4QSVA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) in complex with thymidine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
130
structure length
130
Chain Sequence
b'SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Structure-based approaches towards identification of fragments for the low-druggability ATAD2 bromodomain
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 56
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qsvA00
4RVRA 5EPSA 5L8TA 5FE8A 5LKZA 4NUEA 3QZTA 3FKMX 5IGKA 5FE0A 4CURA 2WP1A 4YADA 5FB1A 4QB3A 4TS8A 4QSQA 5H1VA 3LXJA 4UYFA 3UV2A 3O33A 4MR4A 5DFCA 5F63A 1EQFA 5A82A 3U5NA 1JM4B 4Z1QA 4NR8A 4F3IA 3HMEA 4PCIA 4WIVA 5D3HA 4CFKA 4YH3A 4LYWA 3G0JA 4MR3A 4NQMA 5IGNA 4QC1A 5L8UA 2YEMA 4A9HA 5D3PA 3U5JA 5FE4A 4TT6A 2OO1A 5F61A 4NR4A 5HRWA 3UW9A 4BHWA 4CL9A 3SVGA 4E96A 4ZQLA 4QR3A 4A9IA 5D3SA 5LKXA 2F6NA 2DVQA 5EGUA 5ENFA 4UIYA 5CQ5A 5C7NA 5EPRA 4C67A 5DLXA 5HELA 4TYLA 4PKLA 4A9KA 5E7DA 5D7XA 5DFBA 5DLZA 4A9FA 5A83A 5KU3A 4XUBA 1E6IA 4TZ8A 3U5LA 5D25A 5C89A 5A85A 5E9MA 4PCEA 5DYUA 4TT4A 5II1A 2KTBB 4NYWA 5A5RA 3DAIA 4J0RA 5EWVA 4A9NA 3AQAA 4O72A 3UVYA 3UV5A 3K2JA 4YABA 3AADA 1WUMA 5EU1A 2MJVB 5CGPA 3P1FA 4QSVA 3O35A 4NR6A 5LUUA 4YAXA 5A5QA 5A5PA 5FH6A 4LZSA 4UYEA 4Y03A 4QEUA 5ENHA 5CQ4A 2L5EA 5CZGA 4O7AA 5EP7A 4AKNA 4PY6A 4HXPA 5HRXA 4O77A 4QSRA 5ENBA 4O78A 4O74A 5I7XA 4CLBA 3JVKA 5DKHA 5DX4A 5J0DA 4CUSA 3TLPA 4OGJA 4UIXA 2DVVA 4XUAA 3DWYA 2L85A 5F1LA 2YDWA 4HXOA 5EWDA 3MQMA 5I88A 4QEVA 4LZRA 4Z93A 4TTEA 4LYSA 2N9GA 4HBVA 2GRCA 4IR4A 3HMHA 5BT3A 4YATA 4WHWA 1F68A 5LKUA 4YY6A 5I1QA 4ALGA 2R0VA 2FSAA 4QR4A 4IORA 3HMFA 5KO4A 5FE1A 3IU5A 3QZVA 3U5PA 5BT5A 5AMFA 2DWWA 2YEKA 2DKWA 5D3NA 4YYGA 4NRCA 4HXRA 5G4RA 5ACYA 5FE2A 2E3KA 2I7KA 5D3JA 3RCWA 4QSXA 4TU4A 4NR5A 4HXMA 4NR7A 5IG6A 4QBMA 5I86A 5L96A 4QEWA 5F36A 4A9EA 5CP5A 5EWCA 5FG4A 5CFWA 3U5MA 4HXNA 5DKDA 5CQTA 4FLPA 5CQ3A 4YYNA 5FBXA 5IBNA 4TZ2A 4O7FA 5E9IA 5HQ5A 5F60A 5F2PA 5DYCA 5TB6A 3MB4A 3P1CA 4O70A 4TQNA 2OUOA 3JVMA 4UYHA 5CPEA 5KTUA 4LZ2A 5L99A 5EA1A 4UIWA 4O76A 4WHUA 5F5ZA 5H85A 5FFVA 4NRAA 4XY8A 4NR9A 2DATA 1N72A 5I7YA 4N3WA 4A9JA 3Q2FA 5C4QA 5E73A 3LJWA 5DFDA 5D3TA 5CRZA 4J1PA 5L97A 4QZSA 5FFYA 4A9OA 4UIVA 5FE9A 4O7EA 3MUKA 2E7NA 4YBTA 5LJ1A 3D7CA 3I3JA 5HFQA 4KCXA 4YYJA 4HXKA 5ETBA 4MENA 4C66A 4TU6A 4LR6A 4O75A 4KV4A 5K29A 5HQ6A 3UV4A 3GG3A 2YYNA 1JSPB 2R0SA 4QSSA 5EISA 3ONIA 4QNSA 2RFJA 5F25A 4HBWA 5E74A 5AD3A 4CUPA 5CS8A 4NUDA 3SVFA 4QUUA 5ENJA 4PTBA 5CUAA 5HLSA 3U5OA 4ZC9A 2YQDA 2F6JA 2RI7A 5E9VA 4BW4A 5HENA 4QSUA 3MXFA 3P1DA 5LJ0A 5HFRA 5IIDA 3UVDA 5KTXA 3JVLA 5H1TA 4QC3A 4UITA 5EWWA 5I83A 5F3AA 4CUQA 5HM0A 5L98A 5FE3A 3S91A 5E0RA 4QSWA 5CQ6A 5BT4A 5AD2A 4O7CA 5EICA 5EV9A 5CUBA 4Q0OA 4GPJA 3UVXA 5CQAA 4MEQA 5IGLA 4YBSA 4IOQA 4Z6HA 5CRMA 3IU6A 3P5OA 5II2A 5LVQA 2D9EA 5FFWA 4IR6A 5FE5A 5E9LA 3QZSA 5E9KA 3MB3A 2I8NA 2NXBA 4J0SA 4YY4A 4DONA 5FG5A 5I80A 4IOOA 3Q2EA 5CQ8A 4Z1SA 2E7OA 4LYIA 5DW1A 4CFLA 2R0YA 3LQIA 5EK9A 5C85A 1ZS5A 4YYIA 5HRVA 5A81A 5I89A 2WP2A 4MEPA 5ENGA 4ALHA 5CUGA 4NS5A 5CUCA 5F62A 5CU8A 3S92A 4NRBA 3LQJA 3O36A 4MR6A 4X2IA 5IGMA 5EVAA 4N4IA 5KHMA 3NXBA 4YK0A 5D26A 4YYHA 5JI8A 5KTWA 4A9LA 4BW1A 5A5NA 4UYDA 2OSSA 4HBXA 4QSPA 5CQ7A 5E3DA 5DBMA 2H60A 3SVHA 5HEMA 4XY9A 5COIA 4NXJA 4Z6IA 2RNWA 4NYVA 2DVRA 5ENCA 4QSTA 5G4SA 4NUCA 4QY4A 5TCMA 4HXLA 4ZW1A 2RO1A 4LC2A 4YC9A 5EWHA 5FB0A 5CY9A 5D0CA 4CUUA 4QYLA 4IR5A 4Q0NA 3MULA 5A5SA 4BW3A 1X0JA 5DYAA 5EQ1A 4MEOA 5E3GA 4LRGA 4BJXA 4QUTA 4J3IA 5FE6A 3O34A 3G0LA 4YYKA 5FDZA 4KV1A 3ZYUA 5EPBA 5H1UA 2RS9B 4TT2A 5D24A 5DW2A 5HQ7A 3P1EA 4LDFA 2R10A 3UVWA 2YW5A 3LQHA 5I40A 5AMEA 4YH4A 4UYGA 4N4HA 5I29A 5DY7A 4YYDA 4YYMA 5DKCA 5C8GA 2D82A 4QR5A 4OGIA 4YBMA 1WUGA 5A5OA 2L84A 4N4FA 5ENIA 5LJ2A 5D3RA 5ETDA 2YELA 5FH8A 5FG6A 4UIUA 5FH7A 4O7BA 4UYFB 2RNYA 4XYAA 4IR3A 3JVJA 4O71A 5EM3A 5HJCA 5CTLA 2LSPB 5DYXA 4OUFA 5HCLA 5E9YA 3O37A 4HXSA 4PS5A 4BW2A 4NQNA 5LVRA 4UIZA 5F1HA 4NYXA 4QYDA 3U5KA 4A9MA 2RNXA 5CUEA 5A7CA 5CUDA 5JWMA 4N4GA 2DVSA 5LKTA 5C87A 4CUTA 4MR5A 4HBYA 5EI4A 5ENEA 5FE7A 5D3LA 2G4AA
chains in the Genus database with same CATH superfamily
4RVRA 5EPSA 5L8TA 5FE8A 5LKZA 4NUEA 3QZTA 3FKMX 5IGKA 5FE0A 4CURA 2WP1A 4YADA 5FB1A 4QB3A 4TS8A 4QSQA 5H1VA 3LXJA 4UYFA 3UV2A 3O33A 4AKGA 4MR4A 5DFCA 5F63A 1EQFA 5A82A 3U5NA 1JM4B 4Z1QA 4NR8A 4F3IA 3HMEA 4PCIA 4WIVA 5D3HA 4CFKA 4YH3A 4LYWA 3G0JA 4MR3A 4NQMA 5IGNA 4QC1A 5L8UA 2YEMA 4A9HA 5D3PA 3U5JA 5FE4A 4TT6A 2OO1A 5F61A 3VKGA 4NR4A 5HRWA 3UW9A 4BHWA 4CL9A 3SVGA 4E96A 4ZQLA 4QR3A 4A9IA 5D3SA 5LKXA 2F6NA 2DVQA 5EGUA 5ENFA 4UIYA 5CQ5A 5C7NA 5EPRA 4C67A 5DLXA 5HELA 4TYLA 4PKLA 4A9KA 5E7DA 4AKIA 5D7XA 5DFBA 5DLZA 4A9FA 5A83A 5KU3A 4XUBA 1E6IA 4TZ8A 3U5LA 5D25A 5C89A 5A85A 5E9MA 4PCEA 5DYUA 4TT4A 5II1A 2KTBB 4NYWA 5A5RA 3DAIA 4J0RA 5EWVA 4A9NA 3AQAA 4O72A 3UVYA 3UV5A 3K2JA 4YABA 3AADA 1WUMA 5EU1A 2MJVB 5CGPA 3P1FA 4QSVA 3O35A 4NR6A 3ERRA 5LUUA 4YAXA 5A5QA 5A5PA 5FH6A 3D1BA 3D1DA 4LZSA 4UYEA 4Y03A 4QEUA 5ENHA 5CQ4A 1ZKRA 2L5EA 5CZGA 4O7AA 5EP7A 4AKNA 4PY6A 1PUOA 4HXPA 5HRXA 4O77A 4QSRA 5ENBA 4O78A 4O74A 5I7XA 4CLBA 3JVKA 5DKHA 5DX4A 5J0DA 4CUSA 3TLPA 4OGJA 4UIXA 2DVVA 4XUAA 3DWYA 2L85A 5F1LA 2YDWA 4HXOA 5EWDA 3MQMA 5I88A 4QEVA 4LZRA 4TTEA 4Z93A 4LYSA 2N9GA 4HBVA 2GRCA 4IR4A 3HMHA 5BT3A 4YATA 4WHWA 1F68A 5LKUA 4YY6A 5I1QA 4ALGA 2R0VA 2FSAA 4QR4A 4IORA 3HMFA 5KO4A 5FE1A 3IU5A 3QZVA 3U5PA 5BT5A 5AMFA 2DWWA 2YEKA 2DKWA 5D3NA 4YYGA 4NRCA 4HXRA 5G4RA 5ACYA 5FE2A 2E3KA 2I7KA 5D3JA 3RCWA 4QSXA 4TU4A 4NR5A 4HXMA 4NR7A 5IG6A 4QBMA 5I86A 5L96A 4QEWA 5F36A 4A9EA 5CP5A 5EWCA 5FG4A 5CFWA 3U5MA 4HXNA 5DKDA 5CQTA 4FLPA 5CQ3A 4YYNA 5FBXA 5IBNA 4TZ2A 4O7FA 5E9IA 5HQ5A 5F60A 5F2PA 5DYCA 5TB6A 3MB4A 4AKHA 3P1CA 4O70A 4TQNA 2OUOA 3JVMA 4UYHA 5CPEA 5KTUA 4LZ2A 5L99A 5EA1A 4UIWA 4O76A 4WHUA 5F5ZA 5H85A 5FFVA 4NRAA 4XY8A 4NR9A 2DATA 1N72A 5I7YA 4N3WA 4A9JA 3Q2FA 5C4QA 5E73A 3LJWA 5DFDA 5D3TA 5CRZA 4J1PA 5L97A 4QZSA 5FFYA 4A9OA 4UIVA 5FE9A 4O7EA 3MUKA 2E7NA 4YBTA 5LJ1A 3D7CA 3I3JA 5HFQA 3VKHA 4KCXA 4YYJA 4HXKA 5ETBA 4MENA 4C66A 4TU6A 4LR6A 4O75A 4KV4A 5K29A 5HQ6A 3UV4A 3GG3A 2YYNA 1JSPB 2R0SA 4QSSA 5EISA 3ONIA 4QNSA 2RFJA 5F25A 4HBWA 5E74A 5AD3A 4CUPA 5CS8A 4NUDA 3SVFA 4QUUA 5ENJA 4PTBA 5CUAA 5HLSA 3U5OA 4ZC9A 2YQDA 2RI7A 2F6JA 5E9VA 4BW4A 5HENA 4QSUA 3MXFA 3P1DA 5LJ0A 5HFRA 5IIDA 3UVDA 5KTXA 3JVLA 5H1TA 4QC3A 4UITA 5EWWA 5I83A 5F3AA 4CUQA 5HM0A 5L98A 5FE3A 3S91A 5E0RA 4QSWA 5CQ6A 5BT4A 5AD2A 4O7CA 5EICA 5EV9A 5CUBA 4Q0OA 4GPJA 2EJNA 3UVXA 5CQAA 4MEQA 5IGLA 4YBSA 4IOQA 4Z6HA 5CRMA 3IU6A 3P5OA 5II2A 5LVQA 2D9EA 5FFWA 4IR6A 5FE5A 5E9LA 3QZSA 5E9KA 3MB3A 2I8NA 2NXBA 4J0SA 4YY4A 4DONA 5FG5A 5I80A 4IOOA 3Q2EA 5CQ8A 4Z1SA 2E7OA 4LYIA 5DW1A 4CFLA 2R0YA 3LQIA 5EK9A 5C85A 1ZS5A 4YYIA 5HRVA 5A81A 5I89A 2WP2A 4MEPA 5ENGA 4ALHA 5CUGA 4NS5A 5CUCA 5F62A 5CU8A 3S92A 4NRBA 3LQJA 3O36A 4MR6A 4X2IA 5IGMA 5EVAA 4N4IA 5KHMA 3NXBA 4YK0A 5D26A 4YYHA 5JI8A 5KTWA 4A9LA 4BW1A 5A5NA 4UYDA 2OSSA 4HBXA 4QSPA 5CQ7A 5E3DA 5DBMA 2H60A 3SVHA 5HEMA 4XY9A 5COIA 4NXJA 4Z6IA 2RNWA 4NYVA 2DVRA 5ENCA 4QSTA 5G4SA 4NUCA 4QY4A 5TCMA 4HXLA 4ZW1A 2RO1A 4LC2A 4YC9A 5EWHA 5FB0A 5CY9A 5D0CA 4CUUA 4QYLA 4IR5A 4Q0NA 3MULA 5A5SA 4BW3A 1X0JA 5DYAA 5EQ1A 4MEOA 5E3GA 4LRGA 4BJXA 4QUTA 4J3IA 5FE6A 3O34A 3G0LA 4YYKA 5FDZA 4KV1A 3ZYUA 5EPBA 5H1UA 2RS9B 4TT2A 5D24A 5DW2A 5HQ7A 3P1EA 4LDFA 2R10A 3UVWA 2YW5A 3LQHA 5I40A 5AMEA 4YH4A 4UYGA 4N4HA 5I29A 5DY7A 4YYDA 4YYMA 5DKCA 5C8GA 2D82A 4QR5A 4OGIA 4YBMA 1WUGA 5A5OA 2L84A 4N4FA 5ENIA 5LJ2A 5D3RA 5ETDA 2YELA 5FH8A 5FG6A 4UIUA 5FH7A 4O7BA 4UYFB 2RNYA 4XYAA 4IR3A 3JVJA 4O71A 5EM3A 5HJCA 5CTLA 2LSPB 5DYXA 4OUFA 5HCLA 5E9YA 3O37A 4HXSA 4PS5A 4BW2A 4NQNA 5LVRA 4UIZA 5F1HA 4NYXA 4QYDA 3U5KA 4A9MA 2RNXA 5CUEA 5A7CA 5CUDA 5JWMA 4N4GA 2DVSA 5LKTA 5C87A 4CUTA 4MR5A 4HBYA 5EI4A 5ENEA 5FE7A 4AI6A 5D3LA 2G4AA
chains in the Genus database with same CATH topology
4RVRA 5EPSA 5L8TA 5FE8A 5LKZA 4NUEA 3QZTA 3FKMX 5IGKA 5FE0A 4CURA 2WP1A 4YADA 5FB1A 4QB3A 4TS8A 4QSQA 5H1VA 3LXJA 4UYFA 3UV2A 3O33A 4MR4A 5DFCA 5F63A 1EQFA 5A82A 3U5NA 1JM4B 4Z1QA 4NR8A 4F3IA 3HMEA 4PCIA 4WIVA 5D3HA 4CFKA 4YH3A 4LYWA 3G0JA 4MR3A 4NQMA 5IGNA 4QC1A 5L8UA 2YEMA 4A9HA 5D3PA 3U5JA 5FE4A 4TT6A 2OO1A 5F61A 4NR4A 5HRWA 3UW9A 4BHWA 4CL9A 3SVGA 4E96A 4ZQLA 4QR3A 4A9IA 5D3SA 5LKXA 2F6NA 2DVQA 5EGUA 5ENFA 4UIYA 5CQ5A 5C7NA 5EPRA 4C67A 5DLXA 5HELA 4TYLA 4PKLA 4A9KA 5E7DA 5D7XA 5DFBA 5DLZA 4A9FA 5A83A 5KU3A 4XUBA 1E6IA 4TZ8A 3U5LA 5D25A 5C89A 5A85A 5E9MA 4PCEA 5DYUA 4TT4A 5II1A 2KTBB 4NYWA 5A5RA 3DAIA 4J0RA 5EWVA 4A9NA 3AQAA 4O72A 3UVYA 3UV5A 3K2JA 4YABA 3AADA 1WUMA 5EU1A 2MJVB 5CGPA 3P1FA 4QSVA 3O35A 4NR6A 5LUUA 4YAXA 5A5QA 5A5PA 5FH6A 4LZSA 4UYEA 4Y03A 4QEUA 5ENHA 5CQ4A 2L5EA 5CZGA 4O7AA 5EP7A 4AKNA 4PY6A 4HXPA 5HRXA 4O77A 4QSRA 5ENBA 4O78A 4O74A 5I7XA 4CLBA 3JVKA 5DKHA 5DX4A 5J0DA 4CUSA 3TLPA 4OGJA 4UIXA 2DVVA 4XUAA 3DWYA 2L85A 5F1LA 2YDWA 4HXOA 5EWDA 3MQMA 5I88A 4QEVA 4LZRA 4Z93A 4TTEA 4LYSA 2N9GA 4HBVA 2GRCA 4IR4A 3HMHA 5BT3A 4YATA 4WHWA 1F68A 5LKUA 4YY6A 5I1QA 4ALGA 2R0VA 2FSAA 4QR4A 4IORA 3HMFA 5KO4A 5FE1A 3IU5A 3QZVA 3U5PA 5BT5A 5AMFA 2DWWA 2YEKA 2DKWA 5D3NA 4YYGA 4NRCA 4HXRA 5G4RA 5ACYA 5FE2A 2E3KA 2I7KA 5D3JA 3RCWA 4QSXA 4TU4A 4NR5A 4HXMA 4NR7A 5IG6A 4QBMA 5I86A 5L96A 4QEWA 5F36A 4A9EA 5CP5A 5EWCA 5FG4A 5CFWA 3U5MA 4HXNA 5DKDA 5CQTA 4FLPA 5CQ3A 4YYNA 5FBXA 5IBNA 4TZ2A 4O7FA 5E9IA 5HQ5A 5F60A 5F2PA 5DYCA 5TB6A 3MB4A 3P1CA 4O70A 4TQNA 2OUOA 3JVMA 4UYHA 5CPEA 5KTUA 4LZ2A 5L99A 5EA1A 4UIWA 4O76A 4WHUA 5F5ZA 5H85A 5FFVA 4NRAA 4XY8A 4NR9A 2DATA 1N72A 5I7YA 4N3WA 4A9JA 3Q2FA 5C4QA 5E73A 3LJWA 5DFDA 5D3TA 5CRZA 4J1PA 5L97A 4QZSA 5FFYA 4A9OA 4UIVA 5FE9A 4O7EA 3MUKA 2E7NA 4YBTA 5LJ1A 3D7CA 3I3JA 5HFQA 4KCXA 4YYJA 4HXKA 5ETBA 4MENA 4C66A 4TU6A 4LR6A 4O75A 4KV4A 5K29A 5HQ6A 3UV4A 3GG3A 2YYNA 1JSPB 2R0SA 4QSSA 5EISA 3ONIA 4QNSA 2RFJA 5F25A 4HBWA 5E74A 5AD3A 4CUPA 5CS8A 4NUDA 3SVFA 4QUUA 5ENJA 4PTBA 5CUAA 5HLSA 3U5OA 4ZC9A 2YQDA 2F6JA 2RI7A 5E9VA 4BW4A 5HENA 4QSUA 3MXFA 3P1DA 5LJ0A 5HFRA 5IIDA 3UVDA 5KTXA 3JVLA 5H1TA 4QC3A 4UITA 5EWWA 5I83A 5F3AA 4CUQA 5HM0A 5L98A 5FE3A 3S91A 5E0RA 4QSWA 5CQ6A 5BT4A 5AD2A 4O7CA 5EICA 5EV9A 5CUBA 4Q0OA 4GPJA 3UVXA 5CQAA 4MEQA 5IGLA 4YBSA 4IOQA 4Z6HA 5CRMA 3IU6A 3P5OA 5II2A 5LVQA 2D9EA 5FFWA 4IR6A 5FE5A 5E9LA 3QZSA 5E9KA 3MB3A 2I8NA 2NXBA 4J0SA 4YY4A 4DONA 5FG5A 5I80A 4IOOA 3Q2EA 5CQ8A 4Z1SA 2E7OA 4LYIA 5DW1A 4CFLA 2R0YA 3LQIA 5EK9A 5C85A 1ZS5A 4YYIA 5HRVA 5A81A 5I89A 2WP2A 4MEPA 5ENGA 4ALHA 5CUGA 4NS5A 5CUCA 5F62A 5CU8A 3S92A 4NRBA 3LQJA 3O36A 4MR6A 4X2IA 5IGMA 5EVAA 4N4IA 5KHMA 3NXBA 4YK0A 5D26A 4YYHA 5JI8A 5KTWA 4A9LA 4BW1A 5A5NA 4UYDA 2OSSA 4HBXA 4QSPA 5CQ7A 5E3DA 5DBMA 2H60A 3SVHA 5HEMA 4XY9A 5COIA 4NXJA 4Z6IA 2RNWA 4NYVA 2DVRA 5ENCA 4QSTA 5G4SA 4NUCA 4QY4A 5TCMA 4HXLA 4ZW1A 2RO1A 4LC2A 4YC9A 5EWHA 5FB0A 5CY9A 5D0CA 4CUUA 4QYLA 4IR5A 4Q0NA 3MULA 5A5SA 4BW3A 1X0JA 5DYAA 5EQ1A 4MEOA 5E3GA 4LRGA 4BJXA 4QUTA 4J3IA 5FE6A 3O34A 3G0LA 4YYKA 5FDZA 4KV1A 3ZYUA 5EPBA 5H1UA 2RS9B 4TT2A 5D24A 5DW2A 5HQ7A 3P1EA 4LDFA 2R10A 3UVWA 2YW5A 3LQHA 5I40A 5AMEA 4YH4A 4UYGA 4N4HA 5I29A 5DY7A 4YYDA 4YYMA 5DKCA 5C8GA 2D82A 4QR5A 4OGIA 4YBMA 1WUGA 5A5OA 2L84A 4N4FA 5ENIA 5LJ2A 5D3RA 5ETDA 2YELA 5FH8A 5FG6A 4UIUA 5FH7A 4O7BA 4UYFB 2RNYA 4XYAA 4IR3A 3JVJA 4O71A 5EM3A 5HJCA 5CTLA 2LSPB 5DYXA 4OUFA 5HCLA 5E9YA 3O37A 4HXSA 4PS5A 4BW2A 4NQNA 5LVRA 4UIZA 5F1HA 4NYXA 4QYDA 3U5KA 4A9MA 2RNXA 5CUEA 5A7CA 5CUDA 5JWMA 4N4GA 2DVSA 5LKTA 5C87A 4CUTA 4MR5A 4HBYA 5EI4A 5ENEA 5FE7A 5D3LA 2G4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RVR A;  5EPS A;  5L8T A;  5FE8 A;  5LKZ A;  4NUE A;  3QZT A;  3FKM X;  5IGK A;  5FE0 A;  4CUR A;  2WP1 A;  4YAD A;  5FB1 A;  4QB3 A;  4TS8 A;  4QSQ A;  5H1V A;  3LXJ A;  4UYF A;  3UV2 A;  3O33 A;  4MR4 A;  5DFC A;  5F63 A;  1EQF A;  5A82 A;  3U5N A;  1JM4 B;  4Z1Q A;  4NR8 A;  4F3I A;  3HME A;  4PCI A;  4WIV A;  5D3H A;  4CFK A;  4YH3 A;  4LYW A;  3G0J A;  4MR3 A;  4NQM A;  5IGN A;  4QC1 A;  5L8U A;  2YEM A;  4A9H A;  5D3P A;  3U5J A;  5FE4 A;  4TT6 A;  2OO1 A;  5F61 A;  4NR4 A;  5HRW A;  3UW9 A;  4BHW A;  4CL9 A;  3SVG A;  4E96 A;  4ZQL A;  4QR3 A;  4A9I A;  5D3S A;  5LKX A;  2F6N A;  2DVQ A;  5EGU A;  5ENF A;  4UIY A;  5CQ5 A;  5C7N A;  5EPR A;  4C67 A;  5DLX A;  5HEL A;  4TYL A;  4PKL A;  4A9K A;  5E7D A;  5D7X A;  5DFB A;  5DLZ A;  4A9F A;  5A83 A;  5KU3 A;  4XUB A;  1E6I A;  4TZ8 A;  3U5L A;  5D25 A;  5C89 A;  5A85 A;  5E9M A;  4PCE A;  5DYU A;  4TT4 A;  5II1 A;  2KTB B;  4NYW A;  5A5R A;  3DAI A;  4J0R A;  5EWV A;  4A9N A;  3AQA A;  4O72 A;  3UVY A;  3UV5 A;  3K2J A;  4YAB A;  3AAD A;  1WUM A;  5EU1 A;  2MJV B;  5CGP A;  3P1F A;  4QSV A;  3O35 A;  4NR6 A;  5LUU A;  4YAX A;  5A5Q A;  5A5P A;  5FH6 A;  4LZS A;  4UYE A;  4Y03 A;  4QEU A;  5ENH A;  5CQ4 A;  2L5E A;  5CZG A;  4O7A A;  5EP7 A;  4AKN A;  4PY6 A;  4HXP A;  5HRX A;  4O77 A;  4QSR A;  5ENB A;  4O78 A;  4O74 A;  5I7X A;  4CLB A;  3JVK A;  5DKH A;  5DX4 A;  5J0D A;  4CUS A;  3TLP A;  4OGJ A;  4UIX A;  2DVV A;  4XUA A;  3DWY A;  2L85 A;  5F1L A;  2YDW A;  4HXO A;  5EWD A;  3MQM A;  5I88 A;  4QEV A;  4LZR A;  4Z93 A;  4TTE A;  4LYS A;  2N9G A;  4HBV A;  2GRC A;  4IR4 A;  3HMH A;  5BT3 A;  4YAT A;  4WHW A;  1F68 A;  5LKU A;  4YY6 A;  5I1Q A;  4ALG A;  2R0V A;  2FSA A;  4QR4 A;  4IOR A;  3HMF A;  5KO4 A;  5FE1 A;  3IU5 A;  3QZV A;  3U5P A;  5BT5 A;  5AMF A;  2DWW A;  2YEK A;  2DKW A;  5D3N A;  4YYG A;  4NRC A;  4HXR A;  5G4R A;  5ACY A;  5FE2 A;  2E3K A;  2I7K A;  5D3J A;  3RCW A;  4QSX A;  4TU4 A;  4NR5 A;  4HXM A;  4NR7 A;  5IG6 A;  4QBM A;  5I86 A;  5L96 A;  4QEW A;  5F36 A;  4A9E A;  5CP5 A;  5EWC A;  5FG4 A;  5CFW A;  3U5M A;  4HXN A;  5DKD A;  5CQT A;  4FLP A;  5CQ3 A;  4YYN A;  5FBX A;  5IBN A;  4TZ2 A;  4O7F A;  5E9I A;  5HQ5 A;  5F60 A;  5F2P A;  5DYC A;  5TB6 A;  3MB4 A;  3P1C A;  4O70 A;  4TQN A;  2OUO A;  3JVM A;  4UYH A;  5CPE A;  5KTU A;  4LZ2 A;  5L99 A;  5EA1 A;  4UIW A;  4O76 A;  4WHU A;  5F5Z A;  5H85 A;  5FFV A;  4NRA A;  4XY8 A;  4NR9 A;  2DAT A;  1N72 A;  5I7Y A;  4N3W A;  4A9J A;  3Q2F A;  5C4Q A;  5E73 A;  3LJW A;  5DFD A;  5D3T A;  5CRZ A;  4J1P A;  5L97 A;  4QZS A;  5FFY A;  4A9O A;  4UIV A;  5FE9 A;  4O7E A;  3MUK A;  2E7N A;  4YBT A;  5LJ1 A;  3D7C A;  3I3J A;  5HFQ A;  4KCX A;  4YYJ A;  4HXK A;  5ETB A;  4MEN A;  4C66 A;  4TU6 A;  4LR6 A;  4O75 A;  4KV4 A;  5K29 A;  5HQ6 A;  3UV4 A;  3GG3 A;  2YYN A;  1JSP B;  2R0S A;  4QSS A;  5EIS A;  3ONI A;  4QNS A;  2RFJ A;  5F25 A;  4HBW A;  5E74 A;  5AD3 A;  4CUP A;  5CS8 A;  4NUD A;  3SVF A;  4QUU A;  5ENJ A;  4PTB A;  5CUA A;  5HLS A;  3U5O A;  4ZC9 A;  2YQD A;  2F6J A;  2RI7 A;  5E9V A;  4BW4 A;  5HEN A;  4QSU A;  3MXF A;  3P1D A;  5LJ0 A;  5HFR A;  5IID A;  3UVD A;  5KTX A;  3JVL A;  5H1T A;  4QC3 A;  4UIT A;  5EWW A;  5I83 A;  5F3A A;  4CUQ A;  5HM0 A;  5L98 A;  5FE3 A;  3S91 A;  5E0R A;  4QSW A;  5CQ6 A;  5BT4 A;  5AD2 A;  4O7C A;  5EIC A;  5EV9 A;  5CUB A;  4Q0O A;  4GPJ A;  3UVX A;  5CQA A;  4MEQ A;  5IGL A;  4YBS A;  4IOQ A;  4Z6H A;  5CRM A;  3IU6 A;  3P5O A;  5II2 A;  5LVQ A;  2D9E A;  5FFW A;  4IR6 A;  5FE5 A;  5E9L A;  3QZS A;  5E9K A;  3MB3 A;  2I8N A;  2NXB A;  4J0S A;  4YY4 A;  4DON A;  5FG5 A;  5I80 A;  4IOO A;  3Q2E A;  5CQ8 A;  4Z1S A;  2E7O A;  4LYI A;  5DW1 A;  4CFL A;  2R0Y A;  3LQI A;  5EK9 A;  5C85 A;  1ZS5 A;  4YYI A;  5HRV A;  5A81 A;  5I89 A;  2WP2 A;  4MEP A;  5ENG A;  4ALH A;  5CUG A;  4NS5 A;  5CUC A;  5F62 A;  5CU8 A;  3S92 A;  4NRB A;  3LQJ A;  3O36 A;  4MR6 A;  4X2I A;  5IGM A;  5EVA A;  4N4I A;  5KHM A;  3NXB A;  4YK0 A;  5D26 A;  4YYH A;  5JI8 A;  5KTW A;  4A9L A;  4BW1 A;  5A5N A;  4UYD A;  2OSS A;  4HBX A;  4QSP A;  5CQ7 A;  5E3D A;  5DBM A;  2H60 A;  3SVH A;  5HEM A;  4XY9 A;  5COI A;  4NXJ A;  4Z6I A;  2RNW A;  4NYV A;  2DVR A;  5ENC A;  4QST A;  5G4S A;  4NUC A;  4QY4 A;  5TCM A;  4HXL A;  4ZW1 A;  2RO1 A;  4LC2 A;  4YC9 A;  5EWH A;  5FB0 A;  5CY9 A;  5D0C A;  4CUU A;  4QYL A;  4IR5 A;  4Q0N A;  3MUL A;  5A5S A;  4BW3 A;  1X0J A;  5DYA A;  5EQ1 A;  4MEO A;  5E3G A;  4LRG A;  4BJX A;  4QUT A;  4J3I A;  5FE6 A;  3O34 A;  3G0L A;  4YYK A;  5FDZ A;  4KV1 A;  3ZYU A;  5EPB A;  5H1U A;  2RS9 B;  4TT2 A;  5D24 A;  5DW2 A;  5HQ7 A;  3P1E A;  4LDF A;  2R10 A;  3UVW A;  2YW5 A;  3LQH A;  5I40 A;  5AME A;  4YH4 A;  4UYG A;  4N4H A;  5I29 A;  5DY7 A;  4YYD A;  4YYM A;  5DKC A;  5C8G A;  2D82 A;  4QR5 A;  4OGI A;  4YBM A;  1WUG A;  5A5O A;  2L84 A;  4N4F A;  5ENI A;  5LJ2 A;  5D3R A;  5ETD A;  2YEL A;  5FH8 A;  5FG6 A;  4UIU A;  5FH7 A;  4O7B A;  4UYF B;  2RNY A;  4XYA A;  4IR3 A;  3JVJ A;  4O71 A;  5EM3 A;  5HJC A;  5CTL A;  2LSP B;  5DYX A;  4OUF A;  5HCL A;  5E9Y A;  3O37 A;  4HXS A;  4PS5 A;  4BW2 A;  4NQN A;  5LVR A;  4UIZ A;  5F1H A;  4NYX A;  4QYD A;  3U5K A;  4A9M A;  2RNX A;  5CUE A;  5A7C A;  5CUD A;  5JWM A;  4N4G A;  2DVS A;  5LKT A;  5C87 A;  4CUT A;  4MR5 A;  4HBY A;  5EI4 A;  5ENE A;  5FE7 A;  5D3L A;  2G4A A; 
#chains in the Genus database with same CATH topology
 4RVR A;  5EPS A;  5L8T A;  5FE8 A;  5LKZ A;  4NUE A;  3QZT A;  3FKM X;  5IGK A;  5FE0 A;  4CUR A;  2WP1 A;  4YAD A;  5FB1 A;  4QB3 A;  4TS8 A;  4QSQ A;  5H1V A;  3LXJ A;  4UYF A;  3UV2 A;  3O33 A;  4AKG A;  4MR4 A;  5DFC A;  5F63 A;  1EQF A;  5A82 A;  3U5N A;  1JM4 B;  4Z1Q A;  4NR8 A;  4F3I A;  3HME A;  4PCI A;  4WIV A;  5D3H A;  4CFK A;  4YH3 A;  4LYW A;  3G0J A;  4MR3 A;  4NQM A;  5IGN A;  4QC1 A;  5L8U A;  2YEM A;  4A9H A;  5D3P A;  3U5J A;  5FE4 A;  4TT6 A;  2OO1 A;  5F61 A;  3VKG A;  4NR4 A;  5HRW A;  3UW9 A;  4BHW A;  4CL9 A;  3SVG A;  4E96 A;  4ZQL A;  4QR3 A;  4A9I A;  5D3S A;  5LKX A;  2F6N A;  2DVQ A;  5EGU A;  5ENF A;  4UIY A;  5CQ5 A;  5C7N A;  5EPR A;  4C67 A;  5DLX A;  5HEL A;  4TYL A;  4PKL A;  4A9K A;  5E7D A;  4AKI A;  5D7X A;  5DFB A;  5DLZ A;  4A9F A;  5A83 A;  5KU3 A;  4XUB A;  1E6I A;  4TZ8 A;  3U5L A;  5D25 A;  5C89 A;  5A85 A;  5E9M A;  4PCE A;  5DYU A;  4TT4 A;  5II1 A;  2KTB B;  4NYW A;  5A5R A;  3DAI A;  4J0R A;  5EWV A;  4A9N A;  3AQA A;  4O72 A;  3UVY A;  3UV5 A;  3K2J A;  4YAB A;  3AAD A;  1WUM A;  5EU1 A;  2MJV B;  5CGP A;  3P1F A;  4QSV A;  3O35 A;  4NR6 A;  3ERR A;  5LUU A;  4YAX A;  5A5Q A;  5A5P A;  5FH6 A;  3D1B A;  3D1D A;  4LZS A;  4UYE A;  4Y03 A;  4QEU A;  5ENH A;  5CQ4 A;  1ZKR A;  2L5E A;  5CZG A;  4O7A A;  5EP7 A;  4AKN A;  4PY6 A;  1PUO A;  4HXP A;  5HRX A;  4O77 A;  4QSR A;  5ENB A;  4O78 A;  4O74 A;  5I7X A;  4CLB A;  3JVK A;  5DKH A;  5DX4 A;  5J0D A;  4CUS A;  3TLP A;  4OGJ A;  4UIX A;  2DVV A;  4XUA A;  3DWY A;  2L85 A;  5F1L A;  2YDW A;  4HXO A;  5EWD A;  3MQM A;  5I88 A;  4QEV A;  4LZR A;  4TTE A;  4Z93 A;  4LYS A;  2N9G A;  4HBV A;  2GRC A;  4IR4 A;  3HMH A;  5BT3 A;  4YAT A;  4WHW A;  1F68 A;  5LKU A;  4YY6 A;  5I1Q A;  4ALG A;  2R0V A;  2FSA A;  4QR4 A;  4IOR A;  3HMF A;  5KO4 A;  5FE1 A;  3IU5 A;  3QZV A;  3U5P A;  5BT5 A;  5AMF A;  2DWW A;  2YEK A;  2DKW A;  5D3N A;  4YYG A;  4NRC A;  4HXR A;  5G4R A;  5ACY A;  5FE2 A;  2E3K A;  2I7K A;  5D3J A;  3RCW A;  4QSX A;  4TU4 A;  4NR5 A;  4HXM A;  4NR7 A;  5IG6 A;  4QBM A;  5I86 A;  5L96 A;  4QEW A;  5F36 A;  4A9E A;  5CP5 A;  5EWC A;  5FG4 A;  5CFW A;  3U5M A;  4HXN A;  5DKD A;  5CQT A;  4FLP A;  5CQ3 A;  4YYN A;  5FBX A;  5IBN A;  4TZ2 A;  4O7F A;  5E9I A;  5HQ5 A;  5F60 A;  5F2P A;  5DYC A;  5TB6 A;  3MB4 A;  4AKH A;  3P1C A;  4O70 A;  4TQN A;  2OUO A;  3JVM A;  4UYH A;  5CPE A;  5KTU A;  4LZ2 A;  5L99 A;  5EA1 A;  4UIW A;  4O76 A;  4WHU A;  5F5Z A;  5H85 A;  5FFV A;  4NRA A;  4XY8 A;  4NR9 A;  2DAT A;  1N72 A;  5I7Y A;  4N3W A;  4A9J A;  3Q2F A;  5C4Q A;  5E73 A;  3LJW A;  5DFD A;  5D3T A;  5CRZ A;  4J1P A;  5L97 A;  4QZS A;  5FFY A;  4A9O A;  4UIV A;  5FE9 A;  4O7E A;  3MUK A;  2E7N A;  4YBT A;  5LJ1 A;  3D7C A;  3I3J A;  5HFQ A;  3VKH A;  4KCX A;  4YYJ A;  4HXK A;  5ETB A;  4MEN A;  4C66 A;  4TU6 A;  4LR6 A;  4O75 A;  4KV4 A;  5K29 A;  5HQ6 A;  3UV4 A;  3GG3 A;  2YYN A;  1JSP B;  2R0S A;  4QSS A;  5EIS A;  3ONI A;  4QNS A;  2RFJ A;  5F25 A;  4HBW A;  5E74 A;  5AD3 A;  4CUP A;  5CS8 A;  4NUD A;  3SVF A;  4QUU A;  5ENJ A;  4PTB A;  5CUA A;  5HLS A;  3U5O A;  4ZC9 A;  2YQD A;  2RI7 A;  2F6J A;  5E9V A;  4BW4 A;  5HEN A;  4QSU A;  3MXF A;  3P1D A;  5LJ0 A;  5HFR A;  5IID A;  3UVD A;  5KTX A;  3JVL A;  5H1T A;  4QC3 A;  4UIT A;  5EWW A;  5I83 A;  5F3A A;  4CUQ A;  5HM0 A;  5L98 A;  5FE3 A;  3S91 A;  5E0R A;  4QSW A;  5CQ6 A;  5BT4 A;  5AD2 A;  4O7C A;  5EIC A;  5EV9 A;  5CUB A;  4Q0O A;  4GPJ A;  2EJN A;  3UVX A;  5CQA A;  4MEQ A;  5IGL A;  4YBS A;  4IOQ A;  4Z6H A;  5CRM A;  3IU6 A;  3P5O A;  5II2 A;  5LVQ A;  2D9E A;  5FFW A;  4IR6 A;  5FE5 A;  5E9L A;  3QZS A;  5E9K A;  3MB3 A;  2I8N A;  2NXB A;  4J0S A;  4YY4 A;  4DON A;  5FG5 A;  5I80 A;  4IOO A;  3Q2E A;  5CQ8 A;  4Z1S A;  2E7O A;  4LYI A;  5DW1 A;  4CFL A;  2R0Y A;  3LQI A;  5EK9 A;  5C85 A;  1ZS5 A;  4YYI A;  5HRV A;  5A81 A;  5I89 A;  2WP2 A;  4MEP A;  5ENG A;  4ALH A;  5CUG A;  4NS5 A;  5CUC A;  5F62 A;  5CU8 A;  3S92 A;  4NRB A;  3LQJ A;  3O36 A;  4MR6 A;  4X2I A;  5IGM A;  5EVA A;  4N4I A;  5KHM A;  3NXB A;  4YK0 A;  5D26 A;  4YYH A;  5JI8 A;  5KTW A;  4A9L A;  4BW1 A;  5A5N A;  4UYD A;  2OSS A;  4HBX A;  4QSP A;  5CQ7 A;  5E3D A;  5DBM A;  2H60 A;  3SVH A;  5HEM A;  4XY9 A;  5COI A;  4NXJ A;  4Z6I A;  2RNW A;  4NYV A;  2DVR A;  5ENC A;  4QST A;  5G4S A;  4NUC A;  4QY4 A;  5TCM A;  4HXL A;  4ZW1 A;  2RO1 A;  4LC2 A;  4YC9 A;  5EWH A;  5FB0 A;  5CY9 A;  5D0C A;  4CUU A;  4QYL A;  4IR5 A;  4Q0N A;  3MUL A;  5A5S A;  4BW3 A;  1X0J A;  5DYA A;  5EQ1 A;  4MEO A;  5E3G A;  4LRG A;  4BJX A;  4QUT A;  4J3I A;  5FE6 A;  3O34 A;  3G0L A;  4YYK A;  5FDZ A;  4KV1 A;  3ZYU A;  5EPB A;  5H1U A;  2RS9 B;  4TT2 A;  5D24 A;  5DW2 A;  5HQ7 A;  3P1E A;  4LDF A;  2R10 A;  3UVW A;  2YW5 A;  3LQH A;  5I40 A;  5AME A;  4YH4 A;  4UYG A;  4N4H A;  5I29 A;  5DY7 A;  4YYD A;  4YYM A;  5DKC A;  5C8G A;  2D82 A;  4QR5 A;  4OGI A;  4YBM A;  1WUG A;  5A5O A;  2L84 A;  4N4F A;  5ENI A;  5LJ2 A;  5D3R A;  5ETD A;  2YEL A;  5FH8 A;  5FG6 A;  4UIU A;  5FH7 A;  4O7B A;  4UYF B;  2RNY A;  4XYA A;  4IR3 A;  3JVJ A;  4O71 A;  5EM3 A;  5HJC A;  5CTL A;  2LSP B;  5DYX A;  4OUF A;  5HCL A;  5E9Y A;  3O37 A;  4HXS A;  4PS5 A;  4BW2 A;  4NQN A;  5LVR A;  4UIZ A;  5F1H A;  4NYX A;  4QYD A;  3U5K A;  4A9M A;  2RNX A;  5CUE A;  5A7C A;  5CUD A;  5JWM A;  4N4G A;  2DVS A;  5LKT A;  5C87 A;  4CUT A;  4MR5 A;  4HBY A;  5EI4 A;  5ENE A;  5FE7 A;  4AI6 A;  5D3L A;  2G4A A; 
#chains in the Genus database with same CATH homology
 4RVR A;  5EPS A;  5L8T A;  5FE8 A;  5LKZ A;  4NUE A;  3QZT A;  3FKM X;  5IGK A;  5FE0 A;  4CUR A;  2WP1 A;  4YAD A;  5FB1 A;  4QB3 A;  4TS8 A;  4QSQ A;  5H1V A;  3LXJ A;  4UYF A;  3UV2 A;  3O33 A;  4MR4 A;  5DFC A;  5F63 A;  1EQF A;  5A82 A;  3U5N A;  1JM4 B;  4Z1Q A;  4NR8 A;  4F3I A;  3HME A;  4PCI A;  4WIV A;  5D3H A;  4CFK A;  4YH3 A;  4LYW A;  3G0J A;  4MR3 A;  4NQM A;  5IGN A;  4QC1 A;  5L8U A;  2YEM A;  4A9H A;  5D3P A;  3U5J A;  5FE4 A;  4TT6 A;  2OO1 A;  5F61 A;  4NR4 A;  5HRW A;  3UW9 A;  4BHW A;  4CL9 A;  3SVG A;  4E96 A;  4ZQL A;  4QR3 A;  4A9I A;  5D3S A;  5LKX A;  2F6N A;  2DVQ A;  5EGU A;  5ENF A;  4UIY A;  5CQ5 A;  5C7N A;  5EPR A;  4C67 A;  5DLX A;  5HEL A;  4TYL A;  4PKL A;  4A9K A;  5E7D A;  5D7X A;  5DFB A;  5DLZ A;  4A9F A;  5A83 A;  5KU3 A;  4XUB A;  1E6I A;  4TZ8 A;  3U5L A;  5D25 A;  5C89 A;  5A85 A;  5E9M A;  4PCE A;  5DYU A;  4TT4 A;  5II1 A;  2KTB B;  4NYW A;  5A5R A;  3DAI A;  4J0R A;  5EWV A;  4A9N A;  3AQA A;  4O72 A;  3UVY A;  3UV5 A;  3K2J A;  4YAB A;  3AAD A;  1WUM A;  5EU1 A;  2MJV B;  5CGP A;  3P1F A;  4QSV A;  3O35 A;  4NR6 A;  5LUU A;  4YAX A;  5A5Q A;  5A5P A;  5FH6 A;  4LZS A;  4UYE A;  4Y03 A;  4QEU A;  5ENH A;  5CQ4 A;  2L5E A;  5CZG A;  4O7A A;  5EP7 A;  4AKN A;  4PY6 A;  4HXP A;  5HRX A;  4O77 A;  4QSR A;  5ENB A;  4O78 A;  4O74 A;  5I7X A;  4CLB A;  3JVK A;  5DKH A;  5DX4 A;  5J0D A;  4CUS A;  3TLP A;  4OGJ A;  4UIX A;  2DVV A;  4XUA A;  3DWY A;  2L85 A;  5F1L A;  2YDW A;  4HXO A;  5EWD A;  3MQM A;  5I88 A;  4QEV A;  4LZR A;  4Z93 A;  4TTE A;  4LYS A;  2N9G A;  4HBV A;  2GRC A;  4IR4 A;  3HMH A;  5BT3 A;  4YAT A;  4WHW A;  1F68 A;  5LKU A;  4YY6 A;  5I1Q A;  4ALG A;  2R0V A;  2FSA A;  4QR4 A;  4IOR A;  3HMF A;  5KO4 A;  5FE1 A;  3IU5 A;  3QZV A;  3U5P A;  5BT5 A;  5AMF A;  2DWW A;  2YEK A;  2DKW A;  5D3N A;  4YYG A;  4NRC A;  4HXR A;  5G4R A;  5ACY A;  5FE2 A;  2E3K A;  2I7K A;  5D3J A;  3RCW A;  4QSX A;  4TU4 A;  4NR5 A;  4HXM A;  4NR7 A;  5IG6 A;  4QBM A;  5I86 A;  5L96 A;  4QEW A;  5F36 A;  4A9E A;  5CP5 A;  5EWC A;  5FG4 A;  5CFW A;  3U5M A;  4HXN A;  5DKD A;  5CQT A;  4FLP A;  5CQ3 A;  4YYN A;  5FBX A;  5IBN A;  4TZ2 A;  4O7F A;  5E9I A;  5HQ5 A;  5F60 A;  5F2P A;  5DYC A;  5TB6 A;  3MB4 A;  3P1C A;  4O70 A;  4TQN A;  2OUO A;  3JVM A;  4UYH A;  5CPE A;  5KTU A;  4LZ2 A;  5L99 A;  5EA1 A;  4UIW A;  4O76 A;  4WHU A;  5F5Z A;  5H85 A;  5FFV A;  4NRA A;  4XY8 A;  4NR9 A;  2DAT A;  1N72 A;  5I7Y A;  4N3W A;  4A9J A;  3Q2F A;  5C4Q A;  5E73 A;  3LJW A;  5DFD A;  5D3T A;  5CRZ A;  4J1P A;  5L97 A;  4QZS A;  5FFY A;  4A9O A;  4UIV A;  5FE9 A;  4O7E A;  3MUK A;  2E7N A;  4YBT A;  5LJ1 A;  3D7C A;  3I3J A;  5HFQ A;  4KCX A;  4YYJ A;  4HXK A;  5ETB A;  4MEN A;  4C66 A;  4TU6 A;  4LR6 A;  4O75 A;  4KV4 A;  5K29 A;  5HQ6 A;  3UV4 A;  3GG3 A;  2YYN A;  1JSP B;  2R0S A;  4QSS A;  5EIS A;  3ONI A;  4QNS A;  2RFJ A;  5F25 A;  4HBW A;  5E74 A;  5AD3 A;  4CUP A;  5CS8 A;  4NUD A;  3SVF A;  4QUU A;  5ENJ A;  4PTB A;  5CUA A;  5HLS A;  3U5O A;  4ZC9 A;  2YQD A;  2F6J A;  2RI7 A;  5E9V A;  4BW4 A;  5HEN A;  4QSU A;  3MXF A;  3P1D A;  5LJ0 A;  5HFR A;  5IID A;  3UVD A;  5KTX A;  3JVL A;  5H1T A;  4QC3 A;  4UIT A;  5EWW A;  5I83 A;  5F3A A;  4CUQ A;  5HM0 A;  5L98 A;  5FE3 A;  3S91 A;  5E0R A;  4QSW A;  5CQ6 A;  5BT4 A;  5AD2 A;  4O7C A;  5EIC A;  5EV9 A;  5CUB A;  4Q0O A;  4GPJ A;  3UVX A;  5CQA A;  4MEQ A;  5IGL A;  4YBS A;  4IOQ A;  4Z6H A;  5CRM A;  3IU6 A;  3P5O A;  5II2 A;  5LVQ A;  2D9E A;  5FFW A;  4IR6 A;  5FE5 A;  5E9L A;  3QZS A;  5E9K A;  3MB3 A;  2I8N A;  2NXB A;  4J0S A;  4YY4 A;  4DON A;  5FG5 A;  5I80 A;  4IOO A;  3Q2E A;  5CQ8 A;  4Z1S A;  2E7O A;  4LYI A;  5DW1 A;  4CFL A;  2R0Y A;  3LQI A;  5EK9 A;  5C85 A;  1ZS5 A;  4YYI A;  5HRV A;  5A81 A;  5I89 A;  2WP2 A;  4MEP A;  5ENG A;  4ALH A;  5CUG A;  4NS5 A;  5CUC A;  5F62 A;  5CU8 A;  3S92 A;  4NRB A;  3LQJ A;  3O36 A;  4MR6 A;  4X2I A;  5IGM A;  5EVA A;  4N4I A;  5KHM A;  3NXB A;  4YK0 A;  5D26 A;  4YYH A;  5JI8 A;  5KTW A;  4A9L A;  4BW1 A;  5A5N A;  4UYD A;  2OSS A;  4HBX A;  4QSP A;  5CQ7 A;  5E3D A;  5DBM A;  2H60 A;  3SVH A;  5HEM A;  4XY9 A;  5COI A;  4NXJ A;  4Z6I A;  2RNW A;  4NYV A;  2DVR A;  5ENC A;  4QST A;  5G4S A;  4NUC A;  4QY4 A;  5TCM A;  4HXL A;  4ZW1 A;  2RO1 A;  4LC2 A;  4YC9 A;  5EWH A;  5FB0 A;  5CY9 A;  5D0C A;  4CUU A;  4QYL A;  4IR5 A;  4Q0N A;  3MUL A;  5A5S A;  4BW3 A;  1X0J A;  5DYA A;  5EQ1 A;  4MEO A;  5E3G A;  4LRG A;  4BJX A;  4QUT A;  4J3I A;  5FE6 A;  3O34 A;  3G0L A;  4YYK A;  5FDZ A;  4KV1 A;  3ZYU A;  5EPB A;  5H1U A;  2RS9 B;  4TT2 A;  5D24 A;  5DW2 A;  5HQ7 A;  3P1E A;  4LDF A;  2R10 A;  3UVW A;  2YW5 A;  3LQH A;  5I40 A;  5AME A;  4YH4 A;  4UYG A;  4N4H A;  5I29 A;  5DY7 A;  4YYD A;  4YYM A;  5DKC A;  5C8G A;  2D82 A;  4QR5 A;  4OGI A;  4YBM A;  1WUG A;  5A5O A;  2L84 A;  4N4F A;  5ENI A;  5LJ2 A;  5D3R A;  5ETD A;  2YEL A;  5FH8 A;  5FG6 A;  4UIU A;  5FH7 A;  4O7B A;  4UYF B;  2RNY A;  4XYA A;  4IR3 A;  3JVJ A;  4O71 A;  5EM3 A;  5HJC A;  5CTL A;  2LSP B;  5DYX A;  4OUF A;  5HCL A;  5E9Y A;  3O37 A;  4HXS A;  4PS5 A;  4BW2 A;  4NQN A;  5LVR A;  4UIZ A;  5F1H A;  4NYX A;  4QYD A;  3U5K A;  4A9M A;  2RNX A;  5CUE A;  5A7C A;  5CUD A;  5JWM A;  4N4G A;  2DVS A;  5LKT A;  5C87 A;  4CUT A;  4MR5 A;  4HBY A;  5EI4 A;  5ENE A;  5FE7 A;  5D3L A;  2G4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...