4Z93A

Brd4 bromodomain 2 in complex with gamma-carboline-containing compound, number 18.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
112
structure length
110
Chain Sequence
KVSEQLKCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 4
publication title Structure-Based Design of gamma-Carboline Analogues as Potent and Specific BET Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 110
sequence length 112
ec nomenclature
pdb deposition date 2015-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z93A00
4IOOA 2MJVB 4YAXA 5DW1A 5CQTA 4YYNA 5BT4A 5LKXA 1JM4B 5ENJA 5EPSA 4NXJA 5DY7A 4QEWA 3MQMA 2WP2A 4A9JA 4BW4A 4DONA 4QYLA 3SVFA 3UVYA 4QEUA 5L99A 5HENA 4QB3A 4TZ8A 5TCMA 3I3JA 5CZGA 3QZTA 4UIVA 5ACYA 2DWWA 5KO4A 4LYIA 5DFDA 3SVGA 4YBTA 3O34A 4PCIA 5A83A 5LUUA 4QYDA 2E7NA 3UVXA 4O72A 4YBSA 3G0JA 4NR8A 5CQ7A 4UYHA 5JI8A 4HBYA 4LZRA 3O36A 4QC1A 5EGUA 1JSPB 4O77A 5CRMA 5I7YA 4HXPA 5FE5A 5E3DA 4NRAA 4CURA 2RO1A 5F62A 3U5PA 5A5RA 5FFWA 4PTBA 5ETDA 4UYFA 4XY9A 2F6JA 5C87A 5C7NA 5D3LA 3MB4A 5A85A 4O78A 5L96A 5I86A 5ENFA 5F63A 5IG6A 5EV9A 5DX4A 5CPEA 4O7AA 5CUCA 5E73A 4YYHA 5L98A 5TB6A 4CUTA 4TQNA 3TLPA 3P5OA 5D7XA 4CUSA 5FE1A 4PCEA 4N4GA 4J1PA 5LJ1A 4KCXA 5D3JA 2DATA 4GPJA 4YYMA 4O74A 4XY8A 4TT4A 5D3TA 5CUAA 4HXKA 4A9MA 4NQNA 4KV1A 4C66A 5D3SA 4HXSA 4TU6A 3HMHA 4QSTA 4LR6A 4WHWA 4YATA 5FBXA 4NYWA 1F68A 1X0JA 4BW3A 4QSWA 4XYAA 5EWWA 2E7OA 3U5KA 2DVSA 4NS5A 5HRWA 4UYGA 3QZVA 5CQ4A 5CQ8A 2WP1A 5HM0A 4YYGA 2GRCA 4PY6A 4ZW1A 5F25A 4LRGA 2RI7A 5EM3A 5EWHA 5H1TA 4IR6A 5C85A 5IGLA 5KTXA 4Z6IA 5HEMA 4QSUA 3GG3A 4UIUA 4Z93A 5CFWA 4NRCA 3ONIA 5CUEA 5FE9A 2YQDA 3UV2A 2F6NA 5HQ6A 4AKNA 5E9LA 5IIDA 5FH8A 5H1VA 4BW1A 4OUFA 4HBWA 4Q0OA 3HMFA 3IU5A 5FFYA 4TT2A 4UYDA 2DVQA 5ETBA 5HCLA 4O7BA 5D0CA 4MEPA 4HXOA 4UITA 5FE0A 4MENA 5EU1A 5FE4A 5DW2A 5EWVA 4Z1SA 2G4AA 3U5OA 5CRZA 2RFJA 4YH4A 5FH7A 4QUUA 3DWYA 2RNWA 4O7FA 4QC3A 5JWMA 5I83A 4TT6A 5E74A 5J0DA 2R0SA 5AMEA 2DVRA 5DYAA 5A5SA 2FSAA 2R0VA 5LVRA 2I8NA 4QR5A 4YYJA 5ENHA 4HXRA 5HELA 3LXJA 5HFRA 5HQ5A 5I7XA 4YK0A 4BW2A 5F1LA 4YY4A 4NR6A 5D25A 5EVAA 5KU3A 4J3IA 2N9GA 4O71A 5E7DA 2R10A 4LDFA 4NYVA 4CL9A 5IGKA 5HRVA 4YBMA 4QBMA 5BT3A 5DBMA 4YH3A 5K29A 4N4FA 4RVRA 5CGPA 3S92A 4LYWA 5ENBA 4YADA 5DYCA 5F2PA 5LJ0A 4NR9A 5L8UA 3QZSA 4A9FA 4QEVA 2L85A 4UIWA 4ZQLA 5CQAA 5FE8A 3NXBA 4ALGA 3P1CA 4UYFB 5E9YA 5II1A 5IGNA 4Z6HA 4MR3A 5KTUA 5A5NA 5D3RA 2RS9B 5E9VA 5FFVA 2LSPB 3G0LA 4NQMA 5CUGA 5EQ1A 5E3GA 5A7CA 5F60A 4LC2A 3MUKA 5FE2A 3UW9A 5C4QA 5EICA 4PKLA 4WHUA 5EPRA 4YYDA 1WUGA 3O35A 2YW5A 2D82A 5I88A 2OSSA 5DYXA 3LQIA 4HXNA 5ENEA 5FB1A 4A9OA 4XUAA 4MR4A 5HQ7A 2RNYA 5EPBA 4PS5A 4QZSA 5G4SA 4UIZA 5ENCA 3SVHA 5HJCA 4KV4A 5CS8A 4IR4A 4OGJA 4MEQA 5E9MA 5ENGA 3UVDA 4CUUA 5DFCA 4BHWA 5G4RA 5HLSA 3IU6A 2L84A 3DAIA 3LQHA 5F3AA 5CY9A 5EK9A 4CUQA 5A5QA 5KTWA 4NUCA 5LKTA 5D3NA 4YY6A 4QSXA 3JVMA 4TS8A 4YYIA 4IR3A 5EWDA 3UV5A 4MEOA 5H85A 5CQ5A 5A5OA 5DFBA 2D9EA 4NUDA 5E9IA 4QUTA 4NR4A 4HXMA 4QNSA 3Q2EA 5CU8A 4O76A 5DLXA 5AMFA 5A81A 5EISA 3S91A 3U5NA 3P1EA 4J0SA 4N4IA 5FE3A 3ZYUA 4HXLA 3O33A 4Y03A 5DKHA 4NR7A 4QSPA 5BT5A 5ENIA 5CQ6A 4MR5A 4A9EA 4QSQA 4QSVA 2YEKA 4CLBA 4QSSA 4TZ2A 2DKWA 4XUBA 5E0RA 2E3KA 3JVLA 5FE6A 5CQ3A 4O7CA 4NUEA 2NXBA 5A5PA 5F5ZA 3U5LA 4QY4A 4A9HA 1WUMA 5F1HA 5A82A 4C67A 4ZC9A 1ZS5A 5CUBA 3D7CA 2YDWA 4NYXA 4QSRA 4YC9A 5FG6A 4A9KA 4QR4A 5I89A 4X2IA 5DKDA 5HFQA 4OGIA 3RCWA 5EA1A 5D26A 5FDZA 5E9KA 4IORA 4Z1QA 3LJWA 4UIYA 2R0YA 5I40A 5I1QA 3MULA 4HBXA 3P1FA 4N4HA 5EP7A 1E6IA 5LVQA 3JVKA 3UV4A 5FB0A 5L8TA 4E96A 5C89A 3LQJA 3P1DA 5DYUA 2OO1A 5LKUA 4O75A 5FG5A 5FG4A 2OUOA 2KTBB 2I7KA 4FLPA 4CUPA 3U5MA 5CTLA 3MB3A 5HRXA 2RNXA 2YEMA 5DKCA 4UIXA 2YELA 3UVWA 2YYNA 4A9LA 4A9NA 4O70A 5CUDA 4TU4A 1EQFA 4UYEA 4LZ2A 2DVVA 5H1UA 1N72A 4O7EA 4A9IA 5L97A 5COIA 4J0RA 3U5JA 3AQAA 5AD2A 4YYKA 4QR3A 5D24A 4BJXA 2L5EA 4TYLA 5D3PA 3FKMX 3MXFA 3K2JA 5KHMA 5LJ2A 4F3IA 5IBNA 5II2A 3Q2FA 5CP5A 5IGMA 4IOQA 4MR6A 4CFKA 5F61A 5LKZA 4LYSA 4N3WA 5DLZA 5F36A 4HBVA 4IR5A 5I29A 5AD3A 4LZSA 5C8GA 3JVJA 4NR5A 4NRBA 4WIVA 3HMEA 5EI4A 3O37A 5I80A 4YABA 5FE7A 4TTEA 4ALHA 4CFLA 2H60A 5FH6A 3AADA 4Q0NA 5D3HA 5EWCA
chains in the Genus database with same CATH superfamily
4IOOA 2MJVB 4YAXA 5DW1A 5CQTA 4YYNA 5BT4A 5LKXA 1JM4B 5ENJA 5EPSA 4NXJA 5DY7A 4QEWA 3MQMA 2WP2A 4A9JA 4BW4A 4DONA 4QYLA 3SVFA 3UVYA 4QEUA 5L99A 5HENA 4QB3A 4TZ8A 5TCMA 3I3JA 5CZGA 3QZTA 4UIVA 3VKGA 5ACYA 2DWWA 5KO4A 4LYIA 5DFDA 3SVGA 4YBTA 3O34A 4PCIA 5A83A 5LUUA 4QYDA 2E7NA 3UVXA 4O72A 4YBSA 3G0JA 4NR8A 5CQ7A 4UYHA 5JI8A 4HBYA 4LZRA 3O36A 4QC1A 5EGUA 1JSPB 4O77A 5CRMA 5I7YA 4HXPA 5FE5A 5E3DA 4NRAA 4CURA 2RO1A 5F62A 3U5PA 5A5RA 5FFWA 4PTBA 5ETDA 4UYFA 4XY9A 2F6JA 5C87A 5C7NA 5D3LA 3MB4A 5A85A 4O78A 5L96A 5I86A 5ENFA 5F63A 5IG6A 5EV9A 5DX4A 5CPEA 4O7AA 5CUCA 5E73A 4YYHA 5L98A 5TB6A 4CUTA 4TQNA 3TLPA 3P5OA 5D7XA 4CUSA 5FE1A 4PCEA 4N4GA 4J1PA 5LJ1A 4KCXA 5D3JA 2DATA 4GPJA 4YYMA 4O74A 4XY8A 4TT4A 5D3TA 5CUAA 2EJNA 4HXKA 4A9MA 4NQNA 4KV1A 4C66A 5D3SA 4HXSA 4TU6A 3HMHA 4QSTA 4LR6A 4WHWA 4YATA 5FBXA 4NYWA 1F68A 1X0JA 4BW3A 4QSWA 4XYAA 5EWWA 2E7OA 3U5KA 2DVSA 4NS5A 5HRWA 4UYGA 3QZVA 5CQ4A 5CQ8A 2WP1A 5HM0A 4YYGA 2GRCA 4PY6A 4ZW1A 5F25A 4LRGA 2RI7A 5EM3A 5EWHA 5H1TA 4IR6A 5C85A 5IGLA 5KTXA 4Z6IA 5HEMA 4QSUA 3GG3A 4UIUA 4Z93A 5CFWA 4NRCA 3ONIA 5CUEA 5FE9A 2YQDA 3UV2A 2F6NA 5HQ6A 4AKNA 5E9LA 5IIDA 5FH8A 5H1VA 4BW1A 4OUFA 4HBWA 4Q0OA 3HMFA 3IU5A 5FFYA 4TT2A 4UYDA 2DVQA 5ETBA 5HCLA 4O7BA 5D0CA 4MEPA 4HXOA 4UITA 5FE0A 4MENA 5EU1A 5FE4A 5DW2A 5EWVA 4Z1SA 2G4AA 3U5OA 5CRZA 2RFJA 4YH4A 5FH7A 4QUUA 3DWYA 2RNWA 4O7FA 4QC3A 5JWMA 5I83A 4TT6A 5E74A 5J0DA 2R0SA 5AMEA 2DVRA 5DYAA 5A5SA 2FSAA 2R0VA 5LVRA 2I8NA 4QR5A 4YYJA 5ENHA 4HXRA 5HELA 3LXJA 5HFRA 5HQ5A 5I7XA 4YK0A 4BW2A 5F1LA 4YY4A 4NR6A 5D25A 5EVAA 5KU3A 4J3IA 2N9GA 4O71A 5E7DA 2R10A 4LDFA 4NYVA 4CL9A 5IGKA 5HRVA 4YBMA 4QBMA 5BT3A 5DBMA 4YH3A 5K29A 4N4FA 4RVRA 5CGPA 3S92A 4LYWA 5ENBA 4YADA 5DYCA 5F2PA 3D1BA 5LJ0A 4NR9A 5L8UA 3QZSA 4A9FA 4QEVA 2L85A 4UIWA 4ZQLA 5CQAA 5FE8A 3NXBA 4ALGA 4AKHA 3P1CA 4UYFB 5E9YA 5II1A 5IGNA 4Z6HA 4MR3A 3VKHA 5KTUA 5A5NA 5D3RA 2RS9B 5E9VA 5FFVA 2LSPB 4AKGA 3G0LA 4NQMA 5CUGA 5EQ1A 5E3GA 5A7CA 5F60A 4LC2A 3MUKA 5FE2A 3UW9A 5C4QA 5EICA 4PKLA 4WHUA 5EPRA 4YYDA 1WUGA 3O35A 2YW5A 2D82A 5I88A 2OSSA 5DYXA 3LQIA 4HXNA 5ENEA 5FB1A 4A9OA 4XUAA 4MR4A 1PUOA 1ZKRA 5HQ7A 2RNYA 5EPBA 4PS5A 3D1DA 4QZSA 5G4SA 4UIZA 5ENCA 3SVHA 5HJCA 4KV4A 5CS8A 4IR4A 4OGJA 4MEQA 5E9MA 5ENGA 3UVDA 4CUUA 5DFCA 4BHWA 5G4RA 5HLSA 3IU6A 2L84A 3DAIA 3LQHA 5F3AA 5CY9A 5EK9A 4CUQA 5A5QA 5KTWA 4NUCA 5LKTA 5D3NA 4YY6A 4QSXA 3JVMA 4TS8A 4YYIA 4IR3A 5EWDA 3UV5A 4MEOA 5H85A 5CQ5A 5A5OA 5DFBA 2D9EA 4NUDA 5E9IA 4QUTA 4NR4A 4HXMA 4QNSA 3Q2EA 5CU8A 4O76A 5DLXA 5AMFA 5A81A 3ERRA 5EISA 3S91A 3U5NA 3P1EA 4J0SA 4N4IA 5FE3A 3ZYUA 4HXLA 3O33A 4Y03A 4AI6A 5DKHA 4NR7A 4QSPA 5BT5A 5ENIA 5CQ6A 4MR5A 4A9EA 4QSQA 4QSVA 2YEKA 4CLBA 4QSSA 4TZ2A 2DKWA 4XUBA 5E0RA 2E3KA 3JVLA 5FE6A 5CQ3A 4O7CA 4NUEA 2NXBA 5A5PA 5F5ZA 3U5LA 4QY4A 4A9HA 1WUMA 5F1HA 5A82A 4C67A 4ZC9A 1ZS5A 5CUBA 3D7CA 2YDWA 4NYXA 4QSRA 4AKIA 4YC9A 5FG6A 4A9KA 4QR4A 5I89A 4X2IA 5DKDA 5HFQA 4OGIA 3RCWA 5EA1A 5D26A 5FDZA 5E9KA 4IORA 4Z1QA 3LJWA 4UIYA 2R0YA 5I40A 5I1QA 3MULA 4HBXA 3P1FA 4N4HA 5EP7A 1E6IA 5LVQA 3JVKA 3UV4A 5FB0A 5L8TA 4E96A 5C89A 3LQJA 3P1DA 5DYUA 2OO1A 5LKUA 4O75A 5FG5A 5FG4A 2OUOA 2KTBB 2I7KA 4FLPA 4CUPA 3U5MA 5CTLA 3MB3A 5HRXA 2RNXA 2YEMA 5DKCA 4UIXA 2YELA 3UVWA 2YYNA 4A9LA 4A9NA 4O70A 5CUDA 4TU4A 1EQFA 4UYEA 4LZ2A 2DVVA 5H1UA 1N72A 4O7EA 4A9IA 5L97A 5COIA 4J0RA 3U5JA 3AQAA 5AD2A 4YYKA 4QR3A 5D24A 4BJXA 2L5EA 4TYLA 5D3PA 3FKMX 3MXFA 3K2JA 5KHMA 5LJ2A 4F3IA 5IBNA 5II2A 3Q2FA 5CP5A 5IGMA 4IOQA 4MR6A 4CFKA 5F61A 5LKZA 4LYSA 4N3WA 5DLZA 5F36A 4HBVA 4IR5A 5I29A 5AD3A 4LZSA 5C8GA 3JVJA 4NR5A 4NRBA 4WIVA 3HMEA 5EI4A 3O37A 5I80A 4YABA 5FE7A 4TTEA 4ALHA 4CFLA 2H60A 5FH6A 3AADA 4Q0NA 5D3HA 5EWCA
chains in the Genus database with same CATH topology
4IOOA 2MJVB 4YAXA 5DW1A 5CQTA 4YYNA 5BT4A 5LKXA 1JM4B 5ENJA 5EPSA 4NXJA 5DY7A 4QEWA 3MQMA 2WP2A 4A9JA 4BW4A 4DONA 4QYLA 3SVFA 3UVYA 4QEUA 5L99A 5HENA 4QB3A 4TZ8A 5TCMA 3I3JA 5CZGA 3QZTA 4UIVA 5ACYA 2DWWA 5KO4A 4LYIA 5DFDA 3SVGA 4YBTA 3O34A 4PCIA 5A83A 5LUUA 4QYDA 2E7NA 3UVXA 4O72A 4YBSA 3G0JA 4NR8A 5CQ7A 4UYHA 5JI8A 4HBYA 4LZRA 3O36A 4QC1A 5EGUA 1JSPB 4O77A 5CRMA 5I7YA 4HXPA 5FE5A 5E3DA 4NRAA 4CURA 2RO1A 5F62A 3U5PA 5A5RA 5FFWA 4PTBA 5ETDA 4UYFA 4XY9A 2F6JA 5C87A 5C7NA 5D3LA 3MB4A 5A85A 4O78A 5L96A 5I86A 5ENFA 5F63A 5IG6A 5EV9A 5DX4A 5CPEA 4O7AA 5CUCA 5E73A 4YYHA 5L98A 5TB6A 4CUTA 4TQNA 3TLPA 3P5OA 5D7XA 4CUSA 5FE1A 4PCEA 4N4GA 4J1PA 5LJ1A 4KCXA 5D3JA 2DATA 4GPJA 4YYMA 4O74A 4XY8A 4TT4A 5D3TA 5CUAA 4HXKA 4A9MA 4NQNA 4KV1A 4C66A 5D3SA 4HXSA 4TU6A 3HMHA 4QSTA 4LR6A 4WHWA 4YATA 5FBXA 4NYWA 1F68A 1X0JA 4BW3A 4QSWA 4XYAA 5EWWA 2E7OA 3U5KA 2DVSA 4NS5A 5HRWA 4UYGA 3QZVA 5CQ4A 5CQ8A 2WP1A 5HM0A 4YYGA 2GRCA 4PY6A 4ZW1A 5F25A 4LRGA 2RI7A 5EM3A 5EWHA 5H1TA 4IR6A 5C85A 5IGLA 5KTXA 4Z6IA 5HEMA 4QSUA 3GG3A 4UIUA 4Z93A 5CFWA 4NRCA 3ONIA 5CUEA 5FE9A 2YQDA 3UV2A 2F6NA 5HQ6A 4AKNA 5E9LA 5IIDA 5FH8A 5H1VA 4BW1A 4OUFA 4HBWA 4Q0OA 3HMFA 3IU5A 5FFYA 4TT2A 4UYDA 2DVQA 5ETBA 5HCLA 4O7BA 5D0CA 4MEPA 4HXOA 4UITA 5FE0A 4MENA 5EU1A 5FE4A 5DW2A 5EWVA 4Z1SA 2G4AA 3U5OA 5CRZA 2RFJA 4YH4A 5FH7A 4QUUA 3DWYA 2RNWA 4O7FA 4QC3A 5JWMA 5I83A 4TT6A 5E74A 5J0DA 2R0SA 5AMEA 2DVRA 5DYAA 5A5SA 2FSAA 2R0VA 5LVRA 2I8NA 4QR5A 4YYJA 5ENHA 4HXRA 5HELA 3LXJA 5HFRA 5HQ5A 5I7XA 4YK0A 4BW2A 5F1LA 4YY4A 4NR6A 5D25A 5EVAA 5KU3A 4J3IA 2N9GA 4O71A 5E7DA 2R10A 4LDFA 4NYVA 4CL9A 5IGKA 5HRVA 4YBMA 4QBMA 5BT3A 5DBMA 4YH3A 5K29A 4N4FA 4RVRA 5CGPA 3S92A 4LYWA 5ENBA 4YADA 5DYCA 5F2PA 5LJ0A 4NR9A 5L8UA 3QZSA 4A9FA 4QEVA 2L85A 4UIWA 4ZQLA 5CQAA 5FE8A 3NXBA 4ALGA 3P1CA 4UYFB 5E9YA 5II1A 5IGNA 4Z6HA 4MR3A 5KTUA 5A5NA 5D3RA 2RS9B 5E9VA 5FFVA 2LSPB 3G0LA 4NQMA 5CUGA 5EQ1A 5E3GA 5A7CA 5F60A 4LC2A 3MUKA 5FE2A 3UW9A 5C4QA 5EICA 4PKLA 4WHUA 5EPRA 4YYDA 1WUGA 3O35A 2YW5A 2D82A 5I88A 2OSSA 5DYXA 3LQIA 4HXNA 5ENEA 5FB1A 4A9OA 4XUAA 4MR4A 5HQ7A 2RNYA 5EPBA 4PS5A 4QZSA 5G4SA 4UIZA 5ENCA 3SVHA 5HJCA 4KV4A 5CS8A 4IR4A 4OGJA 4MEQA 5E9MA 5ENGA 3UVDA 4CUUA 5DFCA 4BHWA 5G4RA 5HLSA 3IU6A 2L84A 3DAIA 3LQHA 5F3AA 5CY9A 5EK9A 4CUQA 5A5QA 5KTWA 4NUCA 5LKTA 5D3NA 4YY6A 4QSXA 3JVMA 4TS8A 4YYIA 4IR3A 5EWDA 3UV5A 4MEOA 5H85A 5CQ5A 5A5OA 5DFBA 2D9EA 4NUDA 5E9IA 4QUTA 4NR4A 4HXMA 4QNSA 3Q2EA 5CU8A 4O76A 5DLXA 5AMFA 5A81A 5EISA 3S91A 3U5NA 3P1EA 4J0SA 4N4IA 5FE3A 3ZYUA 4HXLA 3O33A 4Y03A 5DKHA 4NR7A 4QSPA 5BT5A 5ENIA 5CQ6A 4MR5A 4A9EA 4QSQA 4QSVA 2YEKA 4CLBA 4QSSA 4TZ2A 2DKWA 4XUBA 5E0RA 2E3KA 3JVLA 5FE6A 5CQ3A 4O7CA 4NUEA 2NXBA 5A5PA 5F5ZA 3U5LA 4QY4A 4A9HA 1WUMA 5F1HA 5A82A 4C67A 4ZC9A 1ZS5A 5CUBA 3D7CA 2YDWA 4NYXA 4QSRA 4YC9A 5FG6A 4A9KA 4QR4A 5I89A 4X2IA 5DKDA 5HFQA 4OGIA 3RCWA 5EA1A 5D26A 5FDZA 5E9KA 4IORA 4Z1QA 3LJWA 4UIYA 2R0YA 5I40A 5I1QA 3MULA 4HBXA 3P1FA 4N4HA 5EP7A 1E6IA 5LVQA 3JVKA 3UV4A 5FB0A 5L8TA 4E96A 5C89A 3LQJA 3P1DA 5DYUA 2OO1A 5LKUA 4O75A 5FG5A 5FG4A 2OUOA 2KTBB 2I7KA 4FLPA 4CUPA 3U5MA 5CTLA 3MB3A 5HRXA 2RNXA 2YEMA 5DKCA 4UIXA 2YELA 3UVWA 2YYNA 4A9LA 4A9NA 4O70A 5CUDA 4TU4A 1EQFA 4UYEA 4LZ2A 2DVVA 5H1UA 1N72A 4O7EA 4A9IA 5L97A 5COIA 4J0RA 3U5JA 3AQAA 5AD2A 4YYKA 4QR3A 5D24A 4BJXA 2L5EA 4TYLA 5D3PA 3FKMX 3MXFA 3K2JA 5KHMA 5LJ2A 4F3IA 5IBNA 5II2A 3Q2FA 5CP5A 5IGMA 4IOQA 4MR6A 4CFKA 5F61A 5LKZA 4LYSA 4N3WA 5DLZA 5F36A 4HBVA 4IR5A 5I29A 5AD3A 4LZSA 5C8GA 3JVJA 4NR5A 4NRBA 4WIVA 3HMEA 5EI4A 3O37A 5I80A 4YABA 5FE7A 4TTEA 4ALHA 4CFLA 2H60A 5FH6A 3AADA 4Q0NA 5D3HA 5EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOO A;  2MJV B;  4YAX A;  5DW1 A;  5CQT A;  4YYN A;  5BT4 A;  5LKX A;  1JM4 B;  5ENJ A;  5EPS A;  4NXJ A;  5DY7 A;  4QEW A;  3MQM A;  2WP2 A;  4A9J A;  4BW4 A;  4DON A;  4QYL A;  3SVF A;  3UVY A;  4QEU A;  5L99 A;  5HEN A;  4QB3 A;  4TZ8 A;  5TCM A;  3I3J A;  5CZG A;  3QZT A;  4UIV A;  5ACY A;  2DWW A;  5KO4 A;  4LYI A;  5DFD A;  3SVG A;  4YBT A;  3O34 A;  4PCI A;  5A83 A;  5LUU A;  4QYD A;  2E7N A;  3UVX A;  4O72 A;  4YBS A;  3G0J A;  4NR8 A;  5CQ7 A;  4UYH A;  5JI8 A;  4HBY A;  4LZR A;  3O36 A;  4QC1 A;  5EGU A;  1JSP B;  4O77 A;  5CRM A;  5I7Y A;  4HXP A;  5FE5 A;  5E3D A;  4NRA A;  4CUR A;  2RO1 A;  5F62 A;  3U5P A;  5A5R A;  5FFW A;  4PTB A;  5ETD A;  4UYF A;  4XY9 A;  2F6J A;  5C87 A;  5C7N A;  5D3L A;  3MB4 A;  5A85 A;  4O78 A;  5L96 A;  5I86 A;  5ENF A;  5F63 A;  5IG6 A;  5EV9 A;  5DX4 A;  5CPE A;  4O7A A;  5CUC A;  5E73 A;  4YYH A;  5L98 A;  5TB6 A;  4CUT A;  4TQN A;  3TLP A;  3P5O A;  5D7X A;  4CUS A;  5FE1 A;  4PCE A;  4N4G A;  4J1P A;  5LJ1 A;  4KCX A;  5D3J A;  2DAT A;  4GPJ A;  4YYM A;  4O74 A;  4XY8 A;  4TT4 A;  5D3T A;  5CUA A;  4HXK A;  4A9M A;  4NQN A;  4KV1 A;  4C66 A;  5D3S A;  4HXS A;  4TU6 A;  3HMH A;  4QST A;  4LR6 A;  4WHW A;  4YAT A;  5FBX A;  4NYW A;  1F68 A;  1X0J A;  4BW3 A;  4QSW A;  4XYA A;  5EWW A;  2E7O A;  3U5K A;  2DVS A;  4NS5 A;  5HRW A;  4UYG A;  3QZV A;  5CQ4 A;  5CQ8 A;  2WP1 A;  5HM0 A;  4YYG A;  2GRC A;  4PY6 A;  4ZW1 A;  5F25 A;  4LRG A;  2RI7 A;  5EM3 A;  5EWH A;  5H1T A;  4IR6 A;  5C85 A;  5IGL A;  5KTX A;  4Z6I A;  5HEM A;  4QSU A;  3GG3 A;  4UIU A;  4Z93 A;  5CFW A;  4NRC A;  3ONI A;  5CUE A;  5FE9 A;  2YQD A;  3UV2 A;  2F6N A;  5HQ6 A;  4AKN A;  5E9L A;  5IID A;  5FH8 A;  5H1V A;  4BW1 A;  4OUF A;  4HBW A;  4Q0O A;  3HMF A;  3IU5 A;  5FFY A;  4TT2 A;  4UYD A;  2DVQ A;  5ETB A;  5HCL A;  4O7B A;  5D0C A;  4MEP A;  4HXO A;  4UIT A;  5FE0 A;  4MEN A;  5EU1 A;  5FE4 A;  5DW2 A;  5EWV A;  4Z1S A;  2G4A A;  3U5O A;  5CRZ A;  2RFJ A;  4YH4 A;  5FH7 A;  4QUU A;  3DWY A;  2RNW A;  4O7F A;  4QC3 A;  5JWM A;  5I83 A;  4TT6 A;  5E74 A;  5J0D A;  2R0S A;  5AME A;  2DVR A;  5DYA A;  5A5S A;  2FSA A;  2R0V A;  5LVR A;  2I8N A;  4QR5 A;  4YYJ A;  5ENH A;  4HXR A;  5HEL A;  3LXJ A;  5HFR A;  5HQ5 A;  5I7X A;  4YK0 A;  4BW2 A;  5F1L A;  4YY4 A;  4NR6 A;  5D25 A;  5EVA A;  5KU3 A;  4J3I A;  2N9G A;  4O71 A;  5E7D A;  2R10 A;  4LDF A;  4NYV A;  4CL9 A;  5IGK A;  5HRV A;  4YBM A;  4QBM A;  5BT3 A;  5DBM A;  4YH3 A;  5K29 A;  4N4F A;  4RVR A;  5CGP A;  3S92 A;  4LYW A;  5ENB A;  4YAD A;  5DYC A;  5F2P A;  5LJ0 A;  4NR9 A;  5L8U A;  3QZS A;  4A9F A;  4QEV A;  2L85 A;  4UIW A;  4ZQL A;  5CQA A;  5FE8 A;  3NXB A;  4ALG A;  3P1C A;  4UYF B;  5E9Y A;  5II1 A;  5IGN A;  4Z6H A;  4MR3 A;  5KTU A;  5A5N A;  5D3R A;  2RS9 B;  5E9V A;  5FFV A;  2LSP B;  3G0L A;  4NQM A;  5CUG A;  5EQ1 A;  5E3G A;  5A7C A;  5F60 A;  4LC2 A;  3MUK A;  5FE2 A;  3UW9 A;  5C4Q A;  5EIC A;  4PKL A;  4WHU A;  5EPR A;  4YYD A;  1WUG A;  3O35 A;  2YW5 A;  2D82 A;  5I88 A;  2OSS A;  5DYX A;  3LQI A;  4HXN A;  5ENE A;  5FB1 A;  4A9O A;  4XUA A;  4MR4 A;  5HQ7 A;  2RNY A;  5EPB A;  4PS5 A;  4QZS A;  5G4S A;  4UIZ A;  5ENC A;  3SVH A;  5HJC A;  4KV4 A;  5CS8 A;  4IR4 A;  4OGJ A;  4MEQ A;  5E9M A;  5ENG A;  3UVD A;  4CUU A;  5DFC A;  4BHW A;  5G4R A;  5HLS A;  3IU6 A;  2L84 A;  3DAI A;  3LQH A;  5F3A A;  5CY9 A;  5EK9 A;  4CUQ A;  5A5Q A;  5KTW A;  4NUC A;  5LKT A;  5D3N A;  4YY6 A;  4QSX A;  3JVM A;  4TS8 A;  4YYI A;  4IR3 A;  5EWD A;  3UV5 A;  4MEO A;  5H85 A;  5CQ5 A;  5A5O A;  5DFB A;  2D9E A;  4NUD A;  5E9I A;  4QUT A;  4NR4 A;  4HXM A;  4QNS A;  3Q2E A;  5CU8 A;  4O76 A;  5DLX A;  5AMF A;  5A81 A;  5EIS A;  3S91 A;  3U5N A;  3P1E A;  4J0S A;  4N4I A;  5FE3 A;  3ZYU A;  4HXL A;  3O33 A;  4Y03 A;  5DKH A;  4NR7 A;  4QSP A;  5BT5 A;  5ENI A;  5CQ6 A;  4MR5 A;  4A9E A;  4QSQ A;  4QSV A;  2YEK A;  4CLB A;  4QSS A;  4TZ2 A;  2DKW A;  4XUB A;  5E0R A;  2E3K A;  3JVL A;  5FE6 A;  5CQ3 A;  4O7C A;  4NUE A;  2NXB A;  5A5P A;  5F5Z A;  3U5L A;  4QY4 A;  4A9H A;  1WUM A;  5F1H A;  5A82 A;  4C67 A;  4ZC9 A;  1ZS5 A;  5CUB A;  3D7C A;  2YDW A;  4NYX A;  4QSR A;  4YC9 A;  5FG6 A;  4A9K A;  4QR4 A;  5I89 A;  4X2I A;  5DKD A;  5HFQ A;  4OGI A;  3RCW A;  5EA1 A;  5D26 A;  5FDZ A;  5E9K A;  4IOR A;  4Z1Q A;  3LJW A;  4UIY A;  2R0Y A;  5I40 A;  5I1Q A;  3MUL A;  4HBX A;  3P1F A;  4N4H A;  5EP7 A;  1E6I A;  5LVQ A;  3JVK A;  3UV4 A;  5FB0 A;  5L8T A;  4E96 A;  5C89 A;  3LQJ A;  3P1D A;  5DYU A;  2OO1 A;  5LKU A;  4O75 A;  5FG5 A;  5FG4 A;  2OUO A;  2KTB B;  2I7K A;  4FLP A;  4CUP A;  3U5M A;  5CTL A;  3MB3 A;  5HRX A;  2RNX A;  2YEM A;  5DKC A;  4UIX A;  2YEL A;  3UVW A;  2YYN A;  4A9L A;  4A9N A;  4O70 A;  5CUD A;  4TU4 A;  1EQF A;  4UYE A;  4LZ2 A;  2DVV A;  5H1U A;  1N72 A;  4O7E A;  4A9I A;  5L97 A;  5COI A;  4J0R A;  3U5J A;  3AQA A;  5AD2 A;  4YYK A;  4QR3 A;  5D24 A;  4BJX A;  2L5E A;  4TYL A;  5D3P A;  3FKM X;  3MXF A;  3K2J A;  5KHM A;  5LJ2 A;  4F3I A;  5IBN A;  5II2 A;  3Q2F A;  5CP5 A;  5IGM A;  4IOQ A;  4MR6 A;  4CFK A;  5F61 A;  5LKZ A;  4LYS A;  4N3W A;  5DLZ A;  5F36 A;  4HBV A;  4IR5 A;  5I29 A;  5AD3 A;  4LZS A;  5C8G A;  3JVJ A;  4NR5 A;  4NRB A;  4WIV A;  3HME A;  5EI4 A;  3O37 A;  5I80 A;  4YAB A;  5FE7 A;  4TTE A;  4ALH A;  4CFL A;  2H60 A;  5FH6 A;  3AAD A;  4Q0N A;  5D3H A;  5EWC A; 
#chains in the Genus database with same CATH topology
 4IOO A;  2MJV B;  4YAX A;  5DW1 A;  5CQT A;  4YYN A;  5BT4 A;  5LKX A;  1JM4 B;  5ENJ A;  5EPS A;  4NXJ A;  5DY7 A;  4QEW A;  3MQM A;  2WP2 A;  4A9J A;  4BW4 A;  4DON A;  4QYL A;  3SVF A;  3UVY A;  4QEU A;  5L99 A;  5HEN A;  4QB3 A;  4TZ8 A;  5TCM A;  3I3J A;  5CZG A;  3QZT A;  4UIV A;  3VKG A;  5ACY A;  2DWW A;  5KO4 A;  4LYI A;  5DFD A;  3SVG A;  4YBT A;  3O34 A;  4PCI A;  5A83 A;  5LUU A;  4QYD A;  2E7N A;  3UVX A;  4O72 A;  4YBS A;  3G0J A;  4NR8 A;  5CQ7 A;  4UYH A;  5JI8 A;  4HBY A;  4LZR A;  3O36 A;  4QC1 A;  5EGU A;  1JSP B;  4O77 A;  5CRM A;  5I7Y A;  4HXP A;  5FE5 A;  5E3D A;  4NRA A;  4CUR A;  2RO1 A;  5F62 A;  3U5P A;  5A5R A;  5FFW A;  4PTB A;  5ETD A;  4UYF A;  4XY9 A;  2F6J A;  5C87 A;  5C7N A;  5D3L A;  3MB4 A;  5A85 A;  4O78 A;  5L96 A;  5I86 A;  5ENF A;  5F63 A;  5IG6 A;  5EV9 A;  5DX4 A;  5CPE A;  4O7A A;  5CUC A;  5E73 A;  4YYH A;  5L98 A;  5TB6 A;  4CUT A;  4TQN A;  3TLP A;  3P5O A;  5D7X A;  4CUS A;  5FE1 A;  4PCE A;  4N4G A;  4J1P A;  5LJ1 A;  4KCX A;  5D3J A;  2DAT A;  4GPJ A;  4YYM A;  4O74 A;  4XY8 A;  4TT4 A;  5D3T A;  5CUA A;  2EJN A;  4HXK A;  4A9M A;  4NQN A;  4KV1 A;  4C66 A;  5D3S A;  4HXS A;  4TU6 A;  3HMH A;  4QST A;  4LR6 A;  4WHW A;  4YAT A;  5FBX A;  4NYW A;  1F68 A;  1X0J A;  4BW3 A;  4QSW A;  4XYA A;  5EWW A;  2E7O A;  3U5K A;  2DVS A;  4NS5 A;  5HRW A;  4UYG A;  3QZV A;  5CQ4 A;  5CQ8 A;  2WP1 A;  5HM0 A;  4YYG A;  2GRC A;  4PY6 A;  4ZW1 A;  5F25 A;  4LRG A;  2RI7 A;  5EM3 A;  5EWH A;  5H1T A;  4IR6 A;  5C85 A;  5IGL A;  5KTX A;  4Z6I A;  5HEM A;  4QSU A;  3GG3 A;  4UIU A;  4Z93 A;  5CFW A;  4NRC A;  3ONI A;  5CUE A;  5FE9 A;  2YQD A;  3UV2 A;  2F6N A;  5HQ6 A;  4AKN A;  5E9L A;  5IID A;  5FH8 A;  5H1V A;  4BW1 A;  4OUF A;  4HBW A;  4Q0O A;  3HMF A;  3IU5 A;  5FFY A;  4TT2 A;  4UYD A;  2DVQ A;  5ETB A;  5HCL A;  4O7B A;  5D0C A;  4MEP A;  4HXO A;  4UIT A;  5FE0 A;  4MEN A;  5EU1 A;  5FE4 A;  5DW2 A;  5EWV A;  4Z1S A;  2G4A A;  3U5O A;  5CRZ A;  2RFJ A;  4YH4 A;  5FH7 A;  4QUU A;  3DWY A;  2RNW A;  4O7F A;  4QC3 A;  5JWM A;  5I83 A;  4TT6 A;  5E74 A;  5J0D A;  2R0S A;  5AME A;  2DVR A;  5DYA A;  5A5S A;  2FSA A;  2R0V A;  5LVR A;  2I8N A;  4QR5 A;  4YYJ A;  5ENH A;  4HXR A;  5HEL A;  3LXJ A;  5HFR A;  5HQ5 A;  5I7X A;  4YK0 A;  4BW2 A;  5F1L A;  4YY4 A;  4NR6 A;  5D25 A;  5EVA A;  5KU3 A;  4J3I A;  2N9G A;  4O71 A;  5E7D A;  2R10 A;  4LDF A;  4NYV A;  4CL9 A;  5IGK A;  5HRV A;  4YBM A;  4QBM A;  5BT3 A;  5DBM A;  4YH3 A;  5K29 A;  4N4F A;  4RVR A;  5CGP A;  3S92 A;  4LYW A;  5ENB A;  4YAD A;  5DYC A;  5F2P A;  3D1B A;  5LJ0 A;  4NR9 A;  5L8U A;  3QZS A;  4A9F A;  4QEV A;  2L85 A;  4UIW A;  4ZQL A;  5CQA A;  5FE8 A;  3NXB A;  4ALG A;  4AKH A;  3P1C A;  4UYF B;  5E9Y A;  5II1 A;  5IGN A;  4Z6H A;  4MR3 A;  3VKH A;  5KTU A;  5A5N A;  5D3R A;  2RS9 B;  5E9V A;  5FFV A;  2LSP B;  4AKG A;  3G0L A;  4NQM A;  5CUG A;  5EQ1 A;  5E3G A;  5A7C A;  5F60 A;  4LC2 A;  3MUK A;  5FE2 A;  3UW9 A;  5C4Q A;  5EIC A;  4PKL A;  4WHU A;  5EPR A;  4YYD A;  1WUG A;  3O35 A;  2YW5 A;  2D82 A;  5I88 A;  2OSS A;  5DYX A;  3LQI A;  4HXN A;  5ENE A;  5FB1 A;  4A9O A;  4XUA A;  4MR4 A;  1PUO A;  1ZKR A;  5HQ7 A;  2RNY A;  5EPB A;  4PS5 A;  3D1D A;  4QZS A;  5G4S A;  4UIZ A;  5ENC A;  3SVH A;  5HJC A;  4KV4 A;  5CS8 A;  4IR4 A;  4OGJ A;  4MEQ A;  5E9M A;  5ENG A;  3UVD A;  4CUU A;  5DFC A;  4BHW A;  5G4R A;  5HLS A;  3IU6 A;  2L84 A;  3DAI A;  3LQH A;  5F3A A;  5CY9 A;  5EK9 A;  4CUQ A;  5A5Q A;  5KTW A;  4NUC A;  5LKT A;  5D3N A;  4YY6 A;  4QSX A;  3JVM A;  4TS8 A;  4YYI A;  4IR3 A;  5EWD A;  3UV5 A;  4MEO A;  5H85 A;  5CQ5 A;  5A5O A;  5DFB A;  2D9E A;  4NUD A;  5E9I A;  4QUT A;  4NR4 A;  4HXM A;  4QNS A;  3Q2E A;  5CU8 A;  4O76 A;  5DLX A;  5AMF A;  5A81 A;  3ERR A;  5EIS A;  3S91 A;  3U5N A;  3P1E A;  4J0S A;  4N4I A;  5FE3 A;  3ZYU A;  4HXL A;  3O33 A;  4Y03 A;  4AI6 A;  5DKH A;  4NR7 A;  4QSP A;  5BT5 A;  5ENI A;  5CQ6 A;  4MR5 A;  4A9E A;  4QSQ A;  4QSV A;  2YEK A;  4CLB A;  4QSS A;  4TZ2 A;  2DKW A;  4XUB A;  5E0R A;  2E3K A;  3JVL A;  5FE6 A;  5CQ3 A;  4O7C A;  4NUE A;  2NXB A;  5A5P A;  5F5Z A;  3U5L A;  4QY4 A;  4A9H A;  1WUM A;  5F1H A;  5A82 A;  4C67 A;  4ZC9 A;  1ZS5 A;  5CUB A;  3D7C A;  2YDW A;  4NYX A;  4QSR A;  4AKI A;  4YC9 A;  5FG6 A;  4A9K A;  4QR4 A;  5I89 A;  4X2I A;  5DKD A;  5HFQ A;  4OGI A;  3RCW A;  5EA1 A;  5D26 A;  5FDZ A;  5E9K A;  4IOR A;  4Z1Q A;  3LJW A;  4UIY A;  2R0Y A;  5I40 A;  5I1Q A;  3MUL A;  4HBX A;  3P1F A;  4N4H A;  5EP7 A;  1E6I A;  5LVQ A;  3JVK A;  3UV4 A;  5FB0 A;  5L8T A;  4E96 A;  5C89 A;  3LQJ A;  3P1D A;  5DYU A;  2OO1 A;  5LKU A;  4O75 A;  5FG5 A;  5FG4 A;  2OUO A;  2KTB B;  2I7K A;  4FLP A;  4CUP A;  3U5M A;  5CTL A;  3MB3 A;  5HRX A;  2RNX A;  2YEM A;  5DKC A;  4UIX A;  2YEL A;  3UVW A;  2YYN A;  4A9L A;  4A9N A;  4O70 A;  5CUD A;  4TU4 A;  1EQF A;  4UYE A;  4LZ2 A;  2DVV A;  5H1U A;  1N72 A;  4O7E A;  4A9I A;  5L97 A;  5COI A;  4J0R A;  3U5J A;  3AQA A;  5AD2 A;  4YYK A;  4QR3 A;  5D24 A;  4BJX A;  2L5E A;  4TYL A;  5D3P A;  3FKM X;  3MXF A;  3K2J A;  5KHM A;  5LJ2 A;  4F3I A;  5IBN A;  5II2 A;  3Q2F A;  5CP5 A;  5IGM A;  4IOQ A;  4MR6 A;  4CFK A;  5F61 A;  5LKZ A;  4LYS A;  4N3W A;  5DLZ A;  5F36 A;  4HBV A;  4IR5 A;  5I29 A;  5AD3 A;  4LZS A;  5C8G A;  3JVJ A;  4NR5 A;  4NRB A;  4WIV A;  3HME A;  5EI4 A;  3O37 A;  5I80 A;  4YAB A;  5FE7 A;  4TTE A;  4ALH A;  4CFL A;  2H60 A;  5FH6 A;  3AAD A;  4Q0N A;  5D3H A;  5EWC A; 
#chains in the Genus database with same CATH homology
 4IOO A;  2MJV B;  4YAX A;  5DW1 A;  5CQT A;  4YYN A;  5BT4 A;  5LKX A;  1JM4 B;  5ENJ A;  5EPS A;  4NXJ A;  5DY7 A;  4QEW A;  3MQM A;  2WP2 A;  4A9J A;  4BW4 A;  4DON A;  4QYL A;  3SVF A;  3UVY A;  4QEU A;  5L99 A;  5HEN A;  4QB3 A;  4TZ8 A;  5TCM A;  3I3J A;  5CZG A;  3QZT A;  4UIV A;  5ACY A;  2DWW A;  5KO4 A;  4LYI A;  5DFD A;  3SVG A;  4YBT A;  3O34 A;  4PCI A;  5A83 A;  5LUU A;  4QYD A;  2E7N A;  3UVX A;  4O72 A;  4YBS A;  3G0J A;  4NR8 A;  5CQ7 A;  4UYH A;  5JI8 A;  4HBY A;  4LZR A;  3O36 A;  4QC1 A;  5EGU A;  1JSP B;  4O77 A;  5CRM A;  5I7Y A;  4HXP A;  5FE5 A;  5E3D A;  4NRA A;  4CUR A;  2RO1 A;  5F62 A;  3U5P A;  5A5R A;  5FFW A;  4PTB A;  5ETD A;  4UYF A;  4XY9 A;  2F6J A;  5C87 A;  5C7N A;  5D3L A;  3MB4 A;  5A85 A;  4O78 A;  5L96 A;  5I86 A;  5ENF A;  5F63 A;  5IG6 A;  5EV9 A;  5DX4 A;  5CPE A;  4O7A A;  5CUC A;  5E73 A;  4YYH A;  5L98 A;  5TB6 A;  4CUT A;  4TQN A;  3TLP A;  3P5O A;  5D7X A;  4CUS A;  5FE1 A;  4PCE A;  4N4G A;  4J1P A;  5LJ1 A;  4KCX A;  5D3J A;  2DAT A;  4GPJ A;  4YYM A;  4O74 A;  4XY8 A;  4TT4 A;  5D3T A;  5CUA A;  4HXK A;  4A9M A;  4NQN A;  4KV1 A;  4C66 A;  5D3S A;  4HXS A;  4TU6 A;  3HMH A;  4QST A;  4LR6 A;  4WHW A;  4YAT A;  5FBX A;  4NYW A;  1F68 A;  1X0J A;  4BW3 A;  4QSW A;  4XYA A;  5EWW A;  2E7O A;  3U5K A;  2DVS A;  4NS5 A;  5HRW A;  4UYG A;  3QZV A;  5CQ4 A;  5CQ8 A;  2WP1 A;  5HM0 A;  4YYG A;  2GRC A;  4PY6 A;  4ZW1 A;  5F25 A;  4LRG A;  2RI7 A;  5EM3 A;  5EWH A;  5H1T A;  4IR6 A;  5C85 A;  5IGL A;  5KTX A;  4Z6I A;  5HEM A;  4QSU A;  3GG3 A;  4UIU A;  4Z93 A;  5CFW A;  4NRC A;  3ONI A;  5CUE A;  5FE9 A;  2YQD A;  3UV2 A;  2F6N A;  5HQ6 A;  4AKN A;  5E9L A;  5IID A;  5FH8 A;  5H1V A;  4BW1 A;  4OUF A;  4HBW A;  4Q0O A;  3HMF A;  3IU5 A;  5FFY A;  4TT2 A;  4UYD A;  2DVQ A;  5ETB A;  5HCL A;  4O7B A;  5D0C A;  4MEP A;  4HXO A;  4UIT A;  5FE0 A;  4MEN A;  5EU1 A;  5FE4 A;  5DW2 A;  5EWV A;  4Z1S A;  2G4A A;  3U5O A;  5CRZ A;  2RFJ A;  4YH4 A;  5FH7 A;  4QUU A;  3DWY A;  2RNW A;  4O7F A;  4QC3 A;  5JWM A;  5I83 A;  4TT6 A;  5E74 A;  5J0D A;  2R0S A;  5AME A;  2DVR A;  5DYA A;  5A5S A;  2FSA A;  2R0V A;  5LVR A;  2I8N A;  4QR5 A;  4YYJ A;  5ENH A;  4HXR A;  5HEL A;  3LXJ A;  5HFR A;  5HQ5 A;  5I7X A;  4YK0 A;  4BW2 A;  5F1L A;  4YY4 A;  4NR6 A;  5D25 A;  5EVA A;  5KU3 A;  4J3I A;  2N9G A;  4O71 A;  5E7D A;  2R10 A;  4LDF A;  4NYV A;  4CL9 A;  5IGK A;  5HRV A;  4YBM A;  4QBM A;  5BT3 A;  5DBM A;  4YH3 A;  5K29 A;  4N4F A;  4RVR A;  5CGP A;  3S92 A;  4LYW A;  5ENB A;  4YAD A;  5DYC A;  5F2P A;  5LJ0 A;  4NR9 A;  5L8U A;  3QZS A;  4A9F A;  4QEV A;  2L85 A;  4UIW A;  4ZQL A;  5CQA A;  5FE8 A;  3NXB A;  4ALG A;  3P1C A;  4UYF B;  5E9Y A;  5II1 A;  5IGN A;  4Z6H A;  4MR3 A;  5KTU A;  5A5N A;  5D3R A;  2RS9 B;  5E9V A;  5FFV A;  2LSP B;  3G0L A;  4NQM A;  5CUG A;  5EQ1 A;  5E3G A;  5A7C A;  5F60 A;  4LC2 A;  3MUK A;  5FE2 A;  3UW9 A;  5C4Q A;  5EIC A;  4PKL A;  4WHU A;  5EPR A;  4YYD A;  1WUG A;  3O35 A;  2YW5 A;  2D82 A;  5I88 A;  2OSS A;  5DYX A;  3LQI A;  4HXN A;  5ENE A;  5FB1 A;  4A9O A;  4XUA A;  4MR4 A;  5HQ7 A;  2RNY A;  5EPB A;  4PS5 A;  4QZS A;  5G4S A;  4UIZ A;  5ENC A;  3SVH A;  5HJC A;  4KV4 A;  5CS8 A;  4IR4 A;  4OGJ A;  4MEQ A;  5E9M A;  5ENG A;  3UVD A;  4CUU A;  5DFC A;  4BHW A;  5G4R A;  5HLS A;  3IU6 A;  2L84 A;  3DAI A;  3LQH A;  5F3A A;  5CY9 A;  5EK9 A;  4CUQ A;  5A5Q A;  5KTW A;  4NUC A;  5LKT A;  5D3N A;  4YY6 A;  4QSX A;  3JVM A;  4TS8 A;  4YYI A;  4IR3 A;  5EWD A;  3UV5 A;  4MEO A;  5H85 A;  5CQ5 A;  5A5O A;  5DFB A;  2D9E A;  4NUD A;  5E9I A;  4QUT A;  4NR4 A;  4HXM A;  4QNS A;  3Q2E A;  5CU8 A;  4O76 A;  5DLX A;  5AMF A;  5A81 A;  5EIS A;  3S91 A;  3U5N A;  3P1E A;  4J0S A;  4N4I A;  5FE3 A;  3ZYU A;  4HXL A;  3O33 A;  4Y03 A;  5DKH A;  4NR7 A;  4QSP A;  5BT5 A;  5ENI A;  5CQ6 A;  4MR5 A;  4A9E A;  4QSQ A;  4QSV A;  2YEK A;  4CLB A;  4QSS A;  4TZ2 A;  2DKW A;  4XUB A;  5E0R A;  2E3K A;  3JVL A;  5FE6 A;  5CQ3 A;  4O7C A;  4NUE A;  2NXB A;  5A5P A;  5F5Z A;  3U5L A;  4QY4 A;  4A9H A;  1WUM A;  5F1H A;  5A82 A;  4C67 A;  4ZC9 A;  1ZS5 A;  5CUB A;  3D7C A;  2YDW A;  4NYX A;  4QSR A;  4YC9 A;  5FG6 A;  4A9K A;  4QR4 A;  5I89 A;  4X2I A;  5DKD A;  5HFQ A;  4OGI A;  3RCW A;  5EA1 A;  5D26 A;  5FDZ A;  5E9K A;  4IOR A;  4Z1Q A;  3LJW A;  4UIY A;  2R0Y A;  5I40 A;  5I1Q A;  3MUL A;  4HBX A;  3P1F A;  4N4H A;  5EP7 A;  1E6I A;  5LVQ A;  3JVK A;  3UV4 A;  5FB0 A;  5L8T A;  4E96 A;  5C89 A;  3LQJ A;  3P1D A;  5DYU A;  2OO1 A;  5LKU A;  4O75 A;  5FG5 A;  5FG4 A;  2OUO A;  2KTB B;  2I7K A;  4FLP A;  4CUP A;  3U5M A;  5CTL A;  3MB3 A;  5HRX A;  2RNX A;  2YEM A;  5DKC A;  4UIX A;  2YEL A;  3UVW A;  2YYN A;  4A9L A;  4A9N A;  4O70 A;  5CUD A;  4TU4 A;  1EQF A;  4UYE A;  4LZ2 A;  2DVV A;  5H1U A;  1N72 A;  4O7E A;  4A9I A;  5L97 A;  5COI A;  4J0R A;  3U5J A;  3AQA A;  5AD2 A;  4YYK A;  4QR3 A;  5D24 A;  4BJX A;  2L5E A;  4TYL A;  5D3P A;  3FKM X;  3MXF A;  3K2J A;  5KHM A;  5LJ2 A;  4F3I A;  5IBN A;  5II2 A;  3Q2F A;  5CP5 A;  5IGM A;  4IOQ A;  4MR6 A;  4CFK A;  5F61 A;  5LKZ A;  4LYS A;  4N3W A;  5DLZ A;  5F36 A;  4HBV A;  4IR5 A;  5I29 A;  5AD3 A;  4LZS A;  5C8G A;  3JVJ A;  4NR5 A;  4NRB A;  4WIV A;  3HME A;  5EI4 A;  3O37 A;  5I80 A;  4YAB A;  5FE7 A;  4TTE A;  4ALH A;  4CFL A;  2H60 A;  5FH6 A;  3AAD A;  4Q0N A;  5D3H A;  5EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...