4Z93A

Brd4 bromodomain 2 in complex with gamma-carboline-containing compound, number 18.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
112
structure length
110
Chain Sequence
KVSEQLKCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain-containing protein 4
publication title Structure-Based Design of gamma-Carboline Analogues as Potent and Specific BET Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 110
sequence length 112
ec nomenclature
pdb deposition date 2015-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z93A00
5EICA 5HQ5A 4NRAA 3U5NA 5EWDA 4CUUA 5HENA 3S91A 4QEUA 5E9LA 4XUBA 3JVKA 3O37A 4YYDA 5L99A 4N4GA 4TQNA 4ALGA 5DFCA 5EGUA 3HMHA 4O71A 5L97A 3RCWA 4Z6IA 4QB3A 5FG5A 5LUUA 5C8GA 4CLBA 5FBXA 4QSWA 4NR8A 5HCLA 5F36A 2R0VA 3D7CA 4J0SA 4CFLA 4A9KA 4YC9A 2F6JA 4PCIA 5D3HA 4Q0NA 4YH3A 5D24A 5KHMA 2FSAA 5FH8A 4UIUA 5F25A 4QR4A 1JSPB 4YBSA 5DYCA 5C89A 3P1EA 5CUBA 4NQNA 4NYVA 2OO1A 4IOOA 5E9VA 4A9IA 5A5SA 5LJ0A 2I8NA 4PS5A 5D3PA 4O7FA 5EWHA 4TZ2A 5ENIA 4O72A 5ENEA 3Q2EA 5EISA 2MJVB 2DWWA 3HMEA 4A9JA 3DAIA 4QSSA 5CY9A 5TB6A 3K2JA 4IORA 2I7KA 4IR4A 5L98A 4BW4A 4HXPA 4YYHA 5FE2A 5ENBA 4PKLA 5ENHA 5E7DA 4IR5A 4LYSA 5BT3A 4HBXA 4N3WA 5LVQA 2E7NA 2R0SA 5F2PA 5H1VA 5CQAA 4A9LA 2F6NA 2YQDA 5L8UA 4IR6A 5LKXA 4O74A 4BW3A 5FFYA 5TCMA 2OUOA 3P5OA 3AQAA 5ENJA 5A5QA 5CZGA 4UYEA 5AD3A 3JVMA 4MEOA 5AMFA 4NQMA 5CRMA 2YEMA 4UIZA 4HXNA 4YH4A 4BHWA 5ENCA 4LC2A 4ZC9A 5FDZA 5E0RA 5F61A 5KU3A 5K29A 4CUQA 3MULA 4QSRA 4YYJA 5DFBA 4YABA 5FE7A 4KV4A 4TTEA 4YYMA 5I89A 4NYXA 5JI8A 5CQTA 3UVDA 4A9NA 5FE6A 4N4HA 4GPJA 5G4RA 3UVYA 4ALHA 5A85A 5EM3A 5F62A 5KTWA 4TU4A 4YBTA 3O35A 3GG3A 5IGLA 5F60A 1JM4B 5E9YA 4YYKA 5ENFA 4TT2A 4QR5A 4C67A 3IU6A 4LZRA 5I88A 4A9MA 4OUFA 3ONIA 5JWMA 4QC1A 5ENGA 5II1A 4YY6A 2G4AA 5DYAA 2E3KA 3DWYA 5LJ1A 2R10A 4QBMA 4TT6A 4XY8A 5FE9A 4N4FA 5E73A 2L84A 5FE5A 5I7XA 4PTBA 2WP2A 4TS8A 4YATA 4CL9A 4UITA 5HM0A 5I7YA 4NR9A 3SVGA 5IGNA 4YYIA 5L96A 5F5ZA 4O76A 5D3SA 4BJXA 3MXFA 4C66A 4E96A 2YELA 3LQIA 4PY6A 1ZS5A 5LJ2A 5I1QA 5EU1A 5D3RA 4NRCA 4CFKA 4A9FA 5CUGA 5LVRA 5HFQA 4ZQLA 3UV2A 5HELA 4Z1SA 4NUDA 4A9EA 5DKCA 3P1CA 4FLPA 5G4SA 5C7NA 4NXJA 4QEVA 4LRGA 5CQ8A 4MR5A 3SVHA 4CURA 3G0LA 4YYGA 3U5OA 4HXOA 5FH7A 1EQFA 4Z93A 4TYLA 2DVQA 4QUTA 4DONA 5EPSA 2RS9B 5CQ4A 5A5RA 4LYIA 5CU8A 3S92A 4XUAA 4QC3A 5EWWA 3IU5A 5FE8A 5CGPA 5FFWA 4UYGA 3HMFA 3O33A 4CUPA 4NR4A 5DKDA 5HRXA 4OGIA 5DYUA 5KO4A 5DW1A 5DKHA 2R0YA 5E9KA 5EI4A 5DLZA 4QSUA 3QZSA 4IR3A 4QR3A 5DYXA 4MR6A 5CQ7A 4Z6HA 5A82A 4XY9A 4N4IA 2RO1A 4HBWA 3P1FA 5D3NA 3TLPA 5C4QA 4HXMA 3UVXA 3U5MA 5H1TA 4YAXA 5ACYA 3MB4A 4O7CA 4HXKA 4MENA 5IGKA 5ETDA 2L85A 4YK0A 3U5KA 4AKNA 5LKTA 5ETBA 5CQ5A 2NXBA 4QSQA 5CUEA 3U5JA 4PCEA 4X2IA 5I29A 4LDFA 3QZVA 2LSPB 5EWCA 5BT5A 2YDWA 5I86A 3LQHA 4MEPA 3U5PA 1WUMA 4CUTA 5CUAA 5CUCA 5CQ6A 2YEKA 5D0CA 5E3GA 5HQ7A 1X0JA 5FB1A 5D7XA 4WHWA 3JVLA 2RNXA 4J3IA 4OGJA 4UYFA 5E9MA 5BT4A 5LKZA 5E3DA 5FFVA 4QNSA 5I40A 4LR6A 5DY7A 5FE3A 5FE0A 5LKUA 2DKWA 5CPEA 3MUKA 5DBMA 4QY4A 4HXLA 4QSTA 4QUUA 4F3IA 5CP5A 4UYDA 4J1PA 4YADA 4QEWA 5AMEA 5F1HA 2N9GA 3NXBA 4UYFB 4QZSA 4BW1A 5FE1A 5D3TA 2YYNA 5A81A 5D3JA 5HFRA 3LQJA 5FG6A 5FG4A 4QYLA 5HRWA 4A9OA 4YYNA 5C85A 3SVFA 3QZTA 4NRBA 4Q0OA 5DFDA 3UVWA 5I80A 5CQ3A 4NR6A 4UIXA 2H60A 5EA1A 4IOQA 5EPBA 5F3AA 5CS8A 4O75A 4J0RA 3AADA 4O77A 5EP7A 5F1LA 2RNYA 5AD2A 5H1UA 5A7CA 4LZSA 5HRVA 5IG6A 2RNWA 5DLXA 4O7EA 5HJCA 5CFWA 5HEMA 3UW9A 5F63A 3UV4A 5E9IA 4KV1A 2DVSA 5CUDA 5KTXA 5DW2A 2DATA 5COIA 5H85A 2RFJA 4NUCA 4WIVA 4O78A 2GRCA 3MQMA 3Q2FA 4O70A 5EQ1A 4NYWA 4UIYA 5HQ6A 3FKMX 2YW5A 4WHUA 5I83A 5A5PA 4MEQA 5FH6A 5D25A 1N72A 5FE4A 4A9HA 4HBVA 5L8TA 2DVVA 5DX4A 4CUSA 4NR5A 5C87A 4BW2A 4Y03A 4ZW1A 4MR3A 4TT4A 1WUGA 5A5OA 5EVAA 5EWVA 3U5LA 4NS5A 4O7AA 3JVJA 4UYHA 5IIDA 5II2A 5J0DA 2KTBB 4TZ8A 5E74A 5A5NA 5IGMA 3P1DA 3LJWA 3G0JA 5D3LA 1F68A 4HXRA 2OSSA 4QYDA 4UIWA 4UIVA 3I3JA 3MB3A 4NUEA 3ZYUA 2RI7A 3UV5A 5EV9A 2L5EA 2D9EA 5IBNA 4O7BA 4QSXA 2E7OA 5KTUA 5FB0A 4LZ2A 2WP1A 3O36A 4QSVA 3LXJA 5CRZA 5A83A 4TU6A 5CTLA 1E6IA 2DVRA 4MR4A 2D82A 4HBYA 4QSPA 4YY4A 5D26A 3O34A 4NR7A 5HLSA 4KCXA 4XYAA 4HXSA 4Z1QA 5EK9A 4RVRA 4LYWA 4YBMA 5EPRA
chains in the Genus database with same CATH superfamily
5EICA 5HQ5A 4NRAA 3U5NA 5EWDA 4CUUA 5HENA 3S91A 4QEUA 5E9LA 4XUBA 3JVKA 3O37A 4YYDA 5L99A 3VKHA 4N4GA 4TQNA 4ALGA 5DFCA 5EGUA 3HMHA 4O71A 5L97A 3RCWA 4Z6IA 4QB3A 5FG5A 5LUUA 5C8GA 4CLBA 5FBXA 4QSWA 4NR8A 5HCLA 5F36A 2R0VA 3D7CA 4J0SA 4CFLA 4A9KA 4YC9A 2F6JA 4PCIA 5D3HA 4Q0NA 4YH3A 5D24A 5KHMA 2FSAA 5FH8A 4UIUA 5F25A 4QR4A 1JSPB 4YBSA 5DYCA 5C89A 3P1EA 5CUBA 4NQNA 4NYVA 2OO1A 4IOOA 5E9VA 4A9IA 5A5SA 5LJ0A 2I8NA 4PS5A 5D3PA 4O7FA 5EWHA 4TZ2A 5ENIA 4O72A 5ENEA 3Q2EA 5EISA 2MJVB 2DWWA 3HMEA 4A9JA 3DAIA 4QSSA 5CY9A 5TB6A 3K2JA 4IORA 2I7KA 4IR4A 5L98A 4BW4A 4HXPA 4YYHA 5FE2A 5ENBA 4PKLA 5ENHA 5E7DA 4IR5A 4LYSA 5BT3A 4HBXA 4N3WA 5LVQA 2E7NA 2R0SA 5F2PA 5H1VA 5CQAA 4A9LA 2F6NA 2YQDA 5L8UA 4IR6A 5LKXA 4O74A 4BW3A 5FFYA 5TCMA 2OUOA 3P5OA 3AQAA 5ENJA 5A5QA 5CZGA 4UYEA 5AD3A 3JVMA 4MEOA 5AMFA 4NQMA 5CRMA 2YEMA 4UIZA 4HXNA 4YH4A 4BHWA 5ENCA 4AI6A 4LC2A 4ZC9A 5FDZA 5E0RA 5F61A 5KU3A 5K29A 4CUQA 3MULA 4QSRA 4YYJA 5DFBA 4YABA 5FE7A 4KV4A 4TTEA 4YYMA 5I89A 4NYXA 5JI8A 5CQTA 3UVDA 4A9NA 5FE6A 4N4HA 4GPJA 5G4RA 3UVYA 4ALHA 5A85A 5EM3A 5F62A 5KTWA 4TU4A 4YBTA 3O35A 3GG3A 5IGLA 5F60A 1JM4B 5E9YA 4YYKA 5ENFA 4TT2A 4QR5A 4C67A 3IU6A 4LZRA 5I88A 4A9MA 4OUFA 3ONIA 5JWMA 4QC1A 5ENGA 5II1A 4YY6A 2G4AA 5DYAA 2E3KA 3DWYA 5LJ1A 2R10A 4QBMA 4TT6A 4XY8A 5FE9A 4N4FA 5E73A 2L84A 5FE5A 5I7XA 4PTBA 2WP2A 4TS8A 4YATA 4CL9A 4UITA 5HM0A 5I7YA 4NR9A 3SVGA 5IGNA 4YYIA 5L96A 5F5ZA 4O76A 5D3SA 4BJXA 3MXFA 4C66A 4E96A 2YELA 3LQIA 4PY6A 1ZS5A 5LJ2A 5I1QA 5EU1A 5D3RA 4NRCA 4CFKA 4A9FA 5CUGA 5LVRA 5HFQA 4ZQLA 3UV2A 5HELA 4Z1SA 4NUDA 4A9EA 5DKCA 3P1CA 4FLPA 5G4SA 5C7NA 4NXJA 4QEVA 4LRGA 5CQ8A 4MR5A 3SVHA 4CURA 3G0LA 4YYGA 3U5OA 2EJNA 4HXOA 5FH7A 1EQFA 4Z93A 4TYLA 2DVQA 4AKIA 4QUTA 4DONA 5EPSA 2RS9B 5CQ4A 5A5RA 4AKHA 4LYIA 5CU8A 3S92A 4XUAA 4QC3A 5EWWA 3IU5A 5FE8A 5CGPA 5FFWA 4UYGA 3HMFA 3O33A 4CUPA 4NR4A 5DKDA 5HRXA 4OGIA 5DYUA 5KO4A 5DW1A 5DKHA 2R0YA 5E9KA 5EI4A 5DLZA 4QSUA 3QZSA 4IR3A 4QR3A 5DYXA 4MR6A 5CQ7A 4Z6HA 5A82A 4XY9A 4N4IA 2RO1A 4HBWA 3P1FA 5D3NA 3TLPA 5C4QA 4HXMA 3UVXA 3U5MA 5H1TA 4YAXA 5ACYA 1PUOA 3MB4A 4O7CA 4HXKA 4MENA 5IGKA 5ETDA 2L85A 4YK0A 3U5KA 4AKNA 5LKTA 5ETBA 5CQ5A 2NXBA 4QSQA 5CUEA 3U5JA 4PCEA 4X2IA 5I29A 4LDFA 3QZVA 2LSPB 5EWCA 5BT5A 2YDWA 5I86A 3LQHA 4MEPA 3U5PA 1WUMA 4CUTA 5CUAA 5CUCA 5CQ6A 2YEKA 5D0CA 5E3GA 5HQ7A 1X0JA 5FB1A 5D7XA 4WHWA 3JVLA 2RNXA 4J3IA 4OGJA 4UYFA 5E9MA 5BT4A 5LKZA 1ZKRA 5E3DA 5FFVA 4QNSA 5I40A 4LR6A 5DY7A 5FE3A 5FE0A 5LKUA 2DKWA 5CPEA 3MUKA 5DBMA 4QY4A 4HXLA 4QSTA 4QUUA 4F3IA 5CP5A 4UYDA 4J1PA 4YADA 4QEWA 5AMEA 5F1HA 2N9GA 3NXBA 4UYFB 4QZSA 4BW1A 5FE1A 5D3TA 2YYNA 5A81A 5D3JA 5HFRA 3LQJA 5FG6A 5FG4A 4QYLA 5HRWA 4A9OA 4YYNA 3VKGA 5C85A 3SVFA 3QZTA 4NRBA 4Q0OA 5DFDA 3UVWA 5I80A 5CQ3A 4NR6A 4UIXA 2H60A 4AKGA 5EA1A 4IOQA 5EPBA 5F3AA 5CS8A 4O75A 4J0RA 3AADA 4O77A 5EP7A 5F1LA 2RNYA 5AD2A 5H1UA 5A7CA 4LZSA 5HRVA 5IG6A 2RNWA 5DLXA 4O7EA 5HJCA 5CFWA 5HEMA 3UW9A 5F63A 3UV4A 5E9IA 3ERRA 2DVSA 4KV1A 5CUDA 5KTXA 5DW2A 2DATA 5COIA 5H85A 2RFJA 4NUCA 4WIVA 4O78A 2GRCA 3MQMA 3Q2FA 4O70A 5EQ1A 4NYWA 4UIYA 5HQ6A 3FKMX 3D1DA 2YW5A 4WHUA 5I83A 5A5PA 4MEQA 5FH6A 3D1BA 5D25A 1N72A 5FE4A 4A9HA 4HBVA 5L8TA 2DVVA 5DX4A 4CUSA 4NR5A 5C87A 4BW2A 4Y03A 4ZW1A 4MR3A 4TT4A 1WUGA 5A5OA 5EVAA 5EWVA 3U5LA 4NS5A 4O7AA 3JVJA 4UYHA 5IIDA 5II2A 5J0DA 2KTBB 4TZ8A 5E74A 5A5NA 5IGMA 3P1DA 3LJWA 3G0JA 5D3LA 1F68A 4HXRA 2OSSA 4QYDA 4UIWA 4UIVA 3I3JA 3MB3A 4NUEA 3ZYUA 2RI7A 3UV5A 5EV9A 2L5EA 2D9EA 5IBNA 4O7BA 4QSXA 2E7OA 5KTUA 5FB0A 4LZ2A 2WP1A 3O36A 4QSVA 3LXJA 5CRZA 5A83A 4TU6A 5CTLA 1E6IA 2DVRA 4MR4A 2D82A 4HBYA 4QSPA 4YY4A 5D26A 3O34A 4NR7A 5HLSA 4KCXA 4XYAA 4HXSA 4Z1QA 5EK9A 4RVRA 4LYWA 4YBMA 5EPRA
chains in the Genus database with same CATH topology
5EICA 5HQ5A 4NRAA 3U5NA 5EWDA 4CUUA 5HENA 3S91A 4QEUA 5E9LA 4XUBA 3JVKA 3O37A 4YYDA 5L99A 4N4GA 4TQNA 4ALGA 5DFCA 5EGUA 3HMHA 4O71A 5L97A 3RCWA 4Z6IA 4QB3A 5FG5A 5LUUA 5C8GA 4CLBA 5FBXA 4QSWA 4NR8A 5HCLA 5F36A 2R0VA 3D7CA 4J0SA 4CFLA 4A9KA 4YC9A 2F6JA 4PCIA 5D3HA 4Q0NA 4YH3A 5D24A 5KHMA 2FSAA 5FH8A 4UIUA 5F25A 4QR4A 1JSPB 4YBSA 5DYCA 5C89A 3P1EA 5CUBA 4NQNA 4NYVA 2OO1A 4IOOA 5E9VA 4A9IA 5A5SA 5LJ0A 2I8NA 4PS5A 5D3PA 4O7FA 5EWHA 4TZ2A 5ENIA 4O72A 5ENEA 3Q2EA 5EISA 2MJVB 2DWWA 3HMEA 4A9JA 3DAIA 4QSSA 5CY9A 5TB6A 3K2JA 4IORA 2I7KA 4IR4A 5L98A 4BW4A 4HXPA 4YYHA 5FE2A 5ENBA 4PKLA 5ENHA 5E7DA 4IR5A 4LYSA 5BT3A 4HBXA 4N3WA 5LVQA 2E7NA 2R0SA 5F2PA 5H1VA 5CQAA 4A9LA 2F6NA 2YQDA 5L8UA 4IR6A 5LKXA 4O74A 4BW3A 5FFYA 5TCMA 2OUOA 3P5OA 3AQAA 5ENJA 5A5QA 5CZGA 4UYEA 5AD3A 3JVMA 4MEOA 5AMFA 4NQMA 5CRMA 2YEMA 4UIZA 4HXNA 4YH4A 4BHWA 5ENCA 4LC2A 4ZC9A 5FDZA 5E0RA 5F61A 5KU3A 5K29A 4CUQA 3MULA 4QSRA 4YYJA 5DFBA 4YABA 5FE7A 4KV4A 4TTEA 4YYMA 5I89A 4NYXA 5JI8A 5CQTA 3UVDA 4A9NA 5FE6A 4N4HA 4GPJA 5G4RA 3UVYA 4ALHA 5A85A 5EM3A 5F62A 5KTWA 4TU4A 4YBTA 3O35A 3GG3A 5IGLA 5F60A 1JM4B 5E9YA 4YYKA 5ENFA 4TT2A 4QR5A 4C67A 3IU6A 4LZRA 5I88A 4A9MA 4OUFA 3ONIA 5JWMA 4QC1A 5ENGA 5II1A 4YY6A 2G4AA 5DYAA 2E3KA 3DWYA 5LJ1A 2R10A 4QBMA 4TT6A 4XY8A 5FE9A 4N4FA 5E73A 2L84A 5FE5A 5I7XA 4PTBA 2WP2A 4TS8A 4YATA 4CL9A 4UITA 5HM0A 5I7YA 4NR9A 3SVGA 5IGNA 4YYIA 5L96A 5F5ZA 4O76A 5D3SA 4BJXA 3MXFA 4C66A 4E96A 2YELA 3LQIA 4PY6A 1ZS5A 5LJ2A 5I1QA 5EU1A 5D3RA 4NRCA 4CFKA 4A9FA 5CUGA 5LVRA 5HFQA 4ZQLA 3UV2A 5HELA 4Z1SA 4NUDA 4A9EA 5DKCA 3P1CA 4FLPA 5G4SA 5C7NA 4NXJA 4QEVA 4LRGA 5CQ8A 4MR5A 3SVHA 4CURA 3G0LA 4YYGA 3U5OA 4HXOA 5FH7A 1EQFA 4Z93A 4TYLA 2DVQA 4QUTA 4DONA 5EPSA 2RS9B 5CQ4A 5A5RA 4LYIA 5CU8A 3S92A 4XUAA 4QC3A 5EWWA 3IU5A 5FE8A 5CGPA 5FFWA 4UYGA 3HMFA 3O33A 4CUPA 4NR4A 5DKDA 5HRXA 4OGIA 5DYUA 5KO4A 5DW1A 5DKHA 2R0YA 5E9KA 5EI4A 5DLZA 4QSUA 3QZSA 4IR3A 4QR3A 5DYXA 4MR6A 5CQ7A 4Z6HA 5A82A 4XY9A 4N4IA 2RO1A 4HBWA 3P1FA 5D3NA 3TLPA 5C4QA 4HXMA 3UVXA 3U5MA 5H1TA 4YAXA 5ACYA 3MB4A 4O7CA 4HXKA 4MENA 5IGKA 5ETDA 2L85A 4YK0A 3U5KA 4AKNA 5LKTA 5ETBA 5CQ5A 2NXBA 4QSQA 5CUEA 3U5JA 4PCEA 4X2IA 5I29A 4LDFA 3QZVA 2LSPB 5EWCA 5BT5A 2YDWA 5I86A 3LQHA 4MEPA 3U5PA 1WUMA 4CUTA 5CUAA 5CUCA 5CQ6A 2YEKA 5D0CA 5E3GA 5HQ7A 1X0JA 5FB1A 5D7XA 4WHWA 3JVLA 2RNXA 4J3IA 4OGJA 4UYFA 5E9MA 5BT4A 5LKZA 5E3DA 5FFVA 4QNSA 5I40A 4LR6A 5DY7A 5FE3A 5FE0A 5LKUA 2DKWA 5CPEA 3MUKA 5DBMA 4QY4A 4HXLA 4QSTA 4QUUA 4F3IA 5CP5A 4UYDA 4J1PA 4YADA 4QEWA 5AMEA 5F1HA 2N9GA 3NXBA 4UYFB 4QZSA 4BW1A 5FE1A 5D3TA 2YYNA 5A81A 5D3JA 5HFRA 3LQJA 5FG6A 5FG4A 4QYLA 5HRWA 4A9OA 4YYNA 5C85A 3SVFA 3QZTA 4NRBA 4Q0OA 5DFDA 3UVWA 5I80A 5CQ3A 4NR6A 4UIXA 2H60A 5EA1A 4IOQA 5EPBA 5F3AA 5CS8A 4O75A 4J0RA 3AADA 4O77A 5EP7A 5F1LA 2RNYA 5AD2A 5H1UA 5A7CA 4LZSA 5HRVA 5IG6A 2RNWA 5DLXA 4O7EA 5HJCA 5CFWA 5HEMA 3UW9A 5F63A 3UV4A 5E9IA 4KV1A 2DVSA 5CUDA 5KTXA 5DW2A 2DATA 5COIA 5H85A 2RFJA 4NUCA 4WIVA 4O78A 2GRCA 3MQMA 3Q2FA 4O70A 5EQ1A 4NYWA 4UIYA 5HQ6A 3FKMX 2YW5A 4WHUA 5I83A 5A5PA 4MEQA 5FH6A 5D25A 1N72A 5FE4A 4A9HA 4HBVA 5L8TA 2DVVA 5DX4A 4CUSA 4NR5A 5C87A 4BW2A 4Y03A 4ZW1A 4MR3A 4TT4A 1WUGA 5A5OA 5EVAA 5EWVA 3U5LA 4NS5A 4O7AA 3JVJA 4UYHA 5IIDA 5II2A 5J0DA 2KTBB 4TZ8A 5E74A 5A5NA 5IGMA 3P1DA 3LJWA 3G0JA 5D3LA 1F68A 4HXRA 2OSSA 4QYDA 4UIWA 4UIVA 3I3JA 3MB3A 4NUEA 3ZYUA 2RI7A 3UV5A 5EV9A 2L5EA 2D9EA 5IBNA 4O7BA 4QSXA 2E7OA 5KTUA 5FB0A 4LZ2A 2WP1A 3O36A 4QSVA 3LXJA 5CRZA 5A83A 4TU6A 5CTLA 1E6IA 2DVRA 4MR4A 2D82A 4HBYA 4QSPA 4YY4A 5D26A 3O34A 4NR7A 5HLSA 4KCXA 4XYAA 4HXSA 4Z1QA 5EK9A 4RVRA 4LYWA 4YBMA 5EPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EIC A;  5HQ5 A;  4NRA A;  3U5N A;  5EWD A;  4CUU A;  5HEN A;  3S91 A;  4QEU A;  5E9L A;  4XUB A;  3JVK A;  3O37 A;  4YYD A;  5L99 A;  4N4G A;  4TQN A;  4ALG A;  5DFC A;  5EGU A;  3HMH A;  4O71 A;  5L97 A;  3RCW A;  4Z6I A;  4QB3 A;  5FG5 A;  5LUU A;  5C8G A;  4CLB A;  5FBX A;  4QSW A;  4NR8 A;  5HCL A;  5F36 A;  2R0V A;  3D7C A;  4J0S A;  4CFL A;  4A9K A;  4YC9 A;  2F6J A;  4PCI A;  5D3H A;  4Q0N A;  4YH3 A;  5D24 A;  5KHM A;  2FSA A;  5FH8 A;  4UIU A;  5F25 A;  4QR4 A;  1JSP B;  4YBS A;  5DYC A;  5C89 A;  3P1E A;  5CUB A;  4NQN A;  4NYV A;  2OO1 A;  4IOO A;  5E9V A;  4A9I A;  5A5S A;  5LJ0 A;  2I8N A;  4PS5 A;  5D3P A;  4O7F A;  5EWH A;  4TZ2 A;  5ENI A;  4O72 A;  5ENE A;  3Q2E A;  5EIS A;  2MJV B;  2DWW A;  3HME A;  4A9J A;  3DAI A;  4QSS A;  5CY9 A;  5TB6 A;  3K2J A;  4IOR A;  2I7K A;  4IR4 A;  5L98 A;  4BW4 A;  4HXP A;  4YYH A;  5FE2 A;  5ENB A;  4PKL A;  5ENH A;  5E7D A;  4IR5 A;  4LYS A;  5BT3 A;  4HBX A;  4N3W A;  5LVQ A;  2E7N A;  2R0S A;  5F2P A;  5H1V A;  5CQA A;  4A9L A;  2F6N A;  2YQD A;  5L8U A;  4IR6 A;  5LKX A;  4O74 A;  4BW3 A;  5FFY A;  5TCM A;  2OUO A;  3P5O A;  3AQA A;  5ENJ A;  5A5Q A;  5CZG A;  4UYE A;  5AD3 A;  3JVM A;  4MEO A;  5AMF A;  4NQM A;  5CRM A;  2YEM A;  4UIZ A;  4HXN A;  4YH4 A;  4BHW A;  5ENC A;  4LC2 A;  4ZC9 A;  5FDZ A;  5E0R A;  5F61 A;  5KU3 A;  5K29 A;  4CUQ A;  3MUL A;  4QSR A;  4YYJ A;  5DFB A;  4YAB A;  5FE7 A;  4KV4 A;  4TTE A;  4YYM A;  5I89 A;  4NYX A;  5JI8 A;  5CQT A;  3UVD A;  4A9N A;  5FE6 A;  4N4H A;  4GPJ A;  5G4R A;  3UVY A;  4ALH A;  5A85 A;  5EM3 A;  5F62 A;  5KTW A;  4TU4 A;  4YBT A;  3O35 A;  3GG3 A;  5IGL A;  5F60 A;  1JM4 B;  5E9Y A;  4YYK A;  5ENF A;  4TT2 A;  4QR5 A;  4C67 A;  3IU6 A;  4LZR A;  5I88 A;  4A9M A;  4OUF A;  3ONI A;  5JWM A;  4QC1 A;  5ENG A;  5II1 A;  4YY6 A;  2G4A A;  5DYA A;  2E3K A;  3DWY A;  5LJ1 A;  2R10 A;  4QBM A;  4TT6 A;  4XY8 A;  5FE9 A;  4N4F A;  5E73 A;  2L84 A;  5FE5 A;  5I7X A;  4PTB A;  2WP2 A;  4TS8 A;  4YAT A;  4CL9 A;  4UIT A;  5HM0 A;  5I7Y A;  4NR9 A;  3SVG A;  5IGN A;  4YYI A;  5L96 A;  5F5Z A;  4O76 A;  5D3S A;  4BJX A;  3MXF A;  4C66 A;  4E96 A;  2YEL A;  3LQI A;  4PY6 A;  1ZS5 A;  5LJ2 A;  5I1Q A;  5EU1 A;  5D3R A;  4NRC A;  4CFK A;  4A9F A;  5CUG A;  5LVR A;  5HFQ A;  4ZQL A;  3UV2 A;  5HEL A;  4Z1S A;  4NUD A;  4A9E A;  5DKC A;  3P1C A;  4FLP A;  5G4S A;  5C7N A;  4NXJ A;  4QEV A;  4LRG A;  5CQ8 A;  4MR5 A;  3SVH A;  4CUR A;  3G0L A;  4YYG A;  3U5O A;  4HXO A;  5FH7 A;  1EQF A;  4Z93 A;  4TYL A;  2DVQ A;  4QUT A;  4DON A;  5EPS A;  2RS9 B;  5CQ4 A;  5A5R A;  4LYI A;  5CU8 A;  3S92 A;  4XUA A;  4QC3 A;  5EWW A;  3IU5 A;  5FE8 A;  5CGP A;  5FFW A;  4UYG A;  3HMF A;  3O33 A;  4CUP A;  4NR4 A;  5DKD A;  5HRX A;  4OGI A;  5DYU A;  5KO4 A;  5DW1 A;  5DKH A;  2R0Y A;  5E9K A;  5EI4 A;  5DLZ A;  4QSU A;  3QZS A;  4IR3 A;  4QR3 A;  5DYX A;  4MR6 A;  5CQ7 A;  4Z6H A;  5A82 A;  4XY9 A;  4N4I A;  2RO1 A;  4HBW A;  3P1F A;  5D3N A;  3TLP A;  5C4Q A;  4HXM A;  3UVX A;  3U5M A;  5H1T A;  4YAX A;  5ACY A;  3MB4 A;  4O7C A;  4HXK A;  4MEN A;  5IGK A;  5ETD A;  2L85 A;  4YK0 A;  3U5K A;  4AKN A;  5LKT A;  5ETB A;  5CQ5 A;  2NXB A;  4QSQ A;  5CUE A;  3U5J A;  4PCE A;  4X2I A;  5I29 A;  4LDF A;  3QZV A;  2LSP B;  5EWC A;  5BT5 A;  2YDW A;  5I86 A;  3LQH A;  4MEP A;  3U5P A;  1WUM A;  4CUT A;  5CUA A;  5CUC A;  5CQ6 A;  2YEK A;  5D0C A;  5E3G A;  5HQ7 A;  1X0J A;  5FB1 A;  5D7X A;  4WHW A;  3JVL A;  2RNX A;  4J3I A;  4OGJ A;  4UYF A;  5E9M A;  5BT4 A;  5LKZ A;  5E3D A;  5FFV A;  4QNS A;  5I40 A;  4LR6 A;  5DY7 A;  5FE3 A;  5FE0 A;  5LKU A;  2DKW A;  5CPE A;  3MUK A;  5DBM A;  4QY4 A;  4HXL A;  4QST A;  4QUU A;  4F3I A;  5CP5 A;  4UYD A;  4J1P A;  4YAD A;  4QEW A;  5AME A;  5F1H A;  2N9G A;  3NXB A;  4UYF B;  4QZS A;  4BW1 A;  5FE1 A;  5D3T A;  2YYN A;  5A81 A;  5D3J A;  5HFR A;  3LQJ A;  5FG6 A;  5FG4 A;  4QYL A;  5HRW A;  4A9O A;  4YYN A;  5C85 A;  3SVF A;  3QZT A;  4NRB A;  4Q0O A;  5DFD A;  3UVW A;  5I80 A;  5CQ3 A;  4NR6 A;  4UIX A;  2H60 A;  5EA1 A;  4IOQ A;  5EPB A;  5F3A A;  5CS8 A;  4O75 A;  4J0R A;  3AAD A;  4O77 A;  5EP7 A;  5F1L A;  2RNY A;  5AD2 A;  5H1U A;  5A7C A;  4LZS A;  5HRV A;  5IG6 A;  2RNW A;  5DLX A;  4O7E A;  5HJC A;  5CFW A;  5HEM A;  3UW9 A;  5F63 A;  3UV4 A;  5E9I A;  4KV1 A;  2DVS A;  5CUD A;  5KTX A;  5DW2 A;  2DAT A;  5COI A;  5H85 A;  2RFJ A;  4NUC A;  4WIV A;  4O78 A;  2GRC A;  3MQM A;  3Q2F A;  4O70 A;  5EQ1 A;  4NYW A;  4UIY A;  5HQ6 A;  3FKM X;  2YW5 A;  4WHU A;  5I83 A;  5A5P A;  4MEQ A;  5FH6 A;  5D25 A;  1N72 A;  5FE4 A;  4A9H A;  4HBV A;  5L8T A;  2DVV A;  5DX4 A;  4CUS A;  4NR5 A;  5C87 A;  4BW2 A;  4Y03 A;  4ZW1 A;  4MR3 A;  4TT4 A;  1WUG A;  5A5O A;  5EVA A;  5EWV A;  3U5L A;  4NS5 A;  4O7A A;  3JVJ A;  4UYH A;  5IID A;  5II2 A;  5J0D A;  2KTB B;  4TZ8 A;  5E74 A;  5A5N A;  5IGM A;  3P1D A;  3LJW A;  3G0J A;  5D3L A;  1F68 A;  4HXR A;  2OSS A;  4QYD A;  4UIW A;  4UIV A;  3I3J A;  3MB3 A;  4NUE A;  3ZYU A;  2RI7 A;  3UV5 A;  5EV9 A;  2L5E A;  2D9E A;  5IBN A;  4O7B A;  4QSX A;  2E7O A;  5KTU A;  5FB0 A;  4LZ2 A;  2WP1 A;  3O36 A;  4QSV A;  3LXJ A;  5CRZ A;  5A83 A;  4TU6 A;  5CTL A;  1E6I A;  2DVR A;  4MR4 A;  2D82 A;  4HBY A;  4QSP A;  4YY4 A;  5D26 A;  3O34 A;  4NR7 A;  5HLS A;  4KCX A;  4XYA A;  4HXS A;  4Z1Q A;  5EK9 A;  4RVR A;  4LYW A;  4YBM A;  5EPR A; 
#chains in the Genus database with same CATH topology
 5EIC A;  5HQ5 A;  4NRA A;  3U5N A;  5EWD A;  4CUU A;  5HEN A;  3S91 A;  4QEU A;  5E9L A;  4XUB A;  3JVK A;  3O37 A;  4YYD A;  5L99 A;  3VKH A;  4N4G A;  4TQN A;  4ALG A;  5DFC A;  5EGU A;  3HMH A;  4O71 A;  5L97 A;  3RCW A;  4Z6I A;  4QB3 A;  5FG5 A;  5LUU A;  5C8G A;  4CLB A;  5FBX A;  4QSW A;  4NR8 A;  5HCL A;  5F36 A;  2R0V A;  3D7C A;  4J0S A;  4CFL A;  4A9K A;  4YC9 A;  2F6J A;  4PCI A;  5D3H A;  4Q0N A;  4YH3 A;  5D24 A;  5KHM A;  2FSA A;  5FH8 A;  4UIU A;  5F25 A;  4QR4 A;  1JSP B;  4YBS A;  5DYC A;  5C89 A;  3P1E A;  5CUB A;  4NQN A;  4NYV A;  2OO1 A;  4IOO A;  5E9V A;  4A9I A;  5A5S A;  5LJ0 A;  2I8N A;  4PS5 A;  5D3P A;  4O7F A;  5EWH A;  4TZ2 A;  5ENI A;  4O72 A;  5ENE A;  3Q2E A;  5EIS A;  2MJV B;  2DWW A;  3HME A;  4A9J A;  3DAI A;  4QSS A;  5CY9 A;  5TB6 A;  3K2J A;  4IOR A;  2I7K A;  4IR4 A;  5L98 A;  4BW4 A;  4HXP A;  4YYH A;  5FE2 A;  5ENB A;  4PKL A;  5ENH A;  5E7D A;  4IR5 A;  4LYS A;  5BT3 A;  4HBX A;  4N3W A;  5LVQ A;  2E7N A;  2R0S A;  5F2P A;  5H1V A;  5CQA A;  4A9L A;  2F6N A;  2YQD A;  5L8U A;  4IR6 A;  5LKX A;  4O74 A;  4BW3 A;  5FFY A;  5TCM A;  2OUO A;  3P5O A;  3AQA A;  5ENJ A;  5A5Q A;  5CZG A;  4UYE A;  5AD3 A;  3JVM A;  4MEO A;  5AMF A;  4NQM A;  5CRM A;  2YEM A;  4UIZ A;  4HXN A;  4YH4 A;  4BHW A;  5ENC A;  4AI6 A;  4LC2 A;  4ZC9 A;  5FDZ A;  5E0R A;  5F61 A;  5KU3 A;  5K29 A;  4CUQ A;  3MUL A;  4QSR A;  4YYJ A;  5DFB A;  4YAB A;  5FE7 A;  4KV4 A;  4TTE A;  4YYM A;  5I89 A;  4NYX A;  5JI8 A;  5CQT A;  3UVD A;  4A9N A;  5FE6 A;  4N4H A;  4GPJ A;  5G4R A;  3UVY A;  4ALH A;  5A85 A;  5EM3 A;  5F62 A;  5KTW A;  4TU4 A;  4YBT A;  3O35 A;  3GG3 A;  5IGL A;  5F60 A;  1JM4 B;  5E9Y A;  4YYK A;  5ENF A;  4TT2 A;  4QR5 A;  4C67 A;  3IU6 A;  4LZR A;  5I88 A;  4A9M A;  4OUF A;  3ONI A;  5JWM A;  4QC1 A;  5ENG A;  5II1 A;  4YY6 A;  2G4A A;  5DYA A;  2E3K A;  3DWY A;  5LJ1 A;  2R10 A;  4QBM A;  4TT6 A;  4XY8 A;  5FE9 A;  4N4F A;  5E73 A;  2L84 A;  5FE5 A;  5I7X A;  4PTB A;  2WP2 A;  4TS8 A;  4YAT A;  4CL9 A;  4UIT A;  5HM0 A;  5I7Y A;  4NR9 A;  3SVG A;  5IGN A;  4YYI A;  5L96 A;  5F5Z A;  4O76 A;  5D3S A;  4BJX A;  3MXF A;  4C66 A;  4E96 A;  2YEL A;  3LQI A;  4PY6 A;  1ZS5 A;  5LJ2 A;  5I1Q A;  5EU1 A;  5D3R A;  4NRC A;  4CFK A;  4A9F A;  5CUG A;  5LVR A;  5HFQ A;  4ZQL A;  3UV2 A;  5HEL A;  4Z1S A;  4NUD A;  4A9E A;  5DKC A;  3P1C A;  4FLP A;  5G4S A;  5C7N A;  4NXJ A;  4QEV A;  4LRG A;  5CQ8 A;  4MR5 A;  3SVH A;  4CUR A;  3G0L A;  4YYG A;  3U5O A;  2EJN A;  4HXO A;  5FH7 A;  1EQF A;  4Z93 A;  4TYL A;  2DVQ A;  4AKI A;  4QUT A;  4DON A;  5EPS A;  2RS9 B;  5CQ4 A;  5A5R A;  4AKH A;  4LYI A;  5CU8 A;  3S92 A;  4XUA A;  4QC3 A;  5EWW A;  3IU5 A;  5FE8 A;  5CGP A;  5FFW A;  4UYG A;  3HMF A;  3O33 A;  4CUP A;  4NR4 A;  5DKD A;  5HRX A;  4OGI A;  5DYU A;  5KO4 A;  5DW1 A;  5DKH A;  2R0Y A;  5E9K A;  5EI4 A;  5DLZ A;  4QSU A;  3QZS A;  4IR3 A;  4QR3 A;  5DYX A;  4MR6 A;  5CQ7 A;  4Z6H A;  5A82 A;  4XY9 A;  4N4I A;  2RO1 A;  4HBW A;  3P1F A;  5D3N A;  3TLP A;  5C4Q A;  4HXM A;  3UVX A;  3U5M A;  5H1T A;  4YAX A;  5ACY A;  1PUO A;  3MB4 A;  4O7C A;  4HXK A;  4MEN A;  5IGK A;  5ETD A;  2L85 A;  4YK0 A;  3U5K A;  4AKN A;  5LKT A;  5ETB A;  5CQ5 A;  2NXB A;  4QSQ A;  5CUE A;  3U5J A;  4PCE A;  4X2I A;  5I29 A;  4LDF A;  3QZV A;  2LSP B;  5EWC A;  5BT5 A;  2YDW A;  5I86 A;  3LQH A;  4MEP A;  3U5P A;  1WUM A;  4CUT A;  5CUA A;  5CUC A;  5CQ6 A;  2YEK A;  5D0C A;  5E3G A;  5HQ7 A;  1X0J A;  5FB1 A;  5D7X A;  4WHW A;  3JVL A;  2RNX A;  4J3I A;  4OGJ A;  4UYF A;  5E9M A;  5BT4 A;  5LKZ A;  1ZKR A;  5E3D A;  5FFV A;  4QNS A;  5I40 A;  4LR6 A;  5DY7 A;  5FE3 A;  5FE0 A;  5LKU A;  2DKW A;  5CPE A;  3MUK A;  5DBM A;  4QY4 A;  4HXL A;  4QST A;  4QUU A;  4F3I A;  5CP5 A;  4UYD A;  4J1P A;  4YAD A;  4QEW A;  5AME A;  5F1H A;  2N9G A;  3NXB A;  4UYF B;  4QZS A;  4BW1 A;  5FE1 A;  5D3T A;  2YYN A;  5A81 A;  5D3J A;  5HFR A;  3LQJ A;  5FG6 A;  5FG4 A;  4QYL A;  5HRW A;  4A9O A;  4YYN A;  3VKG A;  5C85 A;  3SVF A;  3QZT A;  4NRB A;  4Q0O A;  5DFD A;  3UVW A;  5I80 A;  5CQ3 A;  4NR6 A;  4UIX A;  2H60 A;  4AKG A;  5EA1 A;  4IOQ A;  5EPB A;  5F3A A;  5CS8 A;  4O75 A;  4J0R A;  3AAD A;  4O77 A;  5EP7 A;  5F1L A;  2RNY A;  5AD2 A;  5H1U A;  5A7C A;  4LZS A;  5HRV A;  5IG6 A;  2RNW A;  5DLX A;  4O7E A;  5HJC A;  5CFW A;  5HEM A;  3UW9 A;  5F63 A;  3UV4 A;  5E9I A;  3ERR A;  2DVS A;  4KV1 A;  5CUD A;  5KTX A;  5DW2 A;  2DAT A;  5COI A;  5H85 A;  2RFJ A;  4NUC A;  4WIV A;  4O78 A;  2GRC A;  3MQM A;  3Q2F A;  4O70 A;  5EQ1 A;  4NYW A;  4UIY A;  5HQ6 A;  3FKM X;  3D1D A;  2YW5 A;  4WHU A;  5I83 A;  5A5P A;  4MEQ A;  5FH6 A;  3D1B A;  5D25 A;  1N72 A;  5FE4 A;  4A9H A;  4HBV A;  5L8T A;  2DVV A;  5DX4 A;  4CUS A;  4NR5 A;  5C87 A;  4BW2 A;  4Y03 A;  4ZW1 A;  4MR3 A;  4TT4 A;  1WUG A;  5A5O A;  5EVA A;  5EWV A;  3U5L A;  4NS5 A;  4O7A A;  3JVJ A;  4UYH A;  5IID A;  5II2 A;  5J0D A;  2KTB B;  4TZ8 A;  5E74 A;  5A5N A;  5IGM A;  3P1D A;  3LJW A;  3G0J A;  5D3L A;  1F68 A;  4HXR A;  2OSS A;  4QYD A;  4UIW A;  4UIV A;  3I3J A;  3MB3 A;  4NUE A;  3ZYU A;  2RI7 A;  3UV5 A;  5EV9 A;  2L5E A;  2D9E A;  5IBN A;  4O7B A;  4QSX A;  2E7O A;  5KTU A;  5FB0 A;  4LZ2 A;  2WP1 A;  3O36 A;  4QSV A;  3LXJ A;  5CRZ A;  5A83 A;  4TU6 A;  5CTL A;  1E6I A;  2DVR A;  4MR4 A;  2D82 A;  4HBY A;  4QSP A;  4YY4 A;  5D26 A;  3O34 A;  4NR7 A;  5HLS A;  4KCX A;  4XYA A;  4HXS A;  4Z1Q A;  5EK9 A;  4RVR A;  4LYW A;  4YBM A;  5EPR A; 
#chains in the Genus database with same CATH homology
 5EIC A;  5HQ5 A;  4NRA A;  3U5N A;  5EWD A;  4CUU A;  5HEN A;  3S91 A;  4QEU A;  5E9L A;  4XUB A;  3JVK A;  3O37 A;  4YYD A;  5L99 A;  4N4G A;  4TQN A;  4ALG A;  5DFC A;  5EGU A;  3HMH A;  4O71 A;  5L97 A;  3RCW A;  4Z6I A;  4QB3 A;  5FG5 A;  5LUU A;  5C8G A;  4CLB A;  5FBX A;  4QSW A;  4NR8 A;  5HCL A;  5F36 A;  2R0V A;  3D7C A;  4J0S A;  4CFL A;  4A9K A;  4YC9 A;  2F6J A;  4PCI A;  5D3H A;  4Q0N A;  4YH3 A;  5D24 A;  5KHM A;  2FSA A;  5FH8 A;  4UIU A;  5F25 A;  4QR4 A;  1JSP B;  4YBS A;  5DYC A;  5C89 A;  3P1E A;  5CUB A;  4NQN A;  4NYV A;  2OO1 A;  4IOO A;  5E9V A;  4A9I A;  5A5S A;  5LJ0 A;  2I8N A;  4PS5 A;  5D3P A;  4O7F A;  5EWH A;  4TZ2 A;  5ENI A;  4O72 A;  5ENE A;  3Q2E A;  5EIS A;  2MJV B;  2DWW A;  3HME A;  4A9J A;  3DAI A;  4QSS A;  5CY9 A;  5TB6 A;  3K2J A;  4IOR A;  2I7K A;  4IR4 A;  5L98 A;  4BW4 A;  4HXP A;  4YYH A;  5FE2 A;  5ENB A;  4PKL A;  5ENH A;  5E7D A;  4IR5 A;  4LYS A;  5BT3 A;  4HBX A;  4N3W A;  5LVQ A;  2E7N A;  2R0S A;  5F2P A;  5H1V A;  5CQA A;  4A9L A;  2F6N A;  2YQD A;  5L8U A;  4IR6 A;  5LKX A;  4O74 A;  4BW3 A;  5FFY A;  5TCM A;  2OUO A;  3P5O A;  3AQA A;  5ENJ A;  5A5Q A;  5CZG A;  4UYE A;  5AD3 A;  3JVM A;  4MEO A;  5AMF A;  4NQM A;  5CRM A;  2YEM A;  4UIZ A;  4HXN A;  4YH4 A;  4BHW A;  5ENC A;  4LC2 A;  4ZC9 A;  5FDZ A;  5E0R A;  5F61 A;  5KU3 A;  5K29 A;  4CUQ A;  3MUL A;  4QSR A;  4YYJ A;  5DFB A;  4YAB A;  5FE7 A;  4KV4 A;  4TTE A;  4YYM A;  5I89 A;  4NYX A;  5JI8 A;  5CQT A;  3UVD A;  4A9N A;  5FE6 A;  4N4H A;  4GPJ A;  5G4R A;  3UVY A;  4ALH A;  5A85 A;  5EM3 A;  5F62 A;  5KTW A;  4TU4 A;  4YBT A;  3O35 A;  3GG3 A;  5IGL A;  5F60 A;  1JM4 B;  5E9Y A;  4YYK A;  5ENF A;  4TT2 A;  4QR5 A;  4C67 A;  3IU6 A;  4LZR A;  5I88 A;  4A9M A;  4OUF A;  3ONI A;  5JWM A;  4QC1 A;  5ENG A;  5II1 A;  4YY6 A;  2G4A A;  5DYA A;  2E3K A;  3DWY A;  5LJ1 A;  2R10 A;  4QBM A;  4TT6 A;  4XY8 A;  5FE9 A;  4N4F A;  5E73 A;  2L84 A;  5FE5 A;  5I7X A;  4PTB A;  2WP2 A;  4TS8 A;  4YAT A;  4CL9 A;  4UIT A;  5HM0 A;  5I7Y A;  4NR9 A;  3SVG A;  5IGN A;  4YYI A;  5L96 A;  5F5Z A;  4O76 A;  5D3S A;  4BJX A;  3MXF A;  4C66 A;  4E96 A;  2YEL A;  3LQI A;  4PY6 A;  1ZS5 A;  5LJ2 A;  5I1Q A;  5EU1 A;  5D3R A;  4NRC A;  4CFK A;  4A9F A;  5CUG A;  5LVR A;  5HFQ A;  4ZQL A;  3UV2 A;  5HEL A;  4Z1S A;  4NUD A;  4A9E A;  5DKC A;  3P1C A;  4FLP A;  5G4S A;  5C7N A;  4NXJ A;  4QEV A;  4LRG A;  5CQ8 A;  4MR5 A;  3SVH A;  4CUR A;  3G0L A;  4YYG A;  3U5O A;  4HXO A;  5FH7 A;  1EQF A;  4Z93 A;  4TYL A;  2DVQ A;  4QUT A;  4DON A;  5EPS A;  2RS9 B;  5CQ4 A;  5A5R A;  4LYI A;  5CU8 A;  3S92 A;  4XUA A;  4QC3 A;  5EWW A;  3IU5 A;  5FE8 A;  5CGP A;  5FFW A;  4UYG A;  3HMF A;  3O33 A;  4CUP A;  4NR4 A;  5DKD A;  5HRX A;  4OGI A;  5DYU A;  5KO4 A;  5DW1 A;  5DKH A;  2R0Y A;  5E9K A;  5EI4 A;  5DLZ A;  4QSU A;  3QZS A;  4IR3 A;  4QR3 A;  5DYX A;  4MR6 A;  5CQ7 A;  4Z6H A;  5A82 A;  4XY9 A;  4N4I A;  2RO1 A;  4HBW A;  3P1F A;  5D3N A;  3TLP A;  5C4Q A;  4HXM A;  3UVX A;  3U5M A;  5H1T A;  4YAX A;  5ACY A;  3MB4 A;  4O7C A;  4HXK A;  4MEN A;  5IGK A;  5ETD A;  2L85 A;  4YK0 A;  3U5K A;  4AKN A;  5LKT A;  5ETB A;  5CQ5 A;  2NXB A;  4QSQ A;  5CUE A;  3U5J A;  4PCE A;  4X2I A;  5I29 A;  4LDF A;  3QZV A;  2LSP B;  5EWC A;  5BT5 A;  2YDW A;  5I86 A;  3LQH A;  4MEP A;  3U5P A;  1WUM A;  4CUT A;  5CUA A;  5CUC A;  5CQ6 A;  2YEK A;  5D0C A;  5E3G A;  5HQ7 A;  1X0J A;  5FB1 A;  5D7X A;  4WHW A;  3JVL A;  2RNX A;  4J3I A;  4OGJ A;  4UYF A;  5E9M A;  5BT4 A;  5LKZ A;  5E3D A;  5FFV A;  4QNS A;  5I40 A;  4LR6 A;  5DY7 A;  5FE3 A;  5FE0 A;  5LKU A;  2DKW A;  5CPE A;  3MUK A;  5DBM A;  4QY4 A;  4HXL A;  4QST A;  4QUU A;  4F3I A;  5CP5 A;  4UYD A;  4J1P A;  4YAD A;  4QEW A;  5AME A;  5F1H A;  2N9G A;  3NXB A;  4UYF B;  4QZS A;  4BW1 A;  5FE1 A;  5D3T A;  2YYN A;  5A81 A;  5D3J A;  5HFR A;  3LQJ A;  5FG6 A;  5FG4 A;  4QYL A;  5HRW A;  4A9O A;  4YYN A;  5C85 A;  3SVF A;  3QZT A;  4NRB A;  4Q0O A;  5DFD A;  3UVW A;  5I80 A;  5CQ3 A;  4NR6 A;  4UIX A;  2H60 A;  5EA1 A;  4IOQ A;  5EPB A;  5F3A A;  5CS8 A;  4O75 A;  4J0R A;  3AAD A;  4O77 A;  5EP7 A;  5F1L A;  2RNY A;  5AD2 A;  5H1U A;  5A7C A;  4LZS A;  5HRV A;  5IG6 A;  2RNW A;  5DLX A;  4O7E A;  5HJC A;  5CFW A;  5HEM A;  3UW9 A;  5F63 A;  3UV4 A;  5E9I A;  4KV1 A;  2DVS A;  5CUD A;  5KTX A;  5DW2 A;  2DAT A;  5COI A;  5H85 A;  2RFJ A;  4NUC A;  4WIV A;  4O78 A;  2GRC A;  3MQM A;  3Q2F A;  4O70 A;  5EQ1 A;  4NYW A;  4UIY A;  5HQ6 A;  3FKM X;  2YW5 A;  4WHU A;  5I83 A;  5A5P A;  4MEQ A;  5FH6 A;  5D25 A;  1N72 A;  5FE4 A;  4A9H A;  4HBV A;  5L8T A;  2DVV A;  5DX4 A;  4CUS A;  4NR5 A;  5C87 A;  4BW2 A;  4Y03 A;  4ZW1 A;  4MR3 A;  4TT4 A;  1WUG A;  5A5O A;  5EVA A;  5EWV A;  3U5L A;  4NS5 A;  4O7A A;  3JVJ A;  4UYH A;  5IID A;  5II2 A;  5J0D A;  2KTB B;  4TZ8 A;  5E74 A;  5A5N A;  5IGM A;  3P1D A;  3LJW A;  3G0J A;  5D3L A;  1F68 A;  4HXR A;  2OSS A;  4QYD A;  4UIW A;  4UIV A;  3I3J A;  3MB3 A;  4NUE A;  3ZYU A;  2RI7 A;  3UV5 A;  5EV9 A;  2L5E A;  2D9E A;  5IBN A;  4O7B A;  4QSX A;  2E7O A;  5KTU A;  5FB0 A;  4LZ2 A;  2WP1 A;  3O36 A;  4QSV A;  3LXJ A;  5CRZ A;  5A83 A;  4TU6 A;  5CTL A;  1E6I A;  2DVR A;  4MR4 A;  2D82 A;  4HBY A;  4QSP A;  4YY4 A;  5D26 A;  3O34 A;  4NR7 A;  5HLS A;  4KCX A;  4XYA A;  4HXS A;  4Z1Q A;  5EK9 A;  4RVR A;  4LYW A;  4YBM A;  5EPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...