4TT4A

Crystal structure of atad2a bromodomain complexed with h3(1-21)k14ac peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tt4A00
4AKNA 5I89A 4OGJA 5E3GA 4BW4A 4YH4A 5C87A 5KU3A 5EVAA 4O78A 2WP1A 4CUSA 4YYMA 4QSPA 4MR6A 3UW9A 4KCXA 4Q0OA 5FH8A 4YY6A 4UIVA 4NR9A 5ENEA 3JVMA 4N4IA 5ENBA 4F3IA 5L8UA 4OUFA 2I7KA 4NR6A 3U5LA 5L96A 4QUUA 4Z1SA 5E74A 5D3JA 4IR5A 5A85A 2DVSA 5LKTA 4BHWA 1JSPB 4HXOA 4NQMA 5CS8A 4LZSA 5HM0A 3FKMX 5C4QA 5DYXA 2YEMA 5DKCA 4LR6A 5H85A 4TZ2A 4FLPA 5CRZA 5HFRA 5FE4A 4ALHA 4LYSA 5HRXA 5CQ8A 5FE1A 4BW3A 4PCEA 2RI7A 5L8TA 4MEOA 4QSQA 3G0JA 4YBTA 3U5PA 4NXJA 5I80A 4CL9A 4IORA 4QEUA 5CUGA 5F5ZA 5ENFA 4QY4A 4YYNA 5CUAA 4PKLA 4LDFA 5DW1A 5DYCA 4IR4A 5E3DA 4QSTA 4LZ2A 4TQNA 5DW2A 4QSXA 3O34A 3O35A 5CU8A 5FH6A 5ACYA 3O33A 5D3LA 5F36A 4DONA 4TT4A 3P1DA 4YYIA 4CUPA 4YADA 5E0RA 5BT5A 4YYDA 4TTEA 5D3SA 4UIXA 4NRBA 4TU4A 1EQFA 5D26A 3QZVA 4UYFA 5EM3A 2DKWA 5E9KA 4QSUA 5EICA 5G4SA 5IG6A 4O70A 4UYHA 5D3PA 3P5OA 2DATA 5ENCA 4N4GA 4C66A 5FB1A 5EWWA 2DVQA 5A82A 5E9IA 2YELA 4HXMA 2L85A 2GRCA 2WP2A 5L97A 2F6NA 5DX4A 5EWCA 5HFQA 4NR8A 5CGPA 5F25A 3U5MA 5HCLA 2KTBB 5AD3A 4RVRA 5II1A 5AMEA 4PS5A 5DKHA 5F3AA 5HRWA 4YATA 4PTBA 4NQNA 4A9MA 5CUEA 4ZC9A 5CY9A 4WIVA 4A9JA 4UIZA 1E6IA 4QB3A 4CURA 5DLZA 4YBSA 4BW2A 5TB6A 4TT6A 3P1FA 2YQDA 5HENA 5H1VA 4UYDA 4TYLA 4CLBA 4NR5A 4UIUA 5FH7A 5F1LA 5D0CA 3P1CA 5EGUA 2RNYA 5AMFA 5DYAA 5C89A 5ENJA 2H60A 5FFWA 4QZSA 5L98A 5LKUA 5D3RA 5FG6A 3IU5A 4QBMA 5HELA 4QR5A 5FFVA 4ALGA 1ZS5A 5CQAA 5A5PA 3U5NA 4O71A 4YAXA 4QYLA 3MQMA 2E7NA 5KTXA 4A9FA 5FDZA 4Z6IA 5IGMA 2YDWA 4MEQA 2YW5A 5C7NA 4O7FA 2LSPB 5FG4A 5F2PA 2NXBA 4N4HA 4WHUA 5FE0A 5DY7A 5F62A 2YYNA 4XY8A 4QSSA 3P1EA 3I3JA 5LVQA 2D9EA 2RNWA 4QNSA 4N3WA 4NS5A 5LJ2A 5H1TA 2E7OA 5EK9A 5I7XA 5EU1A 3UVXA 4PY6A 2R0YA 4QR3A 3HMEA 4IOOA 5CUDA 5C85A 2R0SA 5FE7A 5IIDA 3LJWA 5H1UA 3MUKA 4UITA 5CUBA 2MJVB 5FE5A 2RO1A 5F63A 2OO1A 2RNXA 5A83A 5E9YA 5HQ7A 5ENGA 3UV2A 2DVRA 4OGIA 3SVGA 4NUEA 4YYKA 5HQ6A 2I8NA 4YH3A 4HXLA 4QSRA 4E96A 5KTWA 5AD2A 3U5KA 5LKXA 5LVRA 5IGLA 5DFBA 4A9KA 2YEKA 3LQHA 5TCMA 5I7YA 4NYWA 3O36A 4N4FA 5F61A 4HXNA 4A9LA 4NYXA 4NUCA 4QEWA 3UVYA 1X0JA 3K2JA 5E9VA 3AQAA 5CQ7A 4O7BA 5HLSA 2R10A 4J3IA 3AADA 5EISA 3Q2FA 5C8GA 5LUUA 5D25A 5E7DA 4CFKA 5DBMA 5A5NA 4LYIA 5FG5A 4MR4A 5D7XA 5I83A 4A9IA 4NRCA 4O75A 2R0VA 5I88A 4QC3A 5HQ5A 4TS8A 4PCIA 3ONIA 5E73A 5EWVA 4BJXA 5FB0A 4TT2A 3IU6A 3HMHA 5E9LA 3U5JA 5DKDA 4LYWA 4MENA 4A9HA 5A5QA 2RFJA 4Y03A 4NYVA 5FE6A 4IR3A 3O37A 4XUAA 5J0DA 5JWMA 4QEVA 4Z93A 1WUGA 4ZQLA 5DLXA 5CQ5A 4HXSA 4XYAA 3S92A 3MB4A 2DVVA 5CQ6A 4XY9A 4NUDA 4NR4A 4HXRA 4A9NA 5L99A 4HBXA 4Z1QA 4UYEA 5CQ4A 4MR3A 2RS9B 3UVDA 4QSWA 5EP7A 3MULA 3LXJA 5KHMA 2DWWA 5IGKA 4UYGA 4O76A 5F60A 5I86A 4UYFB 4IR6A 4LRGA 2L5EA 4Z6HA 5ENHA 4KV4A 2E3KA 4QR4A 5ENIA 4HBYA 1WUMA 5I1QA 4TZ8A 3QZTA 5LJ1A 4ZW1A 2OUOA 4WHWA 4C67A 5I29A 5EA1A 5COIA 4HXKA 3LQJA 4HBVA 3U5OA 5BT3A 5CTLA 4CUTA 5D3TA 2F6JA 4CUQA 5CQ3A 5DYUA 1JM4B 3D7CA 3RCWA 5A5RA 5EPBA 2N9GA 4YBMA 2D82A 5CZGA 5A5OA 3GG3A 4A9OA 4LZRA 3TLPA 4IOQA 3ZYUA 5IGNA 5FE8A 5DFCA 4YYGA 3S91A 3G0LA 5HRVA 5FE9A 5DFDA 5G4RA 3NXBA 3UVWA 5I40A 5CRMA 3HMFA 5BT4A 4GPJA 4Q0NA 4YY4A 4QC1A 5II2A 4MR5A 5FE3A 4O7CA 5KTUA 4YC9A 3MB3A 4QUTA 3QZSA 4YYJA 5FBXA 5A81A 5EV9A 3UV5A 5CPEA 5IBNA 4BW1A 1F68A 3LQIA 5JI8A 3Q2EA 4QSVA 5D3NA 5A5SA 2G4AA 5EPRA 3SVFA 4UIYA 4O77A 3SVHA 3MXFA 5FE2A 5LJ0A 5KO4A 4J0RA 5EPSA 5HJCA 4NR7A 4TU6A 4UIWA 5CFWA 4QYDA 5CUCA 5EQ1A 1N72A 5EWHA 5K29A 4MEPA 5CP5A 5LKZA 4A9EA 4X2IA 5D3HA 5EI4A 4O72A 2OSSA 4J0SA 4YK0A 5EWDA 5D24A 4J1PA 5HEMA 5F1HA 5A7CA 4O74A 3UV4A 3JVLA 4O7AA 4CUUA 4YYHA 4LC2A 3JVKA 5CQTA 4HXPA 4KV1A 4NRAA 4O7EA 5E9MA 3DWYA 5ETDA 2L84A 3JVJA 4HBWA 4CFLA 5FFYA 2FSAA 4YABA 4XUBA 5ETBA 3DAIA
chains in the Genus database with same CATH superfamily
4AKNA 5I89A 4OGJA 5E3GA 4BW4A 4YH4A 5C87A 5KU3A 5EVAA 4O78A 2WP1A 4CUSA 4YYMA 4QSPA 4MR6A 3UW9A 4KCXA 4Q0OA 5FH8A 4YY6A 4UIVA 4NR9A 5ENEA 3JVMA 4N4IA 5ENBA 4F3IA 5L8UA 4OUFA 2I7KA 4NR6A 3U5LA 5L96A 4QUUA 4Z1SA 5E74A 5D3JA 4IR5A 5A85A 2DVSA 5LKTA 4BHWA 1JSPB 4HXOA 4NQMA 5CS8A 4LZSA 5HM0A 3FKMX 5C4QA 5DYXA 2YEMA 5DKCA 4LR6A 5H85A 4TZ2A 4FLPA 5CRZA 5HFRA 5FE4A 4ALHA 4LYSA 5HRXA 5CQ8A 5FE1A 4BW3A 4PCEA 2RI7A 5L8TA 4MEOA 4QSQA 3G0JA 4YBTA 4AKHA 3U5PA 4NXJA 5I80A 4CL9A 4IORA 4QEUA 5CUGA 5F5ZA 5ENFA 4QY4A 4YYNA 5CUAA 4PKLA 4LDFA 5DW1A 5DYCA 4IR4A 5E3DA 4QSTA 4LZ2A 4TQNA 5DW2A 4QSXA 3O34A 3O35A 5CU8A 5FH6A 5ACYA 3O33A 5D3LA 5F36A 4DONA 4TT4A 3P1DA 4YYIA 4CUPA 4YADA 5E0RA 5BT5A 4YYDA 4TTEA 5D3SA 4UIXA 4NRBA 4TU4A 1EQFA 5D26A 3QZVA 4UYFA 5EM3A 2DKWA 5E9KA 4QSUA 5EICA 5G4SA 5IG6A 4O70A 4UYHA 5D3PA 3P5OA 2DATA 5ENCA 4N4GA 4C66A 5FB1A 5EWWA 2DVQA 5A82A 5E9IA 2EJNA 2YELA 4HXMA 2L85A 2GRCA 2WP2A 5L97A 2F6NA 5DX4A 5EWCA 5HFQA 4NR8A 5CGPA 5F25A 3U5MA 5HCLA 2KTBB 5AD3A 4RVRA 5II1A 5AMEA 4PS5A 5DKHA 3ERRA 5F3AA 5HRWA 4YATA 4PTBA 4NQNA 4A9MA 5CUEA 4ZC9A 5CY9A 4WIVA 4A9JA 4UIZA 1E6IA 4QB3A 4CURA 5DLZA 4YBSA 4BW2A 5TB6A 4TT6A 3P1FA 2YQDA 5HENA 5H1VA 4UYDA 4TYLA 4CLBA 4NR5A 4UIUA 5FH7A 5F1LA 5D0CA 3P1CA 5EGUA 2RNYA 5AMFA 5DYAA 5C89A 5ENJA 2H60A 5FFWA 4QZSA 5L98A 5LKUA 5D3RA 5FG6A 3IU5A 4QBMA 5HELA 4QR5A 5FFVA 4ALGA 1ZS5A 5CQAA 5A5PA 3U5NA 4YAXA 4O71A 4QYLA 3MQMA 2E7NA 4AKIA 3D1BA 5KTXA 4A9FA 5FDZA 4Z6IA 5IGMA 2YDWA 4MEQA 2YW5A 5C7NA 4AI6A 4O7FA 2LSPB 3VKGA 5FG4A 5F2PA 2NXBA 4N4HA 4WHUA 5FE0A 5DY7A 5F62A 2YYNA 4XY8A 4QSSA 3P1EA 3I3JA 5LVQA 2D9EA 2RNWA 4QNSA 4N3WA 4NS5A 5LJ2A 5H1TA 2E7OA 5EK9A 5I7XA 5EU1A 3UVXA 4PY6A 2R0YA 4QR3A 3HMEA 4IOOA 5CUDA 5C85A 2R0SA 5FE7A 5IIDA 3LJWA 5H1UA 3MUKA 4UITA 5CUBA 2MJVB 5FE5A 2RO1A 5F63A 2OO1A 2RNXA 5A83A 5E9YA 5HQ7A 5ENGA 3UV2A 2DVRA 4OGIA 3SVGA 4NUEA 4YYKA 5HQ6A 2I8NA 4YH3A 4HXLA 4QSRA 4E96A 5KTWA 5AD2A 3U5KA 5LKXA 5LVRA 5IGLA 5DFBA 4A9KA 2YEKA 3LQHA 5TCMA 5I7YA 4NYWA 3O36A 4N4FA 5F61A 4HXNA 4A9LA 4NYXA 4NUCA 4QEWA 3UVYA 1X0JA 3K2JA 5E9VA 3AQAA 5CQ7A 4O7BA 5HLSA 2R10A 4J3IA 3AADA 5EISA 3Q2FA 5C8GA 5LUUA 5D25A 5E7DA 4CFKA 5DBMA 5A5NA 4LYIA 5FG5A 4MR4A 5D7XA 5I83A 4A9IA 4NRCA 4O75A 2R0VA 5I88A 4QC3A 5HQ5A 4TS8A 4PCIA 3ONIA 5E73A 5EWVA 4BJXA 5FB0A 4TT2A 3IU6A 3HMHA 5E9LA 3U5JA 5DKDA 4LYWA 4MENA 4A9HA 5A5QA 3VKHA 2RFJA 4Y03A 4NYVA 5FE6A 4IR3A 3O37A 4XUAA 5J0DA 5JWMA 4QEVA 4Z93A 1WUGA 4ZQLA 5DLXA 5CQ5A 4HXSA 4XYAA 3S92A 3MB4A 2DVVA 5CQ6A 4XY9A 4NUDA 4NR4A 4HXRA 4A9NA 5L99A 4HBXA 4Z1QA 4UYEA 5CQ4A 4MR3A 2RS9B 3UVDA 4QSWA 5EP7A 3MULA 3LXJA 5KHMA 2DWWA 5IGKA 4UYGA 4O76A 5F60A 5I86A 4UYFB 4IR6A 4LRGA 2L5EA 1PUOA 4Z6HA 5ENHA 4KV4A 2E3KA 4QR4A 5ENIA 4HBYA 1WUMA 5I1QA 4TZ8A 3QZTA 5LJ1A 4ZW1A 2OUOA 4WHWA 4C67A 5I29A 5EA1A 5COIA 4HXKA 3LQJA 4HBVA 3U5OA 5BT3A 5CTLA 4CUTA 5D3TA 2F6JA 4CUQA 5CQ3A 5DYUA 1JM4B 3D7CA 3RCWA 5A5RA 5EPBA 2N9GA 4YBMA 2D82A 5CZGA 5A5OA 3GG3A 4A9OA 4LZRA 3TLPA 4IOQA 3ZYUA 5IGNA 5FE8A 5DFCA 4YYGA 3S91A 3G0LA 5HRVA 5FE9A 5DFDA 5G4RA 3NXBA 3UVWA 5I40A 5CRMA 3HMFA 5BT4A 4GPJA 4Q0NA 4YY4A 4QC1A 5II2A 4MR5A 5FE3A 4O7CA 5KTUA 4YC9A 3MB3A 4QUTA 3QZSA 4YYJA 5FBXA 5A81A 5EV9A 3UV5A 5CPEA 5IBNA 4BW1A 1F68A 3LQIA 5JI8A 3Q2EA 4QSVA 5D3NA 5A5SA 2G4AA 5EPRA 3SVFA 4UIYA 1ZKRA 4O77A 3SVHA 3MXFA 5FE2A 5LJ0A 5KO4A 4J0RA 3D1DA 5EPSA 5HJCA 4NR7A 4TU6A 4UIWA 5CFWA 4QYDA 5CUCA 5EQ1A 1N72A 5EWHA 5K29A 4MEPA 5CP5A 5LKZA 4A9EA 4X2IA 5D3HA 5EI4A 4O72A 2OSSA 4J0SA 4YK0A 5EWDA 5D24A 4J1PA 5HEMA 5F1HA 5A7CA 4O74A 3UV4A 4AKGA 3JVLA 4O7AA 4CUUA 4YYHA 4LC2A 3JVKA 5CQTA 4HXPA 4KV1A 4NRAA 4O7EA 5E9MA 3DWYA 5ETDA 2L84A 3JVJA 4HBWA 4CFLA 5FFYA 2FSAA 4YABA 4XUBA 5ETBA 3DAIA
chains in the Genus database with same CATH topology
4AKNA 5I89A 4OGJA 5E3GA 4BW4A 4YH4A 5C87A 5KU3A 5EVAA 4O78A 2WP1A 4CUSA 4YYMA 4QSPA 4MR6A 3UW9A 4KCXA 4Q0OA 5FH8A 4YY6A 4UIVA 4NR9A 5ENEA 3JVMA 4N4IA 5ENBA 4F3IA 5L8UA 4OUFA 2I7KA 4NR6A 3U5LA 5L96A 4QUUA 4Z1SA 5E74A 5D3JA 4IR5A 5A85A 2DVSA 5LKTA 4BHWA 1JSPB 4HXOA 4NQMA 5CS8A 4LZSA 5HM0A 3FKMX 5C4QA 5DYXA 2YEMA 5DKCA 4LR6A 5H85A 4TZ2A 4FLPA 5CRZA 5HFRA 5FE4A 4ALHA 4LYSA 5HRXA 5CQ8A 5FE1A 4BW3A 4PCEA 2RI7A 5L8TA 4MEOA 4QSQA 3G0JA 4YBTA 3U5PA 4NXJA 5I80A 4CL9A 4IORA 4QEUA 5CUGA 5F5ZA 5ENFA 4QY4A 4YYNA 5CUAA 4PKLA 4LDFA 5DW1A 5DYCA 4IR4A 5E3DA 4QSTA 4LZ2A 4TQNA 5DW2A 4QSXA 3O34A 3O35A 5CU8A 5FH6A 5ACYA 3O33A 5D3LA 5F36A 4DONA 4TT4A 3P1DA 4YYIA 4CUPA 4YADA 5E0RA 5BT5A 4YYDA 4TTEA 5D3SA 4UIXA 4NRBA 4TU4A 1EQFA 5D26A 3QZVA 4UYFA 5EM3A 2DKWA 5E9KA 4QSUA 5EICA 5G4SA 5IG6A 4O70A 4UYHA 5D3PA 3P5OA 2DATA 5ENCA 4N4GA 4C66A 5FB1A 5EWWA 2DVQA 5A82A 5E9IA 2YELA 4HXMA 2L85A 2GRCA 2WP2A 5L97A 2F6NA 5DX4A 5EWCA 5HFQA 4NR8A 5CGPA 5F25A 3U5MA 5HCLA 2KTBB 5AD3A 4RVRA 5II1A 5AMEA 4PS5A 5DKHA 5F3AA 5HRWA 4YATA 4PTBA 4NQNA 4A9MA 5CUEA 4ZC9A 5CY9A 4WIVA 4A9JA 4UIZA 1E6IA 4QB3A 4CURA 5DLZA 4YBSA 4BW2A 5TB6A 4TT6A 3P1FA 2YQDA 5HENA 5H1VA 4UYDA 4TYLA 4CLBA 4NR5A 4UIUA 5FH7A 5F1LA 5D0CA 3P1CA 5EGUA 2RNYA 5AMFA 5DYAA 5C89A 5ENJA 2H60A 5FFWA 4QZSA 5L98A 5LKUA 5D3RA 5FG6A 3IU5A 4QBMA 5HELA 4QR5A 5FFVA 4ALGA 1ZS5A 5CQAA 5A5PA 3U5NA 4O71A 4YAXA 4QYLA 3MQMA 2E7NA 5KTXA 4A9FA 5FDZA 4Z6IA 5IGMA 2YDWA 4MEQA 2YW5A 5C7NA 4O7FA 2LSPB 5FG4A 5F2PA 2NXBA 4N4HA 4WHUA 5FE0A 5DY7A 5F62A 2YYNA 4XY8A 4QSSA 3P1EA 3I3JA 5LVQA 2D9EA 2RNWA 4QNSA 4N3WA 4NS5A 5LJ2A 5H1TA 2E7OA 5EK9A 5I7XA 5EU1A 3UVXA 4PY6A 2R0YA 4QR3A 3HMEA 4IOOA 5CUDA 5C85A 2R0SA 5FE7A 5IIDA 3LJWA 5H1UA 3MUKA 4UITA 5CUBA 2MJVB 5FE5A 2RO1A 5F63A 2OO1A 2RNXA 5A83A 5E9YA 5HQ7A 5ENGA 3UV2A 2DVRA 4OGIA 3SVGA 4NUEA 4YYKA 5HQ6A 2I8NA 4YH3A 4HXLA 4QSRA 4E96A 5KTWA 5AD2A 3U5KA 5LKXA 5LVRA 5IGLA 5DFBA 4A9KA 2YEKA 3LQHA 5TCMA 5I7YA 4NYWA 3O36A 4N4FA 5F61A 4HXNA 4A9LA 4NYXA 4NUCA 4QEWA 3UVYA 1X0JA 3K2JA 5E9VA 3AQAA 5CQ7A 4O7BA 5HLSA 2R10A 4J3IA 3AADA 5EISA 3Q2FA 5C8GA 5LUUA 5D25A 5E7DA 4CFKA 5DBMA 5A5NA 4LYIA 5FG5A 4MR4A 5D7XA 5I83A 4A9IA 4NRCA 4O75A 2R0VA 5I88A 4QC3A 5HQ5A 4TS8A 4PCIA 3ONIA 5E73A 5EWVA 4BJXA 5FB0A 4TT2A 3IU6A 3HMHA 5E9LA 3U5JA 5DKDA 4LYWA 4MENA 4A9HA 5A5QA 2RFJA 4Y03A 4NYVA 5FE6A 4IR3A 3O37A 4XUAA 5J0DA 5JWMA 4QEVA 4Z93A 1WUGA 4ZQLA 5DLXA 5CQ5A 4HXSA 4XYAA 3S92A 3MB4A 2DVVA 5CQ6A 4XY9A 4NUDA 4NR4A 4HXRA 4A9NA 5L99A 4HBXA 4Z1QA 4UYEA 5CQ4A 4MR3A 2RS9B 3UVDA 4QSWA 5EP7A 3MULA 3LXJA 5KHMA 2DWWA 5IGKA 4UYGA 4O76A 5F60A 5I86A 4UYFB 4IR6A 4LRGA 2L5EA 4Z6HA 5ENHA 4KV4A 2E3KA 4QR4A 5ENIA 4HBYA 1WUMA 5I1QA 4TZ8A 3QZTA 5LJ1A 4ZW1A 2OUOA 4WHWA 4C67A 5I29A 5EA1A 5COIA 4HXKA 3LQJA 4HBVA 3U5OA 5BT3A 5CTLA 4CUTA 5D3TA 2F6JA 4CUQA 5CQ3A 5DYUA 1JM4B 3D7CA 3RCWA 5A5RA 5EPBA 2N9GA 4YBMA 2D82A 5CZGA 5A5OA 3GG3A 4A9OA 4LZRA 3TLPA 4IOQA 3ZYUA 5IGNA 5FE8A 5DFCA 4YYGA 3S91A 3G0LA 5HRVA 5FE9A 5DFDA 5G4RA 3NXBA 3UVWA 5I40A 5CRMA 3HMFA 5BT4A 4GPJA 4Q0NA 4YY4A 4QC1A 5II2A 4MR5A 5FE3A 4O7CA 5KTUA 4YC9A 3MB3A 4QUTA 3QZSA 4YYJA 5FBXA 5A81A 5EV9A 3UV5A 5CPEA 5IBNA 4BW1A 1F68A 3LQIA 5JI8A 3Q2EA 4QSVA 5D3NA 5A5SA 2G4AA 5EPRA 3SVFA 4UIYA 4O77A 3SVHA 3MXFA 5FE2A 5LJ0A 5KO4A 4J0RA 5EPSA 5HJCA 4NR7A 4TU6A 4UIWA 5CFWA 4QYDA 5CUCA 5EQ1A 1N72A 5EWHA 5K29A 4MEPA 5CP5A 5LKZA 4A9EA 4X2IA 5D3HA 5EI4A 4O72A 2OSSA 4J0SA 4YK0A 5EWDA 5D24A 4J1PA 5HEMA 5F1HA 5A7CA 4O74A 3UV4A 3JVLA 4O7AA 4CUUA 4YYHA 4LC2A 3JVKA 5CQTA 4HXPA 4KV1A 4NRAA 4O7EA 5E9MA 3DWYA 5ETDA 2L84A 3JVJA 4HBWA 4CFLA 5FFYA 2FSAA 4YABA 4XUBA 5ETBA 3DAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKN A;  5I89 A;  4OGJ A;  5E3G A;  4BW4 A;  4YH4 A;  5C87 A;  5KU3 A;  5EVA A;  4O78 A;  2WP1 A;  4CUS A;  4YYM A;  4QSP A;  4MR6 A;  3UW9 A;  4KCX A;  4Q0O A;  5FH8 A;  4YY6 A;  4UIV A;  4NR9 A;  5ENE A;  3JVM A;  4N4I A;  5ENB A;  4F3I A;  5L8U A;  4OUF A;  2I7K A;  4NR6 A;  3U5L A;  5L96 A;  4QUU A;  4Z1S A;  5E74 A;  5D3J A;  4IR5 A;  5A85 A;  2DVS A;  5LKT A;  4BHW A;  1JSP B;  4HXO A;  4NQM A;  5CS8 A;  4LZS A;  5HM0 A;  3FKM X;  5C4Q A;  5DYX A;  2YEM A;  5DKC A;  4LR6 A;  5H85 A;  4TZ2 A;  4FLP A;  5CRZ A;  5HFR A;  5FE4 A;  4ALH A;  4LYS A;  5HRX A;  5CQ8 A;  5FE1 A;  4BW3 A;  4PCE A;  2RI7 A;  5L8T A;  4MEO A;  4QSQ A;  3G0J A;  4YBT A;  3U5P A;  4NXJ A;  5I80 A;  4CL9 A;  4IOR A;  4QEU A;  5CUG A;  5F5Z A;  5ENF A;  4QY4 A;  4YYN A;  5CUA A;  4PKL A;  4LDF A;  5DW1 A;  5DYC A;  4IR4 A;  5E3D A;  4QST A;  4LZ2 A;  4TQN A;  5DW2 A;  4QSX A;  3O34 A;  3O35 A;  5CU8 A;  5FH6 A;  5ACY A;  3O33 A;  5D3L A;  5F36 A;  4DON A;  4TT4 A;  3P1D A;  4YYI A;  4CUP A;  4YAD A;  5E0R A;  5BT5 A;  4YYD A;  4TTE A;  5D3S A;  4UIX A;  4NRB A;  4TU4 A;  1EQF A;  5D26 A;  3QZV A;  4UYF A;  5EM3 A;  2DKW A;  5E9K A;  4QSU A;  5EIC A;  5G4S A;  5IG6 A;  4O70 A;  4UYH A;  5D3P A;  3P5O A;  2DAT A;  5ENC A;  4N4G A;  4C66 A;  5FB1 A;  5EWW A;  2DVQ A;  5A82 A;  5E9I A;  2YEL A;  4HXM A;  2L85 A;  2GRC A;  2WP2 A;  5L97 A;  2F6N A;  5DX4 A;  5EWC A;  5HFQ A;  4NR8 A;  5CGP A;  5F25 A;  3U5M A;  5HCL A;  2KTB B;  5AD3 A;  4RVR A;  5II1 A;  5AME A;  4PS5 A;  5DKH A;  5F3A A;  5HRW A;  4YAT A;  4PTB A;  4NQN A;  4A9M A;  5CUE A;  4ZC9 A;  5CY9 A;  4WIV A;  4A9J A;  4UIZ A;  1E6I A;  4QB3 A;  4CUR A;  5DLZ A;  4YBS A;  4BW2 A;  5TB6 A;  4TT6 A;  3P1F A;  2YQD A;  5HEN A;  5H1V A;  4UYD A;  4TYL A;  4CLB A;  4NR5 A;  4UIU A;  5FH7 A;  5F1L A;  5D0C A;  3P1C A;  5EGU A;  2RNY A;  5AMF A;  5DYA A;  5C89 A;  5ENJ A;  2H60 A;  5FFW A;  4QZS A;  5L98 A;  5LKU A;  5D3R A;  5FG6 A;  3IU5 A;  4QBM A;  5HEL A;  4QR5 A;  5FFV A;  4ALG A;  1ZS5 A;  5CQA A;  5A5P A;  3U5N A;  4O71 A;  4YAX A;  4QYL A;  3MQM A;  2E7N A;  5KTX A;  4A9F A;  5FDZ A;  4Z6I A;  5IGM A;  2YDW A;  4MEQ A;  2YW5 A;  5C7N A;  4O7F A;  2LSP B;  5FG4 A;  5F2P A;  2NXB A;  4N4H A;  4WHU A;  5FE0 A;  5DY7 A;  5F62 A;  2YYN A;  4XY8 A;  4QSS A;  3P1E A;  3I3J A;  5LVQ A;  2D9E A;  2RNW A;  4QNS A;  4N3W A;  4NS5 A;  5LJ2 A;  5H1T A;  2E7O A;  5EK9 A;  5I7X A;  5EU1 A;  3UVX A;  4PY6 A;  2R0Y A;  4QR3 A;  3HME A;  4IOO A;  5CUD A;  5C85 A;  2R0S A;  5FE7 A;  5IID A;  3LJW A;  5H1U A;  3MUK A;  4UIT A;  5CUB A;  2MJV B;  5FE5 A;  2RO1 A;  5F63 A;  2OO1 A;  2RNX A;  5A83 A;  5E9Y A;  5HQ7 A;  5ENG A;  3UV2 A;  2DVR A;  4OGI A;  3SVG A;  4NUE A;  4YYK A;  5HQ6 A;  2I8N A;  4YH3 A;  4HXL A;  4QSR A;  4E96 A;  5KTW A;  5AD2 A;  3U5K A;  5LKX A;  5LVR A;  5IGL A;  5DFB A;  4A9K A;  2YEK A;  3LQH A;  5TCM A;  5I7Y A;  4NYW A;  3O36 A;  4N4F A;  5F61 A;  4HXN A;  4A9L A;  4NYX A;  4NUC A;  4QEW A;  3UVY A;  1X0J A;  3K2J A;  5E9V A;  3AQA A;  5CQ7 A;  4O7B A;  5HLS A;  2R10 A;  4J3I A;  3AAD A;  5EIS A;  3Q2F A;  5C8G A;  5LUU A;  5D25 A;  5E7D A;  4CFK A;  5DBM A;  5A5N A;  4LYI A;  5FG5 A;  4MR4 A;  5D7X A;  5I83 A;  4A9I A;  4NRC A;  4O75 A;  2R0V A;  5I88 A;  4QC3 A;  5HQ5 A;  4TS8 A;  4PCI A;  3ONI A;  5E73 A;  5EWV A;  4BJX A;  5FB0 A;  4TT2 A;  3IU6 A;  3HMH A;  5E9L A;  3U5J A;  5DKD A;  4LYW A;  4MEN A;  4A9H A;  5A5Q A;  2RFJ A;  4Y03 A;  4NYV A;  5FE6 A;  4IR3 A;  3O37 A;  4XUA A;  5J0D A;  5JWM A;  4QEV A;  4Z93 A;  1WUG A;  4ZQL A;  5DLX A;  5CQ5 A;  4HXS A;  4XYA A;  3S92 A;  3MB4 A;  2DVV A;  5CQ6 A;  4XY9 A;  4NUD A;  4NR4 A;  4HXR A;  4A9N A;  5L99 A;  4HBX A;  4Z1Q A;  4UYE A;  5CQ4 A;  4MR3 A;  2RS9 B;  3UVD A;  4QSW A;  5EP7 A;  3MUL A;  3LXJ A;  5KHM A;  2DWW A;  5IGK A;  4UYG A;  4O76 A;  5F60 A;  5I86 A;  4UYF B;  4IR6 A;  4LRG A;  2L5E A;  4Z6H A;  5ENH A;  4KV4 A;  2E3K A;  4QR4 A;  5ENI A;  4HBY A;  1WUM A;  5I1Q A;  4TZ8 A;  3QZT A;  5LJ1 A;  4ZW1 A;  2OUO A;  4WHW A;  4C67 A;  5I29 A;  5EA1 A;  5COI A;  4HXK A;  3LQJ A;  4HBV A;  3U5O A;  5BT3 A;  5CTL A;  4CUT A;  5D3T A;  2F6J A;  4CUQ A;  5CQ3 A;  5DYU A;  1JM4 B;  3D7C A;  3RCW A;  5A5R A;  5EPB A;  2N9G A;  4YBM A;  2D82 A;  5CZG A;  5A5O A;  3GG3 A;  4A9O A;  4LZR A;  3TLP A;  4IOQ A;  3ZYU A;  5IGN A;  5FE8 A;  5DFC A;  4YYG A;  3S91 A;  3G0L A;  5HRV A;  5FE9 A;  5DFD A;  5G4R A;  3NXB A;  3UVW A;  5I40 A;  5CRM A;  3HMF A;  5BT4 A;  4GPJ A;  4Q0N A;  4YY4 A;  4QC1 A;  5II2 A;  4MR5 A;  5FE3 A;  4O7C A;  5KTU A;  4YC9 A;  3MB3 A;  4QUT A;  3QZS A;  4YYJ A;  5FBX A;  5A81 A;  5EV9 A;  3UV5 A;  5CPE A;  5IBN A;  4BW1 A;  1F68 A;  3LQI A;  5JI8 A;  3Q2E A;  4QSV A;  5D3N A;  5A5S A;  2G4A A;  5EPR A;  3SVF A;  4UIY A;  4O77 A;  3SVH A;  3MXF A;  5FE2 A;  5LJ0 A;  5KO4 A;  4J0R A;  5EPS A;  5HJC A;  4NR7 A;  4TU6 A;  4UIW A;  5CFW A;  4QYD A;  5CUC A;  5EQ1 A;  1N72 A;  5EWH A;  5K29 A;  4MEP A;  5CP5 A;  5LKZ A;  4A9E A;  4X2I A;  5D3H A;  5EI4 A;  4O72 A;  2OSS A;  4J0S A;  4YK0 A;  5EWD A;  5D24 A;  4J1P A;  5HEM A;  5F1H A;  5A7C A;  4O74 A;  3UV4 A;  3JVL A;  4O7A A;  4CUU A;  4YYH A;  4LC2 A;  3JVK A;  5CQT A;  4HXP A;  4KV1 A;  4NRA A;  4O7E A;  5E9M A;  3DWY A;  5ETD A;  2L84 A;  3JVJ A;  4HBW A;  4CFL A;  5FFY A;  2FSA A;  4YAB A;  4XUB A;  5ETB A;  3DAI A; 
#chains in the Genus database with same CATH topology
 4AKN A;  5I89 A;  4OGJ A;  5E3G A;  4BW4 A;  4YH4 A;  5C87 A;  5KU3 A;  5EVA A;  4O78 A;  2WP1 A;  4CUS A;  4YYM A;  4QSP A;  4MR6 A;  3UW9 A;  4KCX A;  4Q0O A;  5FH8 A;  4YY6 A;  4UIV A;  4NR9 A;  5ENE A;  3JVM A;  4N4I A;  5ENB A;  4F3I A;  5L8U A;  4OUF A;  2I7K A;  4NR6 A;  3U5L A;  5L96 A;  4QUU A;  4Z1S A;  5E74 A;  5D3J A;  4IR5 A;  5A85 A;  2DVS A;  5LKT A;  4BHW A;  1JSP B;  4HXO A;  4NQM A;  5CS8 A;  4LZS A;  5HM0 A;  3FKM X;  5C4Q A;  5DYX A;  2YEM A;  5DKC A;  4LR6 A;  5H85 A;  4TZ2 A;  4FLP A;  5CRZ A;  5HFR A;  5FE4 A;  4ALH A;  4LYS A;  5HRX A;  5CQ8 A;  5FE1 A;  4BW3 A;  4PCE A;  2RI7 A;  5L8T A;  4MEO A;  4QSQ A;  3G0J A;  4YBT A;  4AKH A;  3U5P A;  4NXJ A;  5I80 A;  4CL9 A;  4IOR A;  4QEU A;  5CUG A;  5F5Z A;  5ENF A;  4QY4 A;  4YYN A;  5CUA A;  4PKL A;  4LDF A;  5DW1 A;  5DYC A;  4IR4 A;  5E3D A;  4QST A;  4LZ2 A;  4TQN A;  5DW2 A;  4QSX A;  3O34 A;  3O35 A;  5CU8 A;  5FH6 A;  5ACY A;  3O33 A;  5D3L A;  5F36 A;  4DON A;  4TT4 A;  3P1D A;  4YYI A;  4CUP A;  4YAD A;  5E0R A;  5BT5 A;  4YYD A;  4TTE A;  5D3S A;  4UIX A;  4NRB A;  4TU4 A;  1EQF A;  5D26 A;  3QZV A;  4UYF A;  5EM3 A;  2DKW A;  5E9K A;  4QSU A;  5EIC A;  5G4S A;  5IG6 A;  4O70 A;  4UYH A;  5D3P A;  3P5O A;  2DAT A;  5ENC A;  4N4G A;  4C66 A;  5FB1 A;  5EWW A;  2DVQ A;  5A82 A;  5E9I A;  2EJN A;  2YEL A;  4HXM A;  2L85 A;  2GRC A;  2WP2 A;  5L97 A;  2F6N A;  5DX4 A;  5EWC A;  5HFQ A;  4NR8 A;  5CGP A;  5F25 A;  3U5M A;  5HCL A;  2KTB B;  5AD3 A;  4RVR A;  5II1 A;  5AME A;  4PS5 A;  5DKH A;  3ERR A;  5F3A A;  5HRW A;  4YAT A;  4PTB A;  4NQN A;  4A9M A;  5CUE A;  4ZC9 A;  5CY9 A;  4WIV A;  4A9J A;  4UIZ A;  1E6I A;  4QB3 A;  4CUR A;  5DLZ A;  4YBS A;  4BW2 A;  5TB6 A;  4TT6 A;  3P1F A;  2YQD A;  5HEN A;  5H1V A;  4UYD A;  4TYL A;  4CLB A;  4NR5 A;  4UIU A;  5FH7 A;  5F1L A;  5D0C A;  3P1C A;  5EGU A;  2RNY A;  5AMF A;  5DYA A;  5C89 A;  5ENJ A;  2H60 A;  5FFW A;  4QZS A;  5L98 A;  5LKU A;  5D3R A;  5FG6 A;  3IU5 A;  4QBM A;  5HEL A;  4QR5 A;  5FFV A;  4ALG A;  1ZS5 A;  5CQA A;  5A5P A;  3U5N A;  4YAX A;  4O71 A;  4QYL A;  3MQM A;  2E7N A;  4AKI A;  3D1B A;  5KTX A;  4A9F A;  5FDZ A;  4Z6I A;  5IGM A;  2YDW A;  4MEQ A;  2YW5 A;  5C7N A;  4AI6 A;  4O7F A;  2LSP B;  3VKG A;  5FG4 A;  5F2P A;  2NXB A;  4N4H A;  4WHU A;  5FE0 A;  5DY7 A;  5F62 A;  2YYN A;  4XY8 A;  4QSS A;  3P1E A;  3I3J A;  5LVQ A;  2D9E A;  2RNW A;  4QNS A;  4N3W A;  4NS5 A;  5LJ2 A;  5H1T A;  2E7O A;  5EK9 A;  5I7X A;  5EU1 A;  3UVX A;  4PY6 A;  2R0Y A;  4QR3 A;  3HME A;  4IOO A;  5CUD A;  5C85 A;  2R0S A;  5FE7 A;  5IID A;  3LJW A;  5H1U A;  3MUK A;  4UIT A;  5CUB A;  2MJV B;  5FE5 A;  2RO1 A;  5F63 A;  2OO1 A;  2RNX A;  5A83 A;  5E9Y A;  5HQ7 A;  5ENG A;  3UV2 A;  2DVR A;  4OGI A;  3SVG A;  4NUE A;  4YYK A;  5HQ6 A;  2I8N A;  4YH3 A;  4HXL A;  4QSR A;  4E96 A;  5KTW A;  5AD2 A;  3U5K A;  5LKX A;  5LVR A;  5IGL A;  5DFB A;  4A9K A;  2YEK A;  3LQH A;  5TCM A;  5I7Y A;  4NYW A;  3O36 A;  4N4F A;  5F61 A;  4HXN A;  4A9L A;  4NYX A;  4NUC A;  4QEW A;  3UVY A;  1X0J A;  3K2J A;  5E9V A;  3AQA A;  5CQ7 A;  4O7B A;  5HLS A;  2R10 A;  4J3I A;  3AAD A;  5EIS A;  3Q2F A;  5C8G A;  5LUU A;  5D25 A;  5E7D A;  4CFK A;  5DBM A;  5A5N A;  4LYI A;  5FG5 A;  4MR4 A;  5D7X A;  5I83 A;  4A9I A;  4NRC A;  4O75 A;  2R0V A;  5I88 A;  4QC3 A;  5HQ5 A;  4TS8 A;  4PCI A;  3ONI A;  5E73 A;  5EWV A;  4BJX A;  5FB0 A;  4TT2 A;  3IU6 A;  3HMH A;  5E9L A;  3U5J A;  5DKD A;  4LYW A;  4MEN A;  4A9H A;  5A5Q A;  3VKH A;  2RFJ A;  4Y03 A;  4NYV A;  5FE6 A;  4IR3 A;  3O37 A;  4XUA A;  5J0D A;  5JWM A;  4QEV A;  4Z93 A;  1WUG A;  4ZQL A;  5DLX A;  5CQ5 A;  4HXS A;  4XYA A;  3S92 A;  3MB4 A;  2DVV A;  5CQ6 A;  4XY9 A;  4NUD A;  4NR4 A;  4HXR A;  4A9N A;  5L99 A;  4HBX A;  4Z1Q A;  4UYE A;  5CQ4 A;  4MR3 A;  2RS9 B;  3UVD A;  4QSW A;  5EP7 A;  3MUL A;  3LXJ A;  5KHM A;  2DWW A;  5IGK A;  4UYG A;  4O76 A;  5F60 A;  5I86 A;  4UYF B;  4IR6 A;  4LRG A;  2L5E A;  1PUO A;  4Z6H A;  5ENH A;  4KV4 A;  2E3K A;  4QR4 A;  5ENI A;  4HBY A;  1WUM A;  5I1Q A;  4TZ8 A;  3QZT A;  5LJ1 A;  4ZW1 A;  2OUO A;  4WHW A;  4C67 A;  5I29 A;  5EA1 A;  5COI A;  4HXK A;  3LQJ A;  4HBV A;  3U5O A;  5BT3 A;  5CTL A;  4CUT A;  5D3T A;  2F6J A;  4CUQ A;  5CQ3 A;  5DYU A;  1JM4 B;  3D7C A;  3RCW A;  5A5R A;  5EPB A;  2N9G A;  4YBM A;  2D82 A;  5CZG A;  5A5O A;  3GG3 A;  4A9O A;  4LZR A;  3TLP A;  4IOQ A;  3ZYU A;  5IGN A;  5FE8 A;  5DFC A;  4YYG A;  3S91 A;  3G0L A;  5HRV A;  5FE9 A;  5DFD A;  5G4R A;  3NXB A;  3UVW A;  5I40 A;  5CRM A;  3HMF A;  5BT4 A;  4GPJ A;  4Q0N A;  4YY4 A;  4QC1 A;  5II2 A;  4MR5 A;  5FE3 A;  4O7C A;  5KTU A;  4YC9 A;  3MB3 A;  4QUT A;  3QZS A;  4YYJ A;  5FBX A;  5A81 A;  5EV9 A;  3UV5 A;  5CPE A;  5IBN A;  4BW1 A;  1F68 A;  3LQI A;  5JI8 A;  3Q2E A;  4QSV A;  5D3N A;  5A5S A;  2G4A A;  5EPR A;  3SVF A;  4UIY A;  1ZKR A;  4O77 A;  3SVH A;  3MXF A;  5FE2 A;  5LJ0 A;  5KO4 A;  4J0R A;  3D1D A;  5EPS A;  5HJC A;  4NR7 A;  4TU6 A;  4UIW A;  5CFW A;  4QYD A;  5CUC A;  5EQ1 A;  1N72 A;  5EWH A;  5K29 A;  4MEP A;  5CP5 A;  5LKZ A;  4A9E A;  4X2I A;  5D3H A;  5EI4 A;  4O72 A;  2OSS A;  4J0S A;  4YK0 A;  5EWD A;  5D24 A;  4J1P A;  5HEM A;  5F1H A;  5A7C A;  4O74 A;  3UV4 A;  4AKG A;  3JVL A;  4O7A A;  4CUU A;  4YYH A;  4LC2 A;  3JVK A;  5CQT A;  4HXP A;  4KV1 A;  4NRA A;  4O7E A;  5E9M A;  3DWY A;  5ETD A;  2L84 A;  3JVJ A;  4HBW A;  4CFL A;  5FFY A;  2FSA A;  4YAB A;  4XUB A;  5ETB A;  3DAI A; 
#chains in the Genus database with same CATH homology
 4AKN A;  5I89 A;  4OGJ A;  5E3G A;  4BW4 A;  4YH4 A;  5C87 A;  5KU3 A;  5EVA A;  4O78 A;  2WP1 A;  4CUS A;  4YYM A;  4QSP A;  4MR6 A;  3UW9 A;  4KCX A;  4Q0O A;  5FH8 A;  4YY6 A;  4UIV A;  4NR9 A;  5ENE A;  3JVM A;  4N4I A;  5ENB A;  4F3I A;  5L8U A;  4OUF A;  2I7K A;  4NR6 A;  3U5L A;  5L96 A;  4QUU A;  4Z1S A;  5E74 A;  5D3J A;  4IR5 A;  5A85 A;  2DVS A;  5LKT A;  4BHW A;  1JSP B;  4HXO A;  4NQM A;  5CS8 A;  4LZS A;  5HM0 A;  3FKM X;  5C4Q A;  5DYX A;  2YEM A;  5DKC A;  4LR6 A;  5H85 A;  4TZ2 A;  4FLP A;  5CRZ A;  5HFR A;  5FE4 A;  4ALH A;  4LYS A;  5HRX A;  5CQ8 A;  5FE1 A;  4BW3 A;  4PCE A;  2RI7 A;  5L8T A;  4MEO A;  4QSQ A;  3G0J A;  4YBT A;  3U5P A;  4NXJ A;  5I80 A;  4CL9 A;  4IOR A;  4QEU A;  5CUG A;  5F5Z A;  5ENF A;  4QY4 A;  4YYN A;  5CUA A;  4PKL A;  4LDF A;  5DW1 A;  5DYC A;  4IR4 A;  5E3D A;  4QST A;  4LZ2 A;  4TQN A;  5DW2 A;  4QSX A;  3O34 A;  3O35 A;  5CU8 A;  5FH6 A;  5ACY A;  3O33 A;  5D3L A;  5F36 A;  4DON A;  4TT4 A;  3P1D A;  4YYI A;  4CUP A;  4YAD A;  5E0R A;  5BT5 A;  4YYD A;  4TTE A;  5D3S A;  4UIX A;  4NRB A;  4TU4 A;  1EQF A;  5D26 A;  3QZV A;  4UYF A;  5EM3 A;  2DKW A;  5E9K A;  4QSU A;  5EIC A;  5G4S A;  5IG6 A;  4O70 A;  4UYH A;  5D3P A;  3P5O A;  2DAT A;  5ENC A;  4N4G A;  4C66 A;  5FB1 A;  5EWW A;  2DVQ A;  5A82 A;  5E9I A;  2YEL A;  4HXM A;  2L85 A;  2GRC A;  2WP2 A;  5L97 A;  2F6N A;  5DX4 A;  5EWC A;  5HFQ A;  4NR8 A;  5CGP A;  5F25 A;  3U5M A;  5HCL A;  2KTB B;  5AD3 A;  4RVR A;  5II1 A;  5AME A;  4PS5 A;  5DKH A;  5F3A A;  5HRW A;  4YAT A;  4PTB A;  4NQN A;  4A9M A;  5CUE A;  4ZC9 A;  5CY9 A;  4WIV A;  4A9J A;  4UIZ A;  1E6I A;  4QB3 A;  4CUR A;  5DLZ A;  4YBS A;  4BW2 A;  5TB6 A;  4TT6 A;  3P1F A;  2YQD A;  5HEN A;  5H1V A;  4UYD A;  4TYL A;  4CLB A;  4NR5 A;  4UIU A;  5FH7 A;  5F1L A;  5D0C A;  3P1C A;  5EGU A;  2RNY A;  5AMF A;  5DYA A;  5C89 A;  5ENJ A;  2H60 A;  5FFW A;  4QZS A;  5L98 A;  5LKU A;  5D3R A;  5FG6 A;  3IU5 A;  4QBM A;  5HEL A;  4QR5 A;  5FFV A;  4ALG A;  1ZS5 A;  5CQA A;  5A5P A;  3U5N A;  4O71 A;  4YAX A;  4QYL A;  3MQM A;  2E7N A;  5KTX A;  4A9F A;  5FDZ A;  4Z6I A;  5IGM A;  2YDW A;  4MEQ A;  2YW5 A;  5C7N A;  4O7F A;  2LSP B;  5FG4 A;  5F2P A;  2NXB A;  4N4H A;  4WHU A;  5FE0 A;  5DY7 A;  5F62 A;  2YYN A;  4XY8 A;  4QSS A;  3P1E A;  3I3J A;  5LVQ A;  2D9E A;  2RNW A;  4QNS A;  4N3W A;  4NS5 A;  5LJ2 A;  5H1T A;  2E7O A;  5EK9 A;  5I7X A;  5EU1 A;  3UVX A;  4PY6 A;  2R0Y A;  4QR3 A;  3HME A;  4IOO A;  5CUD A;  5C85 A;  2R0S A;  5FE7 A;  5IID A;  3LJW A;  5H1U A;  3MUK A;  4UIT A;  5CUB A;  2MJV B;  5FE5 A;  2RO1 A;  5F63 A;  2OO1 A;  2RNX A;  5A83 A;  5E9Y A;  5HQ7 A;  5ENG A;  3UV2 A;  2DVR A;  4OGI A;  3SVG A;  4NUE A;  4YYK A;  5HQ6 A;  2I8N A;  4YH3 A;  4HXL A;  4QSR A;  4E96 A;  5KTW A;  5AD2 A;  3U5K A;  5LKX A;  5LVR A;  5IGL A;  5DFB A;  4A9K A;  2YEK A;  3LQH A;  5TCM A;  5I7Y A;  4NYW A;  3O36 A;  4N4F A;  5F61 A;  4HXN A;  4A9L A;  4NYX A;  4NUC A;  4QEW A;  3UVY A;  1X0J A;  3K2J A;  5E9V A;  3AQA A;  5CQ7 A;  4O7B A;  5HLS A;  2R10 A;  4J3I A;  3AAD A;  5EIS A;  3Q2F A;  5C8G A;  5LUU A;  5D25 A;  5E7D A;  4CFK A;  5DBM A;  5A5N A;  4LYI A;  5FG5 A;  4MR4 A;  5D7X A;  5I83 A;  4A9I A;  4NRC A;  4O75 A;  2R0V A;  5I88 A;  4QC3 A;  5HQ5 A;  4TS8 A;  4PCI A;  3ONI A;  5E73 A;  5EWV A;  4BJX A;  5FB0 A;  4TT2 A;  3IU6 A;  3HMH A;  5E9L A;  3U5J A;  5DKD A;  4LYW A;  4MEN A;  4A9H A;  5A5Q A;  2RFJ A;  4Y03 A;  4NYV A;  5FE6 A;  4IR3 A;  3O37 A;  4XUA A;  5J0D A;  5JWM A;  4QEV A;  4Z93 A;  1WUG A;  4ZQL A;  5DLX A;  5CQ5 A;  4HXS A;  4XYA A;  3S92 A;  3MB4 A;  2DVV A;  5CQ6 A;  4XY9 A;  4NUD A;  4NR4 A;  4HXR A;  4A9N A;  5L99 A;  4HBX A;  4Z1Q A;  4UYE A;  5CQ4 A;  4MR3 A;  2RS9 B;  3UVD A;  4QSW A;  5EP7 A;  3MUL A;  3LXJ A;  5KHM A;  2DWW A;  5IGK A;  4UYG A;  4O76 A;  5F60 A;  5I86 A;  4UYF B;  4IR6 A;  4LRG A;  2L5E A;  4Z6H A;  5ENH A;  4KV4 A;  2E3K A;  4QR4 A;  5ENI A;  4HBY A;  1WUM A;  5I1Q A;  4TZ8 A;  3QZT A;  5LJ1 A;  4ZW1 A;  2OUO A;  4WHW A;  4C67 A;  5I29 A;  5EA1 A;  5COI A;  4HXK A;  3LQJ A;  4HBV A;  3U5O A;  5BT3 A;  5CTL A;  4CUT A;  5D3T A;  2F6J A;  4CUQ A;  5CQ3 A;  5DYU A;  1JM4 B;  3D7C A;  3RCW A;  5A5R A;  5EPB A;  2N9G A;  4YBM A;  2D82 A;  5CZG A;  5A5O A;  3GG3 A;  4A9O A;  4LZR A;  3TLP A;  4IOQ A;  3ZYU A;  5IGN A;  5FE8 A;  5DFC A;  4YYG A;  3S91 A;  3G0L A;  5HRV A;  5FE9 A;  5DFD A;  5G4R A;  3NXB A;  3UVW A;  5I40 A;  5CRM A;  3HMF A;  5BT4 A;  4GPJ A;  4Q0N A;  4YY4 A;  4QC1 A;  5II2 A;  4MR5 A;  5FE3 A;  4O7C A;  5KTU A;  4YC9 A;  3MB3 A;  4QUT A;  3QZS A;  4YYJ A;  5FBX A;  5A81 A;  5EV9 A;  3UV5 A;  5CPE A;  5IBN A;  4BW1 A;  1F68 A;  3LQI A;  5JI8 A;  3Q2E A;  4QSV A;  5D3N A;  5A5S A;  2G4A A;  5EPR A;  3SVF A;  4UIY A;  4O77 A;  3SVH A;  3MXF A;  5FE2 A;  5LJ0 A;  5KO4 A;  4J0R A;  5EPS A;  5HJC A;  4NR7 A;  4TU6 A;  4UIW A;  5CFW A;  4QYD A;  5CUC A;  5EQ1 A;  1N72 A;  5EWH A;  5K29 A;  4MEP A;  5CP5 A;  5LKZ A;  4A9E A;  4X2I A;  5D3H A;  5EI4 A;  4O72 A;  2OSS A;  4J0S A;  4YK0 A;  5EWD A;  5D24 A;  4J1P A;  5HEM A;  5F1H A;  5A7C A;  4O74 A;  3UV4 A;  3JVL A;  4O7A A;  4CUU A;  4YYH A;  4LC2 A;  3JVK A;  5CQT A;  4HXP A;  4KV1 A;  4NRA A;  4O7E A;  5E9M A;  3DWY A;  5ETD A;  2L84 A;  3JVJ A;  4HBW A;  4CFL A;  5FFY A;  2FSA A;  4YAB A;  4XUB A;  5ETB A;  3DAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...