXS A;  5DYX A;  4J3I A;  4TZ2 A;  5D25 A;  4FLP A;  2R10 A;  5CUG A;  4E96 A;  5BT5 A;  5D24 A;  3UV5 A;  5DYU A;  5DW2 A;  5FH6 A;  3IU5 A;  3U5N A;  3FKM X;  5LKX A;  5CS8 A;  3JVK A;  5L98 A;  4CUS A;  4QYD A;  5CQ7 A;  4O7E A;  5EM3 A;  5CQ3 A;  3VKH A;  3P1C A;  1ZKR A;  5FG6 A;  5H1T A;  4O74 A;  3UV4 A;  5DYA A;  4KV1 A;  4NUE A;  4MEO A;  4J0R A;  4YAB A;  5EPR A;  4NS5 A;  5FFY A;  4C66 A;  4NR8 A;  4WHW A;  5EGU A;  4A9J A;  5IID A;  4YK0 A;  3UVD A;  2WP1 A;  5DFC A;  5II2 A;  5HLS A;  5ACY A;  5FBX A;  3SVG A;  4PCE A;  4O7B A;  5ENJ A;  5E9V A;  5DX4 A;  3D1B A;  5C85 A;  5HFQ A;  1N72 A;  3U5P A;  3MXF A;  4NR9 A;  4HXO A;  5FDZ A;  4HBW A;  4TT2 A;  4LZR A;  5KO4 A;  3G0L A;  5FH8 A;  5EPS A;  5CFW A;  5HQ5 A;  4XYA A;  5H85 A;  2RNW A;  5F5Z A;  4QB3 A;  4HBX A;  5I88 A;  5L96 A;  4A9M A;  5FE0 A;  4HBY A;  2D9E A;  4MEQ A;  3HME A;  5D0C A;  3AAD A;  5ENC A;  2L84 A;  5JI8 A;  4UIV A;  4NQN A;  4NRA A;  5C87 A;  4NYV A;  2YEK A;  2RFJ A;  4HXK A;  5II1 A;  4NYW A;  5L97 A;  5E9L A;  5CQ6 A;  4CFL A;  3Q2F A;  1WUM A;  4UYF B;  5IGK A;  4BHW A;  5KTX A;  4LYS A;  5ENH A;  4A9K A;  3JVM A;  4NYX A;  2E3K A;  2OSS A;  2GRC A;  4CUP A;  3HMH A;  4HXN A;  5I80 A;  5KTU A;  4YH3 A;  5A5N A;  5HRW A;  5FB0 A;  5CUE A;  4TTE A;  4LDF A;  5H1V A;  2N9G A;  5FE3 A;  5CY9 A;  4HXL A;  5C89 A;  5A5O A;  5LUU A;  4IOO A;  5CQA A;  5I1Q A;  2YEM A;  5FB1 A;  3P1D A;  5L8U A;  2RNY A;  4QBM A;  5AD3 A;  5EWV A;  4A9F A;  2OO1 A;  2DKW A;  3LQJ A;  5LVQ A;  4BW2 A;  2YW5 A;  5F63 A;  4LYW A;  4O78 A;  4CUT A;  4TS8 A;  4O77 A;  2I7K A;  3JVJ A;  5CUB A;  5EWH A;  5F62 A;  2F6N A;  2E7O A;  4YH4 A;  5IGL A;  5DFD A;  5DW1 A;  5AD2 A;  5G4S A;  5G4R A;  5CZG A;  4PY6 A;  5KHM A;  4OUF A;  5E73 A;  3MB3 A;  2MJV B;  4BW1 A;  5ETD A;  4YAX A;  4UIU A;  4TYL A;  4YYJ A;  4RVR A;  4HXM A;  5FE6 A;  5I40 A;  4LZ2 A;  2E7N A;  5AME A;  4UYG A;  4QR3 A;  3ERR A;  2DVR A;  4YBS A;  5HM0 A;  4QSS A;  1EQF A;  5COI A;  1JM4 B;  2G4A A;  5EVA A;  4A9N A;  4CLB A;  4LZS A;  5CQ5 A;  3RCW A;  2NXB A;  4WHU A;  4X2I A;  5KTW A;  5LVR A;  4LYI A;  3O34 A;  4TT6 A;  4QUT A;  4Z93 A;  4ALH A;  4O7F A;  3LQI A;  5I7Y A;  5ETB A;  1PUO A;  4YYH A;  1JSP B;  4Z6H A;  4TU6 A;  5ENF A;  2RNX A;  5ENG A;  4XUB A;  4QNS A;  5CUC A;  4LR6 A;  4QST A;  5FH7 A;  4O7A A;  5I89 A;  4IOQ A;  4QSP A;  4OGJ A;  3DAI A;  5CRZ A;  4ZW1 A;  5EIC A;  4YAD A;  3LXJ A;  4CUQ A;  4NQM A;  5DKC A;  4QUU A;  4NR4 A;  4UIX A;  5DFB A;  5H1U A;  4UYF A;  4NRB A;  4YYM A;  5D3T A;  5ENE A;  4J0S A;  5D3H A;  5DYC A;  5E9I A;  5DKD A;  5D3L A;  5EU1 A;  4MR4 A;  2OUO A;  4QZS A;  5ENB A;  3TLP A;  4TU4 A;  2RI7 A;  5FG4 A;  4UIY A;  5E74 A;  5CPE A;  4J1P A;  5IG6 A;  3S92 A;  4PCI A;  4IOR A;  4Z1S A;  2DWW A;  4XY9 A;  5I7X A;  2F6J A;  4MEP A;  4QC1 A;  2YDW A;  5TB6 A;  4O75 A;  5DBM A;  5F3A A;  5IGM A;  4LRG A;  4GPJ A;  4C67 A;  2R0S A;  4UIW A;  4A9E A;  4XUA A;  5HFR A;  5CRM A;  4MR5 A;  5HEN A;  5DLZ A;  3UV2 A;  5I29 A;  5EP7 A;  5A5P A;  4UYE A;  2L5E A;  3MB4 A;  4Y03 A;  5EWD A;  5F61 A;  3P1F A;  3P5O A;  3MUK A;  3VKG A;  4CUR A;  5DY7 A;  4IR5 A;  4AKG A;  5CTL A;  5F36 A;  5BT4 A;  5FG5 A;  4QSW A;  5D3R A;  5FE4 A;  5F1H A;  3D7C A;  5JWM A;  4QSR A;  5CP5 A;  4MR6 A;  3HMF A;  4QY4 A;  5F25 A;  4BJX A;  5D3N A;  5FE7 A;  5D3J A;  2H60 A;  4UYD A;  5E7D A;  3U5O A;  4AKI A;  4YY4 A;  4ZQL A;  4A9I A;  5IBN A;  5HCL A;  5HJC A;  3O36 A;  5I86 A;  4YYN A;  5HEM A;  3ZYU A;  3JVL A;  5KU3 A;  5TCM A;  3Q2E A;  3UVW A;  4O7C A;  4WIV A;  5K29 A;  4DON A;  2RO1 A;  3D1D A;  5IGN A;  3DWY A;  5ENI A;  2YYN A;  4PKL A;  5D26 A;  5EIS A;  5F2P A;  2R0Y A;  5CUD A;  3IU6 A;  4UIZ A;  4NR6 A;  5I83 A;  3K2J A;  3LQH A;  4N4I A;  4Z6I A;  3NXB A;  1F68 A;  5HEL A;  4NR7 A;  5FE2 A;  4BW3 A;  4KV4 A;  3UVX A;  4QYL A;  5EV9 A;  4NUC A;  4QR5 A;  2YQD A;  5E9M A;  5EA1 A;  5HQ7 A;  4XY8 A;  4NXJ A;  1WUG A;  4Q0O A;  4QSQ A;  5A7C A;  3QZV A;  5HRX A;  5J0D A;  3AQA A;  2KTB B;  4O76 A;  5EI4 A;  4YC9 A;  2I8N A;  4UYH A;  5L99 A;  4TZ8 A;  4CL9 A;  3S91 A;  4QEW A;  3UVY A;  5D3S A;  5FE8 A;  4QEU A;  5EWW A;  3UW9 A;  5EK9 A;  5CU8 A;  5C7N A;  4PTB A;  4O72 A;  5D7X A;  4Z1Q A;  3LJW A;  4TQN A;  5LJ0 A;  4YYD A;  4QEV A;  4QSU A;  3GG3 A;  4CUU A;  3SVH A;  4YBM A;  5BT3 A;  4NRC A;  2YEL A;  5D3P A;  4QSV A;  4Q0N A;  4NUD A;  5CGP A;  4F3I A;  5EQ1 A;  5E3G A;  4UIT A;  2DVV A;  5A5Q A;  5C4Q A;  5E0R A;  3QZS A;  5C8G A;  5A82 A;  2WP2 A;  5LKZ A;  5A5S A;  1E6I A;  2EJN A;  4AKN A;  5E9K A;  4HXP A;  5DLX A;  5FE1 A;  5FE9 A;  4N4F A;  5L8T A; 
#chains in the Genus database with same CATH homology
 2D82 A;  5FE5 A;  4A9L A;  4O71 A;  3ONI A;  3O37 A;  3O33 A;  4YYK A;  4IR6 A;  4IR3 A;  4ALG A;  5HRV A;  5CQ4 A;  4YYI A;  4KCX A;  4N4H A;  5EWC A;  5FFW A;  4N4G A;  4MEN A;  4YY6 A;  4PS5 A;  5FFV A;  3U5M A;  4O70 A;  2LSP B;  4ZC9 A;  5CQ8 A;  5F1L A;  4CFK A;  2FSA A;  5CQT A;  4OGI A;  2RS9 B;  5E3D A;  5LJ2 A;  4HXR A;  5A83 A;  2DAT A;  4NR5 A;  1ZS5 A;  3U5L A;  5DKH A;  3U5K A;  2R0V A;  3P1E A;  4N3W A;  3U5J A;  4A9H A;  3QZT A;  3I3J A;  4A9O A;  4QC3 A;  5E9Y A;  4YYG A;  5HQ6 A;  4QR4 A;  5A81 A;  4MR3 A;  2L85 A;  5AMF A;  4LC2 A;  5CUA A;  5LJ1 A;  4IR4 A;  5LKU A;  2DVQ A;  5A5R A;  2DVS A;  5F60 A;  5EPB A;  3SVF A;  4YBT A;  3G0J A;  4BW4 A;  3MQM A;  3MUL A;  3O35 A;  5A85 A;  4TT4 A;  4QSX A;  4HBV A;  4YAT A;  1X0J A;  5LKT A;  4HXS A;  5DYX A;  4J3I A;  4TZ2 A;  5D25 A;  4FLP A;  2R10 A;  5CUG A;  4E96 A;  5BT5 A;  5D24 A;  3UV5 A;  5DYU A;  5DW2 A;  5FH6 A;  3IU5 A;  3U5N A;  3FKM X;  5LKX A;  5CS8 A;  3JVK A;  5L98 A;  4CUS A;  4QYD A;  5CQ7 A;  4O7E A;  5EM3 A;  5CQ3 A;  3P1C A;  5FG6 A;  5H1T A;  4O74 A;  3UV4 A;  5DYA A;  4KV1 A;  4NUE A;  4MEO A;  4J0R A;  4YAB A;  5EPR A;  4NS5 A;  5FFY A;  4C66 A;  4NR8 A;  4WHW A;  5EGU A;  4A9J A;  5IID A;  4YK0 A;  3UVD A;  2WP1 A;  5DFC A;  5II2 A;  5HLS A;  5ACY A;  5FBX A;  3SVG A;  4PCE A;  4O7B A;  5ENJ A;  5E9V A;  5DX4 A;  5C85 A;  5HFQ A;  1N72 A;  3U5P A;  3MXF A;  4NR9 A;  4HXO A;  5FDZ A;  4HBW A;  4TT2 A;  4LZR A;  5KO4 A;  3G0L A;  5FH8 A;  5EPS A;  5CFW A;  5HQ5 A;  4XYA A;  5H85 A;  2RNW A;  5F5Z A;  4QB3 A;  4HBX A;  5I88 A;  5L96 A;  4A9M A;  5FE0 A;  4HBY A;  2D9E A;  4MEQ A;  3HME A;  5D0C A;  3AAD A;  5ENC A;  2L84 A;  5JI8 A;  4UIV A;  4NQN A;  4NRA A;  5C87 A;  4NYV A;  2YEK A;  2RFJ A;  4HXK A;  5II1 A;  4NYW A;  5L97 A;  5E9L A;  5CQ6 A;  4CFL A;  3Q2F A;  1WUM A;  4UYF B;  5IGK A;  4BHW A;  5KTX A;  4LYS A;  5ENH A;  4A9K A;  3JVM A;  4NYX A;  2E3K A;  2OSS A;  2GRC A;  4CUP A;  3HMH A;  4HXN A;  5I80 A;  5KTU A;  4YH3 A;  5A5N A;  5HRW A;  5FB0 A;  5CUE A;  4TTE A;  4LDF A;  5H1V A;  2N9G A;  5FE3 A;  5CY9 A;  4HXL A;  5C89 A;  5A5O A;  5LUU A;  4IOO A;  5CQA A;  5I1Q A;  2YEM A;  5FB1 A;  3P1D A;  5L8U A;  2RNY A;  4QBM A;  5AD3 A;  5EWV A;  4A9F A;  2OO1 A;  2DKW A;  3LQJ A;  5LVQ A;  4BW2 A;  2YW5 A;  5F63 A;  4LYW A;  4O78 A;  4CUT A;  4TS8 A;  4O77 A;  2I7K A;  3JVJ A;  5CUB A;  5EWH A;  5F62 A;  2F6N A;  2E7O A;  4YH4 A;  5IGL A;  5DFD A;  5DW1 A;  5AD2 A;  5G4S A;  5G4R A;  5CZG A;  4PY6 A;  5KHM A;  4OUF A;  5E73 A;  3MB3 A;  2MJV B;  4BW1 A;  5ETD A;  4YAX A;  4UIU A;  4TYL A;  4YYJ A;  4RVR A;  4HXM A;  5FE6 A;  5I40 A;  4LZ2 A;  2E7N A;  5AME A;  4UYG A;  4QR3 A;  2DVR A;  4YBS A;  5HM0 A;  4QSS A;  1EQF A;  5COI A;  1JM4 B;  2G4A A;  5EVA A;  4A9N A;  4CLB A;  4LZS A;  5CQ5 A;  3RCW A;  2NXB A;  4WHU A;  4X2I A;  5KTW A;  5LVR A;  4LYI A;  3O34 A;  4TT6 A;  4QUT A;  4Z93 A;  4ALH A;  4O7F A;  3LQI A;  5I7Y A;  5ETB A;  4YYH A;  1JSP B;  4Z6H A;  4TU6 A;  5ENF A;  2RNX A;  5ENG A;  4XUB A;  4QNS A;  5CUC A;  4LR6 A;  4QST A;  5FH7 A;  4O7A A;  5I89 A;  4IOQ A;  4QSP A;  4OGJ A;  3DAI A;  5CRZ A;  4ZW1 A;  5EIC A;  4YAD A;  3LXJ A;  4CUQ A;  4NQM A;  5DKC A;  4QUU A;  4NR4 A;  4UIX A;  5DFB A;  5H1U A;  4UYF A;  4NRB A;  4YYM A;  5D3T A;  5ENE A;  4J0S A;  5D3H A;  5DYC A;  5E9I A;  5DKD A;  5D3L A;  5EU1 A;  4MR4 A;  2OUO A;  4QZS A;  5ENB A;  3TLP A;  4TU4 A;  2RI7 A;  5FG4 A;  4UIY A;  5E74 A;  5CPE A;  4J1P A;  5IG6 A;  3S92 A;  4PCI A;  4IOR A;  4Z1S A;  2DWW A;  4XY9 A;  5I7X A;  2F6J A;  4MEP A;  4QC1 A;  2YDW A;  5TB6 A;  4O75 A;  5DBM A;  5F3A A;  5IGM A;  4LRG A;  4GPJ A;  4C67 A;  2R0S A;  4UIW A;  4A9E A;  4XUA A;  5HFR A;  5CRM A;  4MR5 A;  5HEN A;  5DLZ A;  3UV2 A;  5I29 A;  5EP7 A;  5A5P A;  4UYE A;  2L5E A;  3MB4 A;  4Y03 A;  5EWD A;  5F61 A;  3P1F A;  3P5O A;  3MUK A;  4CUR A;  5DY7 A;  4IR5 A;  5CTL A;  5F36 A;  5BT4 A;  5FG5 A;  4QSW A;  5D3R A;  5FE4 A;  5F1H A;  3D7C A;  5JWM A;  4QSR A;  5CP5 A;  4MR6 A;  3HMF A;  4QY4 A;  5F25 A;  4BJX A;  5D3N A;  5FE7 A;  5D3J A;  2H60 A;  4UYD A;  5E7D A;  3U5O A;  4YY4 A;  4ZQL A;  4A9I A;  5IBN A;  5HCL A;  5HJC A;  3O36 A;  5I86 A;  4YYN A;  5HEM A;  3ZYU A;  3JVL A;  5KU3 A;  5TCM A;  3Q2E A;  3UVW A;  4O7C A;  4WIV A;  5K29 A;  4DON A;  2RO1 A;  5IGN A;  3DWY A;  5ENI A;  2YYN A;  4PKL A;  5D26 A;  5EIS A;  5F2P A;  2R0Y A;  5CUD A;  3IU6 A;  4UIZ A;  4NR6 A;  5I83 A;  3K2J A;  3LQH A;  4N4I A;  4Z6I A;  3NXB A;  1F68 A;  5HEL A;  4NR7 A;  5FE2 A;  4BW3 A;  4KV4 A;  3UVX A;  4QYL A;  5EV9 A;  4NUC A;  4QR5 A;  2YQD A;  5E9M A;  5EA1 A;  5HQ7 A;  4XY8 A;  4NXJ A;  1WUG A;  4Q0O A;  4QSQ A;  5A7C A;  3QZV A;  5HRX A;  5J0D A;  3AQA A;  2KTB B;  4O76 A;  5EI4 A;  4YC9 A;  2I8N A;  4UYH A;  5L99 A;  4TZ8 A;  4CL9 A;  3S91 A;  4QEW A;  3UVY A;  5D3S A;  5FE8 A;  4QEU A;  5EWW A;  3UW9 A;  5EK9 A;  5CU8 A;  5C7N A;  4PTB A;  4O72 A;  5D7X A;  4Z1Q A;  3LJW A;  4TQN A;  5LJ0 A;  4YYD A;  4QEV A;  4QSU A;  3GG3 A;  4CUU A;  3SVH A;  4YBM A;  5BT3 A;  4NRC A;  2YEL A;  5D3P A;  4QSV A;  4Q0N A;  4NUD A;  5CGP A;  4F3I A;  5EQ1 A;  5E3G A;  4UIT A;  2DVV A;  5A5Q A;  5C4Q A;  5E0R A;  3QZS A;  5C8G A;  5A82 A;  2WP2 A;  5LKZ A;  5A5S A;  1E6I A;  4AKN A;  5E9K A;  4HXP A;  5DLX A;  5FE1 A;  5FE9 A;  4N4F A;  5L8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...