4TT4A

Crystal structure of atad2a bromodomain complexed with h3(1-21)k14ac peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 55
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tt4A00
4QEVA 4Q0NA 4YADA 5FDZA 5E9YA 5HRXA 2OUOA 3ZYUA 5FE5A 5ENCA 3O33A 4Z6HA 4PCEA 4O71A 2I7KA 4PS5A 5FBXA 1JM4B 4NR6A 4ALHA 5FE8A 4WHWA 4MR6A 3K2JA 4C66A 5DW2A 2DVQA 4TS8A 4PKLA 5A7CA 5DLZA 5L97A 3P1FA 3I3JA 5C85A 4QSSA 4OUFA 3Q2EA 3MQMA 5A5PA 5E74A 5BT3A 3UVYA 4QC1A 3MXFA 3QZTA 4QSRA 5DKDA 3U5KA 5CZGA 5EM3A 5DYAA 5AD3A 4LZRA 3MB4A 2GRCA 4QBMA 4CUTA 4YBTA 4Q0OA 4YH3A 4A9OA 4QC3A 5E73A 5FH7A 5F2PA 5HEMA 4BW1A 5CGPA 5E3DA 4F3IA 2F6NA 4A9NA 3LJWA 2D82A 3SVHA 3DAIA 4QSQA 4LYWA 4NQNA 3P5OA 4IORA 5LJ1A 4TT6A 2R0YA 3JVJA 5LJ2A 5I1QA 4HBWA 4GPJA 4NUCA 4YC9A 4YYIA 4QYLA 5KTUA 5C7NA 3MULA 4A9LA 5CUBA 5EPRA 2N9GA 5IBNA 4QR5A 4QSWA 2DWWA 4YYNA 5DFCA 4LZSA 5H1VA 4NUDA 2KTBB 4YABA 5CQTA 2LSPB 5FG6A 4YYGA 4HXNA 4LR6A 5EVAA 5CY9A 5DW1A 4WIVA 5IGMA 5FFYA 5CQAA 5FE7A 3JVMA 2R10A 5A81A 5H1UA 2H60A 4HBYA 3SVFA 3LQHA 5CPEA 4O70A 1E6IA 4Z1SA 4IR4A 5FB0A 5FG4A 3U5LA 5KHMA 5EGUA 5CUAA 4QB3A 5E9IA 4BW3A 5TCMA 5LUUA 4NS5A 4IOQA 4QZSA 4KCXA 2DATA 5FE0A 5H1TA 5EPBA 5CRMA 5LVRA 5HLSA 4A9EA 3P1EA 3UVDA 5L98A 5D7XA 2YEKA 5DX4A 3MB3A 5EP7A 4UYEA 4O78A 4Y03A 5EU1A 3JVKA 4QR4A 5DYXA 4BW2A 4YK0A 3S91A 5LKUA 5FE1A 5KTXA 5CU8A 5E9LA 4A9KA 4ZC9A 5D25A 5ENFA 3UW9A 5E9VA 4UIUA 5EPSA 3D7CA 4O75A 5E7DA 4YBSA 5L8TA 5C4QA 4E96A 2OSSA 5D3LA 5LKTA 4J3IA 4O7BA 4QEWA 5EWHA 3O34A 5C89A 2E7NA 4UIXA 5I7YA 4N4IA 3SVGA 2G4AA 2L5EA 5ENHA 4A9FA 4ALGA 4NR7A 5I86A 5CRZA 5D0CA 4HXPA 2RO1A 5HQ7A 4N4HA 5CS8A 1WUMA 3FKMX 4A9JA 4ZW1A 4QSVA 3G0LA 2DVRA 5D3HA 5EV9A 2R0VA 4CFKA 5IGLA 4UYFB 5FFVA 5CFWA 5FE2A 4X2IA 4QSTA 4HXSA 4PTBA 5EI4A 5FH8A 5HELA 4TYLA 5ACYA 5L96A 5IIDA 5KTWA 4O74A 5A82A 4HBXA 5HM0A 5EWVA 2I8NA 4TZ8A 4TT2A 5E3GA 4NRCA 4OGIA 5LKZA 5EWWA 3O37A 2RFJA 4QUTA 4YYHA 4QSUA 3U5OA 4CUPA 4O7EA 5FH6A 4YH4A 4Z1QA 5FG5A 5DKCA 3U5MA 5F60A 5HRWA 4UYGA 5DBMA 4C67A 3P1CA 2D9EA 4NYWA 5G4SA 5LJ0A 4IR6A 4J1PA 4QEUA 2YYNA 2E7OA 4MEPA 5CP5A 2RNWA 4N4FA 5CQ8A 4OGJA 4O7AA 5HJCA 4N3WA 3U5PA 2L84A 3AQAA 5DYCA 4XUBA 5I88A 5FFWA 4HXMA 4PY6A 5FE6A 4LZ2A 5D24A 4XY9A 4QSXA 5AD2A 4ZQLA 4NQMA 3U5JA 5L99A 5F1LA 4TTEA 4CFLA 3O35A 2YW5A 4IOOA 3HMFA 2DVVA 5L8UA 4PCIA 5D3TA 4CL9A 4HXRA 5CTLA 4CUSA 5LKXA 5FE4A 4CUUA 5II1A 5COIA 4A9IA 5HENA 5CUGA 5DKHA 5HQ6A 4YYDA 5JI8A 2MJVB 5J0DA 5CQ4A 5D3RA 1X0JA 3U5NA 4LDFA 4HBVA 4HXOA 5EICA 5A85A 3HMEA 5A5QA 4UITA 4QYDA 5D3PA 1N72A 3DWYA 5EA1A 4IR3A 5CUDA 5KU3A 4O76A 5HCLA 4MEOA 4HXKA 4TU4A 4QSPA 5C8GA 5I40A 5EQ1A 4NRAA 4CURA 4NRBA 2DVSA 4Z93A 4YYKA 4RVRA 5A5NA 2YEMA 3GG3A 4YAXA 3UV2A 5CQ6A 4DONA 5F62A 5HQ5A 3QZVA 4CUQA 4QNSA 5DFDA 3MUKA 1WUGA 4UIZA 5F5ZA 5F61A 3S92A 3Q2FA 2WP1A 2RI7A 4YBMA 5F36A 4YYJA 4NR4A 5TB6A 4IR5A 5EISA 5EK9A 4UYFA 2F6JA 5A5OA 5ENBA 4TQNA 4WHUA 4MR3A 4TT4A 3IU5A 4XY8A 4LYSA 4A9HA 4NUEA 2L85A 5I89A 5D3SA 3TLPA 5E9MA 3LQJA 5F25A 1JSPB 3JVLA 5C87A 4MR5A 4YY4A 2YELA 4AKNA 5I29A 5BT5A 4NR8A 2NXBA 3NXBA 5ENGA 4HXLA 3UV4A 4MEQA 5A5RA 4NR5A 5F1HA 4UIVA 4UYDA 3O36A 3UVWA 5CQ7A 5DY7A 4NR9A 4KV1A 1EQFA 5AMEA 2WP2A 4NXJA 4O7CA 5ETBA 1F68A 4BHWA 5ETDA 5HRVA 3UVXA 4TU6A 4O7FA 5I80A 4J0RA 4YYMA 5JWMA 5CUCA 4MR4A 2RNYA 3LXJA 4MENA 5ENJA 3ONIA 5CQ5A 5E9KA 3RCWA 5FE9A 5K29A 2FSAA 4YY6A 5A83A 5ENEA 4LYIA 1ZS5A 3P1DA 4LRGA 4J0SA 4N4GA 4YATA 5DYUA 5DLXA 4Z6IA 5FE3A 5CQ3A 3G0JA 5H85A 4O77A 4FLPA 5F3AA 5FB1A 2E3KA 5IGNA 4NYVA 4LC2A 5I7XA 3UV5A 4KV4A 5D26A 4UIYA 5A5SA 2RS9B 5E0RA 5F63A 5IGKA 5HFRA 5D3NA 4QY4A 2R0SA 2DKWA 4QR3A 4QUUA 4TZ2A 5IG6A 5EWDA 4BW4A 2YQDA 3QZSA 2YDWA 4UIWA 5DFBA 3IU6A 3AADA 4A9MA 5HFQA 4BJXA 5LVQA 3LQIA 5BT4A 5CUEA 4O72A 3HMHA 4XYAA 5ENIA 4CLBA 5I83A 5D3JA 2OO1A 4XUAA 5EWCA 5II2A 5KO4A 5AMFA 4UYHA 2RNXA 5G4RA 4NYXA
chains in the Genus database with same CATH superfamily
4QEVA 4Q0NA 4YADA 5FDZA 5E9YA 5HRXA 2OUOA 3ZYUA 5FE5A 5ENCA 3O33A 4Z6HA 4PCEA 4O71A 2I7KA 4PS5A 5FBXA 1JM4B 4NR6A 4ALHA 5FE8A 4WHWA 4MR6A 3K2JA 4C66A 5DW2A 2DVQA 4TS8A 4PKLA 5A7CA 5DLZA 5L97A 3P1FA 3I3JA 5C85A 4QSSA 4OUFA 3Q2EA 3MQMA 5A5PA 5E74A 5BT3A 3UVYA 4QC1A 3MXFA 3QZTA 4QSRA 5DKDA 3U5KA 5CZGA 5EM3A 5DYAA 5AD3A 4LZRA 3MB4A 2GRCA 4QBMA 4CUTA 4YBTA 4Q0OA 4YH3A 4A9OA 4QC3A 5E73A 5FH7A 5F2PA 5HEMA 4BW1A 5CGPA 4AKGA 5E3DA 4F3IA 2F6NA 4A9NA 3LJWA 2D82A 3SVHA 2EJNA 3DAIA 4QSQA 4LYWA 4NQNA 3P5OA 4IORA 5LJ1A 4TT6A 2R0YA 3JVJA 5LJ2A 5I1QA 4HBWA 4GPJA 4NUCA 4AI6A 4YC9A 4YYIA 4QYLA 5KTUA 5C7NA 3MULA 4A9LA 5CUBA 5EPRA 2N9GA 5IBNA 4QR5A 4QSWA 2DWWA 4YYNA 5DFCA 4LZSA 5H1VA 4NUDA 2KTBB 4YABA 5CQTA 2LSPB 5FG6A 4YYGA 4HXNA 4LR6A 5EVAA 5CY9A 5DW1A 4WIVA 5IGMA 5FFYA 5CQAA 5FE7A 3JVMA 2R10A 5A81A 5H1UA 2H60A 4HBYA 3SVFA 3LQHA 5CPEA 4O70A 1E6IA 4Z1SA 4IR4A 5FB0A 5FG4A 3U5LA 5KHMA 5EGUA 5CUAA 4QB3A 5E9IA 4BW3A 5TCMA 5LUUA 4NS5A 4IOQA 4QZSA 4KCXA 2DATA 5FE0A 5H1TA 5EPBA 5CRMA 5LVRA 5HLSA 4A9EA 3P1EA 3UVDA 5L98A 5D7XA 2YEKA 5DX4A 3MB3A 5EP7A 4UYEA 4O78A 4Y03A 5EU1A 3JVKA 4QR4A 5DYXA 4BW2A 4YK0A 3S91A 5LKUA 5FE1A 5KTXA 5CU8A 5E9LA 4A9KA 4ZC9A 5D25A 3VKGA 5ENFA 3UW9A 5E9VA 4UIUA 5EPSA 3D7CA 4O75A 5E7DA 4YBSA 5L8TA 5C4QA 4E96A 2OSSA 5D3LA 5LKTA 4J3IA 4O7BA 4QEWA 5EWHA 3O34A 5C89A 2E7NA 4UIXA 5I7YA 4N4IA 3SVGA 2G4AA 2L5EA 5ENHA 4A9FA 4ALGA 4NR7A 5I86A 5CRZA 5D0CA 4HXPA 2RO1A 5HQ7A 5CS8A 4N4HA 1WUMA 3FKMX 4A9JA 4ZW1A 4QSVA 3G0LA 2DVRA 5D3HA 5EV9A 2R0VA 4CFKA 5IGLA 4UYFB 5FFVA 5CFWA 5FE2A 4X2IA 4QSTA 4HXSA 4PTBA 5EI4A 5FH8A 5HELA 4TYLA 5ACYA 5L96A 5IIDA 5KTWA 4O74A 5A82A 4HBXA 5HM0A 5EWVA 2I8NA 4TZ8A 4TT2A 5E3GA 4NRCA 4OGIA 3ERRA 5LKZA 5EWWA 3O37A 2RFJA 4QUTA 4YYHA 4QSUA 3D1BA 3U5OA 4CUPA 4O7EA 5FH6A 4YH4A 4Z1QA 5FG5A 5DKCA 3U5MA 5F60A 5HRWA 4UYGA 5DBMA 4C67A 3P1CA 2D9EA 4NYWA 5G4SA 5LJ0A 4IR6A 4J1PA 4QEUA 2YYNA 2E7OA 4MEPA 5CP5A 2RNWA 4N4FA 1ZKRA 5CQ8A 4OGJA 4O7AA 5HJCA 4N3WA 3U5PA 2L84A 3AQAA 5DYCA 4XUBA 5I88A 5FFWA 4HXMA 4PY6A 5FE6A 4LZ2A 5D24A 4XY9A 4QSXA 5AD2A 4ZQLA 4NQMA 3U5JA 5L99A 5F1LA 4TTEA 4CFLA 3O35A 2YW5A 4IOOA 3HMFA 2DVVA 5L8UA 4PCIA 5D3TA 4CL9A 4HXRA 5CTLA 4CUSA 5LKXA 5FE4A 4CUUA 5II1A 5COIA 4A9IA 5HENA 5CUGA 5DKHA 5HQ6A 4YYDA 5JI8A 2MJVB 5J0DA 5CQ4A 5D3RA 1X0JA 3U5NA 4LDFA 4HBVA 4HXOA 5EICA 5A85A 3HMEA 5A5QA 4UITA 4QYDA 5D3PA 1N72A 3DWYA 5EA1A 4AKHA 4IR3A 5CUDA 5KU3A 4O76A 5HCLA 4MEOA 4HXKA 4TU4A 4QSPA 5C8GA 5I40A 5EQ1A 4NRAA 4CURA 4NRBA 2DVSA 4Z93A 4YYKA 4RVRA 5A5NA 2YEMA 3GG3A 4YAXA 3UV2A 5CQ6A 4DONA 5F62A 5HQ5A 3QZVA 4CUQA 4QNSA 5DFDA 3MUKA 1WUGA 4UIZA 5F5ZA 5F61A 3S92A 3Q2FA 2WP1A 2RI7A 4YBMA 5F36A 4YYJA 4NR4A 5TB6A 4IR5A 5EISA 5EK9A 4UYFA 2F6JA 5A5OA 5ENBA 4TQNA 4WHUA 4MR3A 4TT4A 3IU5A 4XY8A 4LYSA 4A9HA 4NUEA 2L85A 5I89A 5D3SA 3TLPA 5E9MA 3LQJA 5F25A 1JSPB 3JVLA 5C87A 4MR5A 4YY4A 3VKHA 2YELA 4AKNA 5I29A 4AKIA 5BT5A 4NR8A 2NXBA 3NXBA 5ENGA 4HXLA 3UV4A 4MEQA 5A5RA 4NR5A 5F1HA 4UIVA 4UYDA 3O36A 3UVWA 5CQ7A 5DY7A 4NR9A 4KV1A 1EQFA 5AMEA 2WP2A 4NXJA 4O7CA 5ETBA 1F68A 4BHWA 5ETDA 5HRVA 3UVXA 4TU6A 4O7FA 5I80A 4J0RA 4YYMA 5JWMA 5CUCA 4MR4A 2RNYA 3LXJA 4MENA 5ENJA 3ONIA 5CQ5A 5E9KA 3RCWA 5FE9A 5K29A 2FSAA 4YY6A 5A83A 5ENEA 4LYIA 1ZS5A 3D1DA 3P1DA 4LRGA 4J0SA 4N4GA 4YATA 5DYUA 5DLXA 4Z6IA 5FE3A 5CQ3A 3G0JA 5H85A 4O77A 4FLPA 5F3AA 5FB1A 2E3KA 5IGNA 4NYVA 4LC2A 5I7XA 3UV5A 4KV4A 5D26A 4UIYA 5A5SA 2RS9B 5E0RA 5F63A 5IGKA 5HFRA 5D3NA 4QY4A 2R0SA 2DKWA 4QR3A 4QUUA 1PUOA 4TZ2A 5EWDA 5IG6A 4BW4A 2YQDA 3QZSA 2YDWA 4UIWA 5DFBA 3IU6A 3AADA 4A9MA 5HFQA 4BJXA 5LVQA 3LQIA 5BT4A 5CUEA 4O72A 3HMHA 4XYAA 5ENIA 4CLBA 5I83A 5D3JA 2OO1A 4XUAA 5EWCA 5II2A 5KO4A 5AMFA 4UYHA 2RNXA 5G4RA 4NYXA
chains in the Genus database with same CATH topology
4QEVA 4Q0NA 4YADA 5FDZA 5E9YA 5HRXA 2OUOA 3ZYUA 5FE5A 5ENCA 3O33A 4Z6HA 4PCEA 4O71A 2I7KA 4PS5A 5FBXA 1JM4B 4NR6A 4ALHA 5FE8A 4WHWA 4MR6A 3K2JA 4C66A 5DW2A 2DVQA 4TS8A 4PKLA 5A7CA 5DLZA 5L97A 3P1FA 3I3JA 5C85A 4QSSA 4OUFA 3Q2EA 3MQMA 5A5PA 5E74A 5BT3A 3UVYA 4QC1A 3MXFA 3QZTA 4QSRA 5DKDA 3U5KA 5CZGA 5EM3A 5DYAA 5AD3A 4LZRA 3MB4A 2GRCA 4QBMA 4CUTA 4YBTA 4Q0OA 4YH3A 4A9OA 4QC3A 5E73A 5FH7A 5F2PA 5HEMA 4BW1A 5CGPA 5E3DA 4F3IA 2F6NA 4A9NA 3LJWA 2D82A 3SVHA 3DAIA 4QSQA 4LYWA 4NQNA 3P5OA 4IORA 5LJ1A 4TT6A 2R0YA 3JVJA 5LJ2A 5I1QA 4HBWA 4GPJA 4NUCA 4YC9A 4YYIA 4QYLA 5KTUA 5C7NA 3MULA 4A9LA 5CUBA 5EPRA 2N9GA 5IBNA 4QR5A 4QSWA 2DWWA 4YYNA 5DFCA 4LZSA 5H1VA 4NUDA 2KTBB 4YABA 5CQTA 2LSPB 5FG6A 4YYGA 4HXNA 4LR6A 5EVAA 5CY9A 5DW1A 4WIVA 5IGMA 5FFYA 5CQAA 5FE7A 3JVMA 2R10A 5A81A 5H1UA 2H60A 4HBYA 3SVFA 3LQHA 5CPEA 4O70A 1E6IA 4Z1SA 4IR4A 5FB0A 5FG4A 3U5LA 5KHMA 5EGUA 5CUAA 4QB3A 5E9IA 4BW3A 5TCMA 5LUUA 4NS5A 4IOQA 4QZSA 4KCXA 2DATA 5FE0A 5H1TA 5EPBA 5CRMA 5LVRA 5HLSA 4A9EA 3P1EA 3UVDA 5L98A 5D7XA 2YEKA 5DX4A 3MB3A 5EP7A 4UYEA 4O78A 4Y03A 5EU1A 3JVKA 4QR4A 5DYXA 4BW2A 4YK0A 3S91A 5LKUA 5FE1A 5KTXA 5CU8A 5E9LA 4A9KA 4ZC9A 5D25A 5ENFA 3UW9A 5E9VA 4UIUA 5EPSA 3D7CA 4O75A 5E7DA 4YBSA 5L8TA 5C4QA 4E96A 2OSSA 5D3LA 5LKTA 4J3IA 4O7BA 4QEWA 5EWHA 3O34A 5C89A 2E7NA 4UIXA 5I7YA 4N4IA 3SVGA 2G4AA 2L5EA 5ENHA 4A9FA 4ALGA 4NR7A 5I86A 5CRZA 5D0CA 4HXPA 2RO1A 5HQ7A 4N4HA 5CS8A 1WUMA 3FKMX 4A9JA 4ZW1A 4QSVA 3G0LA 2DVRA 5D3HA 5EV9A 2R0VA 4CFKA 5IGLA 4UYFB 5FFVA 5CFWA 5FE2A 4X2IA 4QSTA 4HXSA 4PTBA 5EI4A 5FH8A 5HELA 4TYLA 5ACYA 5L96A 5IIDA 5KTWA 4O74A 5A82A 4HBXA 5HM0A 5EWVA 2I8NA 4TZ8A 4TT2A 5E3GA 4NRCA 4OGIA 5LKZA 5EWWA 3O37A 2RFJA 4QUTA 4YYHA 4QSUA 3U5OA 4CUPA 4O7EA 5FH6A 4YH4A 4Z1QA 5FG5A 5DKCA 3U5MA 5F60A 5HRWA 4UYGA 5DBMA 4C67A 3P1CA 2D9EA 4NYWA 5G4SA 5LJ0A 4IR6A 4J1PA 4QEUA 2YYNA 2E7OA 4MEPA 5CP5A 2RNWA 4N4FA 5CQ8A 4OGJA 4O7AA 5HJCA 4N3WA 3U5PA 2L84A 3AQAA 5DYCA 4XUBA 5I88A 5FFWA 4HXMA 4PY6A 5FE6A 4LZ2A 5D24A 4XY9A 4QSXA 5AD2A 4ZQLA 4NQMA 3U5JA 5L99A 5F1LA 4TTEA 4CFLA 3O35A 2YW5A 4IOOA 3HMFA 2DVVA 5L8UA 4PCIA 5D3TA 4CL9A 4HXRA 5CTLA 4CUSA 5LKXA 5FE4A 4CUUA 5II1A 5COIA 4A9IA 5HENA 5CUGA 5DKHA 5HQ6A 4YYDA 5JI8A 2MJVB 5J0DA 5CQ4A 5D3RA 1X0JA 3U5NA 4LDFA 4HBVA 4HXOA 5EICA 5A85A 3HMEA 5A5QA 4UITA 4QYDA 5D3PA 1N72A 3DWYA 5EA1A 4IR3A 5CUDA 5KU3A 4O76A 5HCLA 4MEOA 4HXKA 4TU4A 4QSPA 5C8GA 5I40A 5EQ1A 4NRAA 4CURA 4NRBA 2DVSA 4Z93A 4YYKA 4RVRA 5A5NA 2YEMA 3GG3A 4YAXA 3UV2A 5CQ6A 4DONA 5F62A 5HQ5A 3QZVA 4CUQA 4QNSA 5DFDA 3MUKA 1WUGA 4UIZA 5F5ZA 5F61A 3S92A 3Q2FA 2WP1A 2RI7A 4YBMA 5F36A 4YYJA 4NR4A 5TB6A 4IR5A 5EISA 5EK9A 4UYFA 2F6JA 5A5OA 5ENBA 4TQNA 4WHUA 4MR3A 4TT4A 3IU5A 4XY8A 4LYSA 4A9HA 4NUEA 2L85A 5I89A 5D3SA 3TLPA 5E9MA 3LQJA 5F25A 1JSPB 3JVLA 5C87A 4MR5A 4YY4A 2YELA 4AKNA 5I29A 5BT5A 4NR8A 2NXBA 3NXBA 5ENGA 4HXLA 3UV4A 4MEQA 5A5RA 4NR5A 5F1HA 4UIVA 4UYDA 3O36A 3UVWA 5CQ7A 5DY7A 4NR9A 4KV1A 1EQFA 5AMEA 2WP2A 4NXJA 4O7CA 5ETBA 1F68A 4BHWA 5ETDA 5HRVA 3UVXA 4TU6A 4O7FA 5I80A 4J0RA 4YYMA 5JWMA 5CUCA 4MR4A 2RNYA 3LXJA 4MENA 5ENJA 3ONIA 5CQ5A 5E9KA 3RCWA 5FE9A 5K29A 2FSAA 4YY6A 5A83A 5ENEA 4LYIA 1ZS5A 3P1DA 4LRGA 4J0SA 4N4GA 4YATA 5DYUA 5DLXA 4Z6IA 5FE3A 5CQ3A 3G0JA 5H85A 4O77A 4FLPA 5F3AA 5FB1A 2E3KA 5IGNA 4NYVA 4LC2A 5I7XA 3UV5A 4KV4A 5D26A 4UIYA 5A5SA 2RS9B 5E0RA 5F63A 5IGKA 5HFRA 5D3NA 4QY4A 2R0SA 2DKWA 4QR3A 4QUUA 4TZ2A 5IG6A 5EWDA 4BW4A 2YQDA 3QZSA 2YDWA 4UIWA 5DFBA 3IU6A 3AADA 4A9MA 5HFQA 4BJXA 5LVQA 3LQIA 5BT4A 5CUEA 4O72A 3HMHA 4XYAA 5ENIA 4CLBA 5I83A 5D3JA 2OO1A 4XUAA 5EWCA 5II2A 5KO4A 5AMFA 4UYHA 2RNXA 5G4RA 4NYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QEV A;  4Q0N A;  4YAD A;  5FDZ A;  5E9Y A;  5HRX A;  2OUO A;  3ZYU A;  5FE5 A;  5ENC A;  3O33 A;  4Z6H A;  4PCE A;  4O71 A;  2I7K A;  4PS5 A;  5FBX A;  1JM4 B;  4NR6 A;  4ALH A;  5FE8 A;  4WHW A;  4MR6 A;  3K2J A;  4C66 A;  5DW2 A;  2DVQ A;  4TS8 A;  4PKL A;  5A7C A;  5DLZ A;  5L97 A;  3P1F A;  3I3J A;  5C85 A;  4QSS A;  4OUF A;  3Q2E A;  3MQM A;  5A5P A;  5E74 A;  5BT3 A;  3UVY A;  4QC1 A;  3MXF A;  3QZT A;  4QSR A;  5DKD A;  3U5K A;  5CZG A;  5EM3 A;  5DYA A;  5AD3 A;  4LZR A;  3MB4 A;  2GRC A;  4QBM A;  4CUT A;  4YBT A;  4Q0O A;  4YH3 A;  4A9O A;  4QC3 A;  5E73 A;  5FH7 A;  5F2P A;  5HEM A;  4BW1 A;  5CGP A;  5E3D A;  4F3I A;  2F6N A;  4A9N A;  3LJW A;  2D82 A;  3SVH A;  3DAI A;  4QSQ A;  4LYW A;  4NQN A;  3P5O A;  4IOR A;  5LJ1 A;  4TT6 A;  2R0Y A;  3JVJ A;  5LJ2 A;  5I1Q A;  4HBW A;  4GPJ A;  4NUC A;  4YC9 A;  4YYI A;  4QYL A;  5KTU A;  5C7N A;  3MUL A;  4A9L A;  5CUB A;  5EPR A;  2N9G A;  5IBN A;  4QR5 A;  4QSW A;  2DWW A;  4YYN A;  5DFC A;  4LZS A;  5H1V A;  4NUD A;  2KTB B;  4YAB A;  5CQT A;  2LSP B;  5FG6 A;  4YYG A;  4HXN A;  4LR6 A;  5EVA A;  5CY9 A;  5DW1 A;  4WIV A;  5IGM A;  5FFY A;  5CQA A;  5FE7 A;  3JVM A;  2R10 A;  5A81 A;  5H1U A;  2H60 A;  4HBY A;  3SVF A;  3LQH A;  5CPE A;  4O70 A;  1E6I A;  4Z1S A;  4IR4 A;  5FB0 A;  5FG4 A;  3U5L A;  5KHM A;  5EGU A;  5CUA A;  4QB3 A;  5E9I A;  4BW3 A;  5TCM A;  5LUU A;  4NS5 A;  4IOQ A;  4QZS A;  4KCX A;  2DAT A;  5FE0 A;  5H1T A;  5EPB A;  5CRM A;  5LVR A;  5HLS A;  4A9E A;  3P1E A;  3UVD A;  5L98 A;  5D7X A;  2YEK A;  5DX4 A;  3MB3 A;  5EP7 A;  4UYE A;  4O78 A;  4Y03 A;  5EU1 A;  3JVK A;  4QR4 A;  5DYX A;  4BW2 A;  4YK0 A;  3S91 A;  5LKU A;  5FE1 A;  5KTX A;  5CU8 A;  5E9L A;  4A9K A;  4ZC9 A;  5D25 A;  5ENF A;  3UW9 A;  5E9V A;  4UIU A;  5EPS A;  3D7C A;  4O75 A;  5E7D A;  4YBS A;  5L8T A;  5C4Q A;  4E96 A;  2OSS A;  5D3L A;  5LKT A;  4J3I A;  4O7B A;  4QEW A;  5EWH A;  3O34 A;  5C89 A;  2E7N A;  4UIX A;  5I7Y A;  4N4I A;  3SVG A;  2G4A A;  2L5E A;  5ENH A;  4A9F A;  4ALG A;  4NR7 A;  5I86 A;  5CRZ A;  5D0C A;  4HXP A;  2RO1 A;  5HQ7 A;  4N4H A;  5CS8 A;  1WUM A;  3FKM X;  4A9J A;  4ZW1 A;  4QSV A;  3G0L A;  2DVR A;  5D3H A;  5EV9 A;  2R0V A;  4CFK A;  5IGL A;  4UYF B;  5FFV A;  5CFW A;  5FE2 A;  4X2I A;  4QST A;  4HXS A;  4PTB A;  5EI4 A;  5FH8 A;  5HEL A;  4TYL A;  5ACY A;  5L96 A;  5IID A;  5KTW A;  4O74 A;  5A82 A;  4HBX A;  5HM0 A;  5EWV A;  2I8N A;  4TZ8 A;  4TT2 A;  5E3G A;  4NRC A;  4OGI A;  5LKZ A;  5EWW A;  3O37 A;  2RFJ A;  4QUT A;  4YYH A;  4QSU A;  3U5O A;  4CUP A;  4O7E A;  5FH6 A;  4YH4 A;  4Z1Q A;  5FG5 A;  5DKC A;  3U5M A;  5F60 A;  5HRW A;  4UYG A;  5DBM A;  4C67 A;  3P1C A;  2D9E A;  4NYW A;  5G4S A;  5LJ0 A;  4IR6 A;  4J1P A;  4QEU A;  2YYN A;  2E7O A;  4MEP A;  5CP5 A;  2RNW A;  4N4F A;  5CQ8 A;  4OGJ A;  4O7A A;  5HJC A;  4N3W A;  3U5P A;  2L84 A;  3AQA A;  5DYC A;  4XUB A;  5I88 A;  5FFW A;  4HXM A;  4PY6 A;  5FE6 A;  4LZ2 A;  5D24 A;  4XY9 A;  4QSX A;  5AD2 A;  4ZQL A;  4NQM A;  3U5J A;  5L99 A;  5F1L A;  4TTE A;  4CFL A;  3O35 A;  2YW5 A;  4IOO A;  3HMF A;  2DVV A;  5L8U A;  4PCI A;  5D3T A;  4CL9 A;  4HXR A;  5CTL A;  4CUS A;  5LKX A;  5FE4 A;  4CUU A;  5II1 A;  5COI A;  4A9I A;  5HEN A;  5CUG A;  5DKH A;  5HQ6 A;  4YYD A;  5JI8 A;  2MJV B;  5J0D A;  5CQ4 A;  5D3R A;  1X0J A;  3U5N A;  4LDF A;  4HBV A;  4HXO A;  5EIC A;  5A85 A;  3HME A;  5A5Q A;  4UIT A;  4QYD A;  5D3P A;  1N72 A;  3DWY A;  5EA1 A;  4IR3 A;  5CUD A;  5KU3 A;  4O76 A;  5HCL A;  4MEO A;  4HXK A;  4TU4 A;  4QSP A;  5C8G A;  5I40 A;  5EQ1 A;  4NRA A;  4CUR A;  4NRB A;  2DVS A;  4Z93 A;  4YYK A;  4RVR A;  5A5N A;  2YEM A;  3GG3 A;  4YAX A;  3UV2 A;  5CQ6 A;  4DON A;  5F62 A;  5HQ5 A;  3QZV A;  4CUQ A;  4QNS A;  5DFD A;  3MUK A;  1WUG A;  4UIZ A;  5F5Z A;  5F61 A;  3S92 A;  3Q2F A;  2WP1 A;  2RI7 A;  4YBM A;  5F36 A;  4YYJ A;  4NR4 A;  5TB6 A;  4IR5 A;  5EIS A;  5EK9 A;  4UYF A;  2F6J A;  5A5O A;  5ENB A;  4TQN A;  4WHU A;  4MR3 A;  4TT4 A;  3IU5 A;  4XY8 A;  4LYS A;  4A9H A;  4NUE A;  2L85 A;  5I89 A;  5D3S A;  3TLP A;  5E9M A;  3LQJ A;  5F25 A;  1JSP B;  3JVL A;  5C87 A;  4MR5 A;  4YY4 A;  2YEL A;  4AKN A;  5I29 A;  5BT5 A;  4NR8 A;  2NXB A;  3NXB A;  5ENG A;  4HXL A;  3UV4 A;  4MEQ A;  5A5R A;  4NR5 A;  5F1H A;  4UIV A;  4UYD A;  3O36 A;  3UVW A;  5CQ7 A;  5DY7 A;  4NR9 A;  4KV1 A;  1EQF A;  5AME A;  2WP2 A;  4NXJ A;  4O7C A;  5ETB A;  1F68 A;  4BHW A;  5ETD A;  5HRV A;  3UVX A;  4TU6 A;  4O7F A;  5I80 A;  4J0R A;  4YYM A;  5JWM A;  5CUC A;  4MR4 A;  2RNY A;  3LXJ A;  4MEN A;  5ENJ A;  3ONI A;  5CQ5 A;  5E9K A;  3RCW A;  5FE9 A;  5K29 A;  2FSA A;  4YY6 A;  5A83 A;  5ENE A;  4LYI A;  1ZS5 A;  3P1D A;  4LRG A;  4J0S A;  4N4G A;  4YAT A;  5DYU A;  5DLX A;  4Z6I A;  5FE3 A;  5CQ3 A;  3G0J A;  5H85 A;  4O77 A;  4FLP A;  5F3A A;  5FB1 A;  2E3K A;  5IGN A;  4NYV A;  4LC2 A;  5I7X A;  3UV5 A;  4KV4 A;  5D26 A;  4UIY A;  5A5S A;  2RS9 B;  5E0R A;  5F63 A;  5IGK A;  5HFR A;  5D3N A;  4QY4 A;  2R0S A;  2DKW A;  4QR3 A;  4QUU A;  4TZ2 A;  5IG6 A;  5EWD A;  4BW4 A;  2YQD A;  3QZS A;  2YDW A;  4UIW A;  5DFB A;  3IU6 A;  3AAD A;  4A9M A;  5HFQ A;  4BJX A;  5LVQ A;  3LQI A;  5BT4 A;  5CUE A;  4O72 A;  3HMH A;  4XYA A;  5ENI A;  4CLB A;  5I83 A;  5D3J A;  2OO1 A;  4XUA A;  5EWC A;  5II2 A;  5KO4 A;  5AMF A;  4UYH A;  2RNX A;  5G4R A;  4NYX A; 
#chains in the Genus database with same CATH topology
 4QEV A;  4Q0N A;  4YAD A;  5FDZ A;  5E9Y A;  5HRX A;  2OUO A;  3ZYU A;  5FE5 A;  5ENC A;  3O33 A;  4Z6H A;  4PCE A;  4O71 A;  2I7K A;  4PS5 A;  5FBX A;  1JM4 B;  4NR6 A;  4ALH A;  5FE8 A;  4WHW A;  4MR6 A;  3K2J A;  4C66 A;  5DW2 A;  2DVQ A;  4TS8 A;  4PKL A;  5A7C A;  5DLZ A;  5L97 A;  3P1F A;  3I3J A;  5C85 A;  4QSS A;  4OUF A;  3Q2E A;  3MQM A;  5A5P A;  5E74 A;  5BT3 A;  3UVY A;  4QC1 A;  3MXF A;  3QZT A;  4QSR A;  5DKD A;  3U5K A;  5CZG A;  5EM3 A;  5DYA A;  5AD3 A;  4LZR A;  3MB4 A;  2GRC A;  4QBM A;  4CUT A;  4YBT A;  4Q0O A;  4YH3 A;  4A9O A;  4QC3 A;  5E73 A;  5FH7 A;  5F2P A;  5HEM A;  4BW1 A;  5CGP A;  4AKG A;  5E3D A;  4F3I A;  2F6N A;  4A9N A;  3LJW A;  2D82 A;  3SVH A;  2EJN A;  3DAI A;  4QSQ A;  4LYW A;  4NQN A;  3P5O A;  4IOR A;  5LJ1 A;  4TT6 A;  2R0Y A;  3JVJ A;  5LJ2 A;  5I1Q A;  4HBW A;  4GPJ A;  4NUC A;  4AI6 A;  4YC9 A;  4YYI A;  4QYL A;  5KTU A;  5C7N A;  3MUL A;  4A9L A;  5CUB A;  5EPR A;  2N9G A;  5IBN A;  4QR5 A;  4QSW A;  2DWW A;  4YYN A;  5DFC A;  4LZS A;  5H1V A;  4NUD A;  2KTB B;  4YAB A;  5CQT A;  2LSP B;  5FG6 A;  4YYG A;  4HXN A;  4LR6 A;  5EVA A;  5CY9 A;  5DW1 A;  4WIV A;  5IGM A;  5FFY A;  5CQA A;  5FE7 A;  3JVM A;  2R10 A;  5A81 A;  5H1U A;  2H60 A;  4HBY A;  3SVF A;  3LQH A;  5CPE A;  4O70 A;  1E6I A;  4Z1S A;  4IR4 A;  5FB0 A;  5FG4 A;  3U5L A;  5KHM A;  5EGU A;  5CUA A;  4QB3 A;  5E9I A;  4BW3 A;  5TCM A;  5LUU A;  4NS5 A;  4IOQ A;  4QZS A;  4KCX A;  2DAT A;  5FE0 A;  5H1T A;  5EPB A;  5CRM A;  5LVR A;  5HLS A;  4A9E A;  3P1E A;  3UVD A;  5L98 A;  5D7X A;  2YEK A;  5DX4 A;  3MB3 A;  5EP7 A;  4UYE A;  4O78 A;  4Y03 A;  5EU1 A;  3JVK A;  4QR4 A;  5DYX A;  4BW2 A;  4YK0 A;  3S91 A;  5LKU A;  5FE1 A;  5KTX A;  5CU8 A;  5E9L A;  4A9K A;  4ZC9 A;  5D25 A;  3VKG A;  5ENF A;  3UW9 A;  5E9V A;  4UIU A;  5EPS A;  3D7C A;  4O75 A;  5E7D A;  4YBS A;  5L8T A;  5C4Q A;  4E96 A;  2OSS A;  5D3L A;  5LKT A;  4J3I A;  4O7B A;  4QEW A;  5EWH A;  3O34 A;  5C89 A;  2E7N A;  4UIX A;  5I7Y A;  4N4I A;  3SVG A;  2G4A A;  2L5E A;  5ENH A;  4A9F A;  4ALG A;  4NR7 A;  5I86 A;  5CRZ A;  5D0C A;  4HXP A;  2RO1 A;  5HQ7 A;  5CS8 A;  4N4H A;  1WUM A;  3FKM X;  4A9J A;  4ZW1 A;  4QSV A;  3G0L A;  2DVR A;  5D3H A;  5EV9 A;  2R0V A;  4CFK A;  5IGL A;  4UYF B;  5FFV A;  5CFW A;  5FE2 A;  4X2I A;  4QST A;  4HXS A;  4PTB A;  5EI4 A;  5FH8 A;  5HEL A;  4TYL A;  5ACY A;  5L96 A;  5IID A;  5KTW A;  4O74 A;  5A82 A;  4HBX A;  5HM0 A;  5EWV A;  2I8N A;  4TZ8 A;  4TT2 A;  5E3G A;  4NRC A;  4OGI A;  3ERR A;  5LKZ A;  5EWW A;  3O37 A;  2RFJ A;  4QUT A;  4YYH A;  4QSU A;  3D1B A;  3U5O A;  4CUP A;  4O7E A;  5FH6 A;  4YH4 A;  4Z1Q A;  5FG5 A;  5DKC A;  3U5M A;  5F60 A;  5HRW A;  4UYG A;  5DBM A;  4C67 A;  3P1C A;  2D9E A;  4NYW A;  5G4S A;  5LJ0 A;  4IR6 A;  4J1P A;  4QEU A;  2YYN A;  2E7O A;  4MEP A;  5CP5 A;  2RNW A;  4N4F A;  1ZKR A;  5CQ8 A;  4OGJ A;  4O7A A;  5HJC A;  4N3W A;  3U5P A;  2L84 A;  3AQA A;  5DYC A;  4XUB A;  5I88 A;  5FFW A;  4HXM A;  4PY6 A;  5FE6 A;  4LZ2 A;  5D24 A;  4XY9 A;  4QSX A;  5AD2 A;  4ZQL A;  4NQM A;  3U5J A;  5L99 A;  5F1L A;  4TTE A;  4CFL A;  3O35 A;  2YW5 A;  4IOO A;  3HMF A;  2DVV A;  5L8U A;  4PCI A;  5D3T A;  4CL9 A;  4HXR A;  5CTL A;  4CUS A;  5LKX A;  5FE4 A;  4CUU A;  5II1 A;  5COI A;  4A9I A;  5HEN A;  5CUG A;  5DKH A;  5HQ6 A;  4YYD A;  5JI8 A;  2MJV B;  5J0D A;  5CQ4 A;  5D3R A;  1X0J A;  3U5N A;  4LDF A;  4HBV A;  4HXO A;  5EIC A;  5A85 A;  3HME A;  5A5Q A;  4UIT A;  4QYD A;  5D3P A;  1N72 A;  3DWY A;  5EA1 A;  4AKH A;  4IR3 A;  5CUD A;  5KU3 A;  4O76 A;  5HCL A;  4MEO A;  4HXK A;  4TU4 A;  4QSP A;  5C8G A;  5I40 A;  5EQ1 A;  4NRA A;  4CUR A;  4NRB A;  2DVS A;  4Z93 A;  4YYK A;  4RVR A;  5A5N A;  2YEM A;  3GG3 A;  4YAX A;  3UV2 A;  5CQ6 A;  4DON A;  5F62 A;  5HQ5 A;  3QZV A;  4CUQ A;  4QNS A;  5DFD A;  3MUK A;  1WUG A;  4UIZ A;  5F5Z A;  5F61 A;  3S92 A;  3Q2F A;  2WP1 A;  2RI7 A;  4YBM A;  5F36 A;  4YYJ A;  4NR4 A;  5TB6 A;  4IR5 A;  5EIS A;  5EK9 A;  4UYF A;  2F6J A;  5A5O A;  5ENB A;  4TQN A;  4WHU A;  4MR3 A;  4TT4 A;  3IU5 A;  4XY8 A;  4LYS A;  4A9H A;  4NUE A;  2L85 A;  5I89 A;  5D3S A;  3TLP A;  5E9M A;  3LQJ A;  5F25 A;  1JSP B;  3JVL A;  5C87 A;  4MR5 A;  4YY4 A;  3VKH A;  2YEL A;  4AKN A;  5I29 A;  4AKI A;  5BT5 A;  4NR8 A;  2NXB A;  3NXB A;  5ENG A;  4HXL A;  3UV4 A;  4MEQ A;  5A5R A;  4NR5 A;  5F1H A;  4UIV A;  4UYD A;  3O36 A;  3UVW A;  5CQ7 A;  5DY7 A;  4NR9 A;  4KV1 A;  1EQF A;  5AME A;  2WP2 A;  4NXJ A;  4O7C A;  5ETB A;  1F68 A;  4BHW A;  5ETD A;  5HRV A;  3UVX A;  4TU6 A;  4O7F A;  5I80 A;  4J0R A;  4YYM A;  5JWM A;  5CUC A;  4MR4 A;  2RNY A;  3LXJ A;  4MEN A;  5ENJ A;  3ONI A;  5CQ5 A;  5E9K A;  3RCW A;  5FE9 A;  5K29 A;  2FSA A;  4YY6 A;  5A83 A;  5ENE A;  4LYI A;  1ZS5 A;  3D1D A;  3P1D A;  4LRG A;  4J0S A;  4N4G A;  4YAT A;  5DYU A;  5DLX A;  4Z6I A;  5FE3 A;  5CQ3 A;  3G0J A;  5H85 A;  4O77 A;  4FLP A;  5F3A A;  5FB1 A;  2E3K A;  5IGN A;  4NYV A;  4LC2 A;  5I7X A;  3UV5 A;  4KV4 A;  5D26 A;  4UIY A;  5A5S A;  2RS9 B;  5E0R A;  5F63 A;  5IGK A;  5HFR A;  5D3N A;  4QY4 A;  2R0S A;  2DKW A;  4QR3 A;  4QUU A;  1PUO A;  4TZ2 A;  5EWD A;  5IG6 A;  4BW4 A;  2YQD A;  3QZS A;  2YDW A;  4UIW A;  5DFB A;  3IU6 A;  3AAD A;  4A9M A;  5HFQ A;  4BJX A;  5LVQ A;  3LQI A;  5BT4 A;  5CUE A;  4O72 A;  3HMH A;  4XYA A;  5ENI A;  4CLB A;  5I83 A;  5D3J A;  2OO1 A;  4XUA A;  5EWC A;  5II2 A;  5KO4 A;  5AMF A;  4UYH A;  2RNX A;  5G4R A;  4NYX A; 
#chains in the Genus database with same CATH homology
 4QEV A;  4Q0N A;  4YAD A;  5FDZ A;  5E9Y A;  5HRX A;  2OUO A;  3ZYU A;  5FE5 A;  5ENC A;  3O33 A;  4Z6H A;  4PCE A;  4O71 A;  2I7K A;  4PS5 A;  5FBX A;  1JM4 B;  4NR6 A;  4ALH A;  5FE8 A;  4WHW A;  4MR6 A;  3K2J A;  4C66 A;  5DW2 A;  2DVQ A;  4TS8 A;  4PKL A;  5A7C A;  5DLZ A;  5L97 A;  3P1F A;  3I3J A;  5C85 A;  4QSS A;  4OUF A;  3Q2E A;  3MQM A;  5A5P A;  5E74 A;  5BT3 A;  3UVY A;  4QC1 A;  3MXF A;  3QZT A;  4QSR A;  5DKD A;  3U5K A;  5CZG A;  5EM3 A;  5DYA A;  5AD3 A;  4LZR A;  3MB4 A;  2GRC A;  4QBM A;  4CUT A;  4YBT A;  4Q0O A;  4YH3 A;  4A9O A;  4QC3 A;  5E73 A;  5FH7 A;  5F2P A;  5HEM A;  4BW1 A;  5CGP A;  5E3D A;  4F3I A;  2F6N A;  4A9N A;  3LJW A;  2D82 A;  3SVH A;  3DAI A;  4QSQ A;  4LYW A;  4NQN A;  3P5O A;  4IOR A;  5LJ1 A;  4TT6 A;  2R0Y A;  3JVJ A;  5LJ2 A;  5I1Q A;  4HBW A;  4GPJ A;  4NUC A;  4YC9 A;  4YYI A;  4QYL A;  5KTU A;  5C7N A;  3MUL A;  4A9L A;  5CUB A;  5EPR A;  2N9G A;  5IBN A;  4QR5 A;  4QSW A;  2DWW A;  4YYN A;  5DFC A;  4LZS A;  5H1V A;  4NUD A;  2KTB B;  4YAB A;  5CQT A;  2LSP B;  5FG6 A;  4YYG A;  4HXN A;  4LR6 A;  5EVA A;  5CY9 A;  5DW1 A;  4WIV A;  5IGM A;  5FFY A;  5CQA A;  5FE7 A;  3JVM A;  2R10 A;  5A81 A;  5H1U A;  2H60 A;  4HBY A;  3SVF A;  3LQH A;  5CPE A;  4O70 A;  1E6I A;  4Z1S A;  4IR4 A;  5FB0 A;  5FG4 A;  3U5L A;  5KHM A;  5EGU A;  5CUA A;  4QB3 A;  5E9I A;  4BW3 A;  5TCM A;  5LUU A;  4NS5 A;  4IOQ A;  4QZS A;  4KCX A;  2DAT A;  5FE0 A;  5H1T A;  5EPB A;  5CRM A;  5LVR A;  5HLS A;  4A9E A;  3P1E A;  3UVD A;  5L98 A;  5D7X A;  2YEK A;  5DX4 A;  3MB3 A;  5EP7 A;  4UYE A;  4O78 A;  4Y03 A;  5EU1 A;  3JVK A;  4QR4 A;  5DYX A;  4BW2 A;  4YK0 A;  3S91 A;  5LKU A;  5FE1 A;  5KTX A;  5CU8 A;  5E9L A;  4A9K A;  4ZC9 A;  5D25 A;  5ENF A;  3UW9 A;  5E9V A;  4UIU A;  5EPS A;  3D7C A;  4O75 A;  5E7D A;  4YBS A;  5L8T A;  5C4Q A;  4E96 A;  2OSS A;  5D3L A;  5LKT A;  4J3I A;  4O7B A;  4QEW A;  5EWH A;  3O34 A;  5C89 A;  2E7N A;  4UIX A;  5I7Y A;  4N4I A;  3SVG A;  2G4A A;  2L5E A;  5ENH A;  4A9F A;  4ALG A;  4NR7 A;  5I86 A;  5CRZ A;  5D0C A;  4HXP A;  2RO1 A;  5HQ7 A;  4N4H A;  5CS8 A;  1WUM A;  3FKM X;  4A9J A;  4ZW1 A;  4QSV A;  3G0L A;  2DVR A;  5D3H A;  5EV9 A;  2R0V A;  4CFK A;  5IGL A;  4UYF B;  5FFV A;  5CFW A;  5FE2 A;  4X2I A;  4QST A;  4HXS A;  4PTB A;  5EI4 A;  5FH8 A;  5HEL A;  4TYL A;  5ACY A;  5L96 A;  5IID A;  5KTW A;  4O74 A;  5A82 A;  4HBX A;  5HM0 A;  5EWV A;  2I8N A;  4TZ8 A;  4TT2 A;  5E3G A;  4NRC A;  4OGI A;  5LKZ A;  5EWW A;  3O37 A;  2RFJ A;  4QUT A;  4YYH A;  4QSU A;  3U5O A;  4CUP A;  4O7E A;  5FH6 A;  4YH4 A;  4Z1Q A;  5FG5 A;  5DKC A;  3U5M A;  5F60 A;  5HRW A;  4UYG A;  5DBM A;  4C67 A;  3P1C A;  2D9E A;  4NYW A;  5G4S A;  5LJ0 A;  4IR6 A;  4J1P A;  4QEU A;  2YYN A;  2E7O A;  4MEP A;  5CP5 A;  2RNW A;  4N4F A;  5CQ8 A;  4OGJ A;  4O7A A;  5HJC A;  4N3W A;  3U5P A;  2L84 A;  3AQA A;  5DYC A;  4XUB A;  5I88 A;  5FFW A;  4HXM A;  4PY6 A;  5FE6 A;  4LZ2 A;  5D24 A;  4XY9 A;  4QSX A;  5AD2 A;  4ZQL A;  4NQM A;  3U5J A;  5L99 A;  5F1L A;  4TTE A;  4CFL A;  3O35 A;  2YW5 A;  4IOO A;  3HMF A;  2DVV A;  5L8U A;  4PCI A;  5D3T A;  4CL9 A;  4HXR A;  5CTL A;  4CUS A;  5LKX A;  5FE4 A;  4CUU A;  5II1 A;  5COI A;  4A9I A;  5HEN A;  5CUG A;  5DKH A;  5HQ6 A;  4YYD A;  5JI8 A;  2MJV B;  5J0D A;  5CQ4 A;  5D3R A;  1X0J A;  3U5N A;  4LDF A;  4HBV A;  4HXO A;  5EIC A;  5A85 A;  3HME A;  5A5Q A;  4UIT A;  4QYD A;  5D3P A;  1N72 A;  3DWY A;  5EA1 A;  4IR3 A;  5CUD A;  5KU3 A;  4O76 A;  5HCL A;  4MEO A;  4HXK A;  4TU4 A;  4QSP A;  5C8G A;  5I40 A;  5EQ1 A;  4NRA A;  4CUR A;  4NRB A;  2DVS A;  4Z93 A;  4YYK A;  4RVR A;  5A5N A;  2YEM A;  3GG3 A;  4YAX A;  3UV2 A;  5CQ6 A;  4DON A;  5F62 A;  5HQ5 A;  3QZV A;  4CUQ A;  4QNS A;  5DFD A;  3MUK A;  1WUG A;  4UIZ A;  5F5Z A;  5F61 A;  3S92 A;  3Q2F A;  2WP1 A;  2RI7 A;  4YBM A;  5F36 A;  4YYJ A;  4NR4 A;  5TB6 A;  4IR5 A;  5EIS A;  5EK9 A;  4UYF A;  2F6J A;  5A5O A;  5ENB A;  4TQN A;  4WHU A;  4MR3 A;  4TT4 A;  3IU5 A;  4XY8 A;  4LYS A;  4A9H A;  4NUE A;  2L85 A;  5I89 A;  5D3S A;  3TLP A;  5E9M A;  3LQJ A;  5F25 A;  1JSP B;  3JVL A;  5C87 A;  4MR5 A;  4YY4 A;  2YEL A;  4AKN A;  5I29 A;  5BT5 A;  4NR8 A;  2NXB A;  3NXB A;  5ENG A;  4HXL A;  3UV4 A;  4MEQ A;  5A5R A;  4NR5 A;  5F1H A;  4UIV A;  4UYD A;  3O36 A;  3UVW A;  5CQ7 A;  5DY7 A;  4NR9 A;  4KV1 A;  1EQF A;  5AME A;  2WP2 A;  4NXJ A;  4O7C A;  5ETB A;  1F68 A;  4BHW A;  5ETD A;  5HRV A;  3UVX A;  4TU6 A;  4O7F A;  5I80 A;  4J0R A;  4YYM A;  5JWM A;  5CUC A;  4MR4 A;  2RNY A;  3LXJ A;  4MEN A;  5ENJ A;  3ONI A;  5CQ5 A;  5E9K A;  3RCW A;  5FE9 A;  5K29 A;  2FSA A;  4YY6 A;  5A83 A;  5ENE A;  4LYI A;  1ZS5 A;  3P1D A;  4LRG A;  4J0S A;  4N4G A;  4YAT A;  5DYU A;  5DLX A;  4Z6I A;  5FE3 A;  5CQ3 A;  3G0J A;  5H85 A;  4O77 A;  4FLP A;  5F3A A;  5FB1 A;  2E3K A;  5IGN A;  4NYV A;  4LC2 A;  5I7X A;  3UV5 A;  4KV4 A;  5D26 A;  4UIY A;  5A5S A;  2RS9 B;  5E0R A;  5F63 A;  5IGK A;  5HFR A;  5D3N A;  4QY4 A;  2R0S A;  2DKW A;  4QR3 A;  4QUU A;  4TZ2 A;  5IG6 A;  5EWD A;  4BW4 A;  2YQD A;  3QZS A;  2YDW A;  4UIW A;  5DFB A;  3IU6 A;  3AAD A;  4A9M A;  5HFQ A;  4BJX A;  5LVQ A;  3LQI A;  5BT4 A;  5CUE A;  4O72 A;  3HMH A;  4XYA A;  5ENI A;  4CLB A;  5I83 A;  5D3J A;  2OO1 A;  4XUA A;  5EWC A;  5II2 A;  5KO4 A;  5AMF A;  4UYH A;  2RNX A;  5G4R A;  4NYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...