5ETDA

Crystal structure of the human brpf1 bromodomain in complex with seed14
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5etdA00
5L8UA 5I83A 4HBXA 5D24A 2RS9B 4QSQA 5EICA 5CZGA 4QBMA 3UW9A 4TU6A 1X0JA 5ENJA 5CTLA 4NR5A 5IG6A 4N4FA 4LR6A 3ONIA 5COIA 5HQ6A 4O71A 3LQHA 4CUPA 3MB3A 4Z6IA 4QEWA 3SVFA 4QR5A 5AMEA 4IR4A 3AADA 3NXBA 4QC3A 3HMFA 4J0SA 4QR4A 3AQAA 5F25A 5E3GA 5DYXA 4LZ2A 4BW1A 3UVYA 4QY4A 2DKWA 4HXOA 5CQ6A 5IBNA 3K2JA 5EWCA 4BW3A 5EPBA 5F3AA 4O72A 5BT4A 4QUUA 5L96A 4XY9A 3UV5A 5A7CA 4RVRA 5E9VA 3O37A 5DFBA 5CQAA 4YH4A 2RNXA 4HBVA 4NYWA 5D3HA 5A83A 4MR6A 5F1HA 4QUTA 5CQ5A 4CLBA 5BT5A 3D7CA 4BHWA 2FSAA 4NS5A 4ZC9A 3G0LA 4UIWA 4NRBA 4O74A 5I29A 2RNWA 3O34A 5A82A 5I86A 4TT2A 4BW4A 4O7CA 5LVQA 5I1QA 4LYSA 4XYAA 5CUEA 4QSXA 4FLPA 5IGMA 5HEMA 4HBWA 4YAXA 2GRCA 4NQMA 5D26A 4YY4A 5AD2A 5H1TA 2RO1A 4E96A 4CL9A 5HENA 4OUFA 5E74A 3QZTA 5F63A 5CFWA 3U5LA 5FG6A 5A81A 4MR3A 5LKZA 3JVMA 5FH7A 4YYHA 5D3PA 4PY6A 3MQMA 4UIYA 5EWWA 5KTUA 2N9GA 5ENIA 5CUGA 5EPRA 4Z1SA 5DY7A 5HRXA 5LJ0A 5F36A 2WP1A 4A9KA 5D3LA 3P1DA 2DWWA 4O7BA 5H85A 3P1EA 4A9JA 3LQIA 4PS5A 2OSSA 4NR4A 4YYNA 4CFKA 4LYIA 4J0RA 5A5NA 4QB3A 5CQ7A 5E7DA 2YELA 4ALHA 5DFCA 4QEUA 4TQNA 5EQ1A 5FDZA 2DVRA 2YQDA 4TU4A 2MJVB 5FB1A 3JVJA 4TTEA 2OO1A 5DW1A 5FE2A 5F2PA 5EM3A 1ZS5A 2DVSA 4NXJA 4TT4A 4TS8A 5I7XA 5AMFA 4BW2A 5ENBA 2L84A 5JWMA 4MR5A 5FE4A 5LJ1A 5D3TA 5I89A 5FFWA 2YEMA 5D25A 4UIZA 5CGPA 5IGNA 5CY9A 4HXRA 4Q0NA 5G4RA 3P5OA 2H60A 4KCXA 4IORA 4QZSA 5E9LA 4YK0A 4IR6A 4PKLA 5A85A 4DONA 3UVXA 5H1VA 5C7NA 4HXKA 4UYDA 5E0RA 4Y03A 5HQ7A 4XUBA 5EWHA 4NQNA 5HFRA 4N3WA 4LYWA 3UV2A 3SVGA 4XY8A 3RCWA 2R0VA 4N4IA 5FE1A 4LRGA 5HQ5A 5I7YA 2F6JA 5EWDA 5EPSA 5KHMA 4MENA 5ENGA 4QSPA 5DLXA 1WUGA 2G4AA 1E6IA 5C8GA 5FFYA 4J3IA 3SVHA 4NR9A 5FE6A 5ACYA 5FE0A 4A9HA 5CQ3A 5ETDA 5E73A 4HBYA 4OGIA 4QSTA 4QC1A 3U5JA 3HMEA 4UYGA 4CUSA 4YBSA 4MEQA 4IR5A 4QEVA 4J1PA 5I40A 3S92A 4A9IA 3TLPA 5FE3A 5E3DA 5L97A 5KU3A 4Z93A 5HRWA 5LUUA 5KO4A 5EA1A 4HXSA 5G4SA 4O77A 5KTXA 5L98A 4YABA 4YYMA 4WIVA 4NUCA 4PCIA 5CUDA 5CPEA 4O7EA 2I8NA 4TZ8A 4YBTA 5CP5A 4HXPA 5DX4A 2F6NA 2RNYA 5D0CA 4Z1QA 5ENEA 5C4QA 5EI4A 4LZRA 4QYDA 4O7FA 4UYEA 5DKDA 2DVQA 5D3NA 2KTBB 2L85A 4IOOA 5FG4A 3IU6A 4X2IA 5FFVA 4OGJA 2R0YA 2RI7A 4NRCA 5F5ZA 5EISA 5C87A 4YYJA 5JI8A 5F1LA 5DYCA 4A9NA 2E7OA 5ENCA 5E9IA 2WP2A 4MR4A 4Q0OA 5DBMA 4YY6A 5CS8A 5E9KA 4YADA 1JSPB 3O35A 3I3JA 2L5EA 2DVVA 5TB6A 3O36A 4PCEA 3Q2EA 5EGUA 5LKXA 5CUCA 4UIUA 5CUBA 4Z6HA 4C66A 5LKTA 3U5NA 4YYGA 4CUQA 3U5KA 4IOQA 5AD3A 5ENFA 5CUAA 5E9YA 4CFLA 2YYNA 5EU1A 3P1CA 5EP7A 4QR3A 4NR7A 5FG5A 4QSUA 5J0DA 5HM0A 5DW2A 4PTBA 4ZQLA 5F60A 4LDFA 4QSRA 4UYFB 5DYAA 3MB4A 3U5OA 5FE8A 3JVKA 5DLZA 3IU5A 4TYLA 4QYLA 4KV1A 4O75A 4CURA 2R0SA 3LQJA 5C85A 2NXBA 5EV9A 4GPJA 5ETBA 5HLSA 3JVLA 5FH6A 5D3SA 2R10A 5I80A 4A9FA 5CQ8A 5DFDA 3DWYA 5L8TA 5DKHA 3MULA 4YYIA 4QSVA 5A5SA 4WHUA 4BJXA 5II2A 4NR8A 3GG3A 4IR3A 4ALGA 2I7KA 4HXNA 3U5PA 4UITA 4QNSA 2RFJA 5II1A 5DKCA 4QSWA 3Q2FA 5FE9A 4NR6A 5ENHA 3HMHA 5D3RA 4O76A 5C89A 4MEPA 3QZVA 3LXJA 2E7NA 4HXLA 4C67A 5EVAA 5D3JA 5DYUA 3QZSA 5A5QA 2D82A 5H1UA 5HRVA 5FE7A 5F62A 4N4GA 4YATA 4LC2A 4YYDA 4TZ2A 3S91A 2OUOA 5CRZA 5CQ4A 5FB0A 4UYHA 5CU8A 5BT3A 5A5RA 4O78A 4A9LA 3ZYUA 4NUEA 5A5PA 4NYVA 1N72A 5LJ2A 5KTWA 2YEKA 2E3KA 4YC9A 3MXFA 5FE5A 4KV4A 5IIDA 5LKUA 4N4HA 4A9EA 5HJCA 4NYXA 5EWVA 4NUDA 4CUUA 4WHWA 5D7XA 5IGKA 3P1FA 4UIXA 5TCMA 3LJWA 4QSSA 4XUAA 1WUMA 4UIVA 3UVDA 5IGLA 2YW5A 2DATA 5FBXA 2YDWA 4AKNA 2D9EA 4YH3A 5I88A 5FH8A 1EQFA 4HXMA 5HELA 4O7AA 3UV4A 4YYKA 5HCLA 4CUTA 4NRAA 5K29A 5CRMA 5E9MA 4TT6A 1JM4B 3DAIA 4F3IA 5LVRA 4MEOA 4A9MA 5F61A 3MUKA 5A5OA 1F68A 5CQTA 4A9OA 3O33A 4O70A 4UYFA 4LZSA 4ZW1A 3FKMX 3G0JA 3UVWA 3U5MA 4YBMA 5EK9A 5L99A 2LSPB 5HFQA
chains in the Genus database with same CATH superfamily
5L8UA 5I83A 4HBXA 5D24A 2RS9B 4QSQA 5EICA 5CZGA 4QBMA 3UW9A 4TU6A 1X0JA 5ENJA 5CTLA 4NR5A 5IG6A 4N4FA 4LR6A 3ONIA 5COIA 5HQ6A 4O71A 3LQHA 4CUPA 3MB3A 4Z6IA 4QEWA 3SVFA 4QR5A 5AMEA 4IR4A 3AADA 3NXBA 4QC3A 3HMFA 4J0SA 4QR4A 3AQAA 5F25A 5E3GA 5DYXA 3D1DA 4LZ2A 4BW1A 3UVYA 4QY4A 2DKWA 4HXOA 5CQ6A 5IBNA 3K2JA 5EWCA 4BW3A 5EPBA 5F3AA 4O72A 5BT4A 4QUUA 5L96A 4XY9A 3UV5A 5A7CA 4RVRA 5E9VA 3O37A 5DFBA 5CQAA 4YH4A 2RNXA 4HBVA 4NYWA 5D3HA 5A83A 4MR6A 5F1HA 4QUTA 5CQ5A 4CLBA 5BT5A 3D7CA 4BHWA 2FSAA 3D1BA 4NS5A 4ZC9A 3G0LA 4UIWA 4NRBA 4O74A 5I29A 2RNWA 3O34A 5A82A 5I86A 4TT2A 4BW4A 4O7CA 5LVQA 5I1QA 4LYSA 4XYAA 5CUEA 4QSXA 4FLPA 5IGMA 5HEMA 4HBWA 4YAXA 2GRCA 4NQMA 5D26A 4YY4A 5AD2A 5H1TA 2RO1A 4E96A 4CL9A 5HENA 4OUFA 5E74A 3QZTA 5F63A 5CFWA 3U5LA 5FG6A 5A81A 4MR3A 5LKZA 3JVMA 5FH7A 4YYHA 5D3PA 4PY6A 3MQMA 4UIYA 5EWWA 5KTUA 2N9GA 5ENIA 5CUGA 5EPRA 4Z1SA 5DY7A 5HRXA 5LJ0A 5F36A 2WP1A 4A9KA 5D3LA 3P1DA 2DWWA 4O7BA 5H85A 3P1EA 4A9JA 3LQIA 4PS5A 2OSSA 3VKGA 4NR4A 4YYNA 4CFKA 4LYIA 4J0RA 5A5NA 4QB3A 5CQ7A 5E7DA 2YELA 4ALHA 5DFCA 4QEUA 4TQNA 5EQ1A 5FDZA 2DVRA 2YQDA 4TU4A 2MJVB 5FB1A 3JVJA 4TTEA 2OO1A 5DW1A 5FE2A 5F2PA 5EM3A 1ZS5A 2DVSA 4NXJA 4TT4A 4TS8A 5I7XA 5AMFA 4BW2A 5ENBA 2L84A 5JWMA 4MR5A 5FE4A 5LJ1A 5D3TA 5I89A 5FFWA 2YEMA 5D25A 4UIZA 5CGPA 5IGNA 5CY9A 4HXRA 4Q0NA 5G4RA 3P5OA 2H60A 4KCXA 4IORA 4QZSA 5E9LA 4YK0A 4IR6A 4PKLA 5A85A 4DONA 3UVXA 5H1VA 5C7NA 1ZKRA 4HXKA 4UYDA 5E0RA 4Y03A 5HQ7A 4XUBA 5EWHA 4NQNA 5HFRA 4N3WA 4LYWA 3UV2A 3SVGA 4XY8A 3RCWA 2R0VA 4N4IA 5FE1A 4LRGA 5HQ5A 5I7YA 2F6JA 5EWDA 5EPSA 5KHMA 4MENA 5ENGA 4QSPA 5DLXA 1WUGA 2G4AA 1E6IA 5C8GA 5FFYA 4J3IA 3SVHA 4NR9A 5FE6A 5ACYA 5FE0A 4A9HA 5CQ3A 5ETDA 5E73A 4HBYA 4OGIA 4QSTA 4QC1A 3U5JA 3HMEA 4UYGA 4CUSA 4YBSA 4MEQA 4IR5A 4QEVA 4J1PA 5I40A 3S92A 4A9IA 3TLPA 5FE3A 5E3DA 5L97A 5KU3A 4Z93A 5HRWA 5LUUA 5KO4A 5EA1A 4HXSA 5G4SA 4O77A 5KTXA 5L98A 4YABA 4YYMA 4WIVA 4NUCA 4PCIA 5CUDA 5CPEA 4O7EA 2I8NA 4TZ8A 4YBTA 5CP5A 4HXPA 5DX4A 2F6NA 2RNYA 5D0CA 4Z1QA 5ENEA 5C4QA 5EI4A 4LZRA 4QYDA 4O7FA 4UYEA 5DKDA 2DVQA 5D3NA 2KTBB 2L85A 4IOOA 5FG4A 3IU6A 4X2IA 5FFVA 4OGJA 2R0YA 2RI7A 4NRCA 5F5ZA 5EISA 5C87A 4YYJA 5JI8A 3VKHA 5F1LA 5DYCA 4A9NA 2E7OA 4AKGA 5ENCA 5E9IA 2WP2A 4MR4A 4Q0OA 5DBMA 4YY6A 5CS8A 5E9KA 4YADA 1JSPB 3O35A 3I3JA 2L5EA 2DVVA 5TB6A 3O36A 4PCEA 2EJNA 3Q2EA 5EGUA 5LKXA 5CUCA 4UIUA 5CUBA 4Z6HA 4C66A 5LKTA 3U5NA 4YYGA 4CUQA 4AI6A 3U5KA 4IOQA 5AD3A 5ENFA 5CUAA 5E9YA 4CFLA 2YYNA 5EU1A 3P1CA 5EP7A 4QR3A 4NR7A 5FG5A 4QSUA 5J0DA 5HM0A 5DW2A 4PTBA 4ZQLA 5F60A 4LDFA 4QSRA 4UYFB 5DYAA 3MB4A 3U5OA 5FE8A 3JVKA 5DLZA 3IU5A 4TYLA 4QYLA 4KV1A 4O75A 4CURA 2R0SA 3LQJA 5C85A 2NXBA 5EV9A 4GPJA 3ERRA 5ETBA 5HLSA 3JVLA 4AKIA 5FH6A 5D3SA 2R10A 5I80A 4A9FA 5CQ8A 5DFDA 3DWYA 5L8TA 5DKHA 3MULA 4YYIA 4QSVA 5A5SA 4WHUA 4BJXA 5II2A 4NR8A 3GG3A 4IR3A 4ALGA 2I7KA 4HXNA 3U5PA 4UITA 4QNSA 2RFJA 5II1A 5DKCA 4QSWA 3Q2FA 5FE9A 4NR6A 5ENHA 3HMHA 5D3RA 4O76A 5C89A 4MEPA 3QZVA 3LXJA 2E7NA 4HXLA 4C67A 5EVAA 5D3JA 5DYUA 3QZSA 5A5QA 2D82A 5H1UA 5HRVA 5FE7A 5F62A 4N4GA 4YATA 4LC2A 4YYDA 4TZ2A 3S91A 2OUOA 5CRZA 5CQ4A 5FB0A 4UYHA 5CU8A 5BT3A 5A5RA 4O78A 4A9LA 3ZYUA 4NUEA 5A5PA 4NYVA 1N72A 5LJ2A 5KTWA 2YEKA 2E3KA 4YC9A 3MXFA 5FE5A 4KV4A 5IIDA 5LKUA 4N4HA 4A9EA 5HJCA 4NYXA 5EWVA 4NUDA 4CUUA 4WHWA 5D7XA 5IGKA 1PUOA 3P1FA 4UIXA 5TCMA 3LJWA 4QSSA 4XUAA 1WUMA 4UIVA 3UVDA 5IGLA 2YW5A 2DATA 5FBXA 2YDWA 4AKNA 2D9EA 4YH3A 5I88A 5FH8A 1EQFA 4HXMA 5HELA 4O7AA 3UV4A 4YYKA 5HCLA 4CUTA 4NRAA 5K29A 5CRMA 5E9MA 4TT6A 1JM4B 3DAIA 4F3IA 5LVRA 4MEOA 4A9MA 4AKHA 5F61A 3MUKA 5A5OA 1F68A 5CQTA 4A9OA 3O33A 4O70A 4UYFA 4LZSA 4ZW1A 3FKMX 3G0JA 3UVWA 3U5MA 4YBMA 5EK9A 5L99A 2LSPB 5HFQA
chains in the Genus database with same CATH topology
5L8UA 5I83A 4HBXA 5D24A 2RS9B 4QSQA 5EICA 5CZGA 4QBMA 3UW9A 4TU6A 1X0JA 5ENJA 5CTLA 4NR5A 5IG6A 4N4FA 4LR6A 3ONIA 5COIA 5HQ6A 4O71A 3LQHA 4CUPA 3MB3A 4Z6IA 4QEWA 3SVFA 4QR5A 5AMEA 4IR4A 3AADA 3NXBA 4QC3A 3HMFA 4J0SA 4QR4A 3AQAA 5F25A 5E3GA 5DYXA 4LZ2A 4BW1A 3UVYA 4QY4A 2DKWA 4HXOA 5CQ6A 5IBNA 3K2JA 5EWCA 4BW3A 5EPBA 5F3AA 4O72A 5BT4A 4QUUA 5L96A 4XY9A 3UV5A 5A7CA 4RVRA 5E9VA 3O37A 5DFBA 5CQAA 4YH4A 2RNXA 4HBVA 4NYWA 5D3HA 5A83A 4MR6A 5F1HA 4QUTA 5CQ5A 4CLBA 5BT5A 3D7CA 4BHWA 2FSAA 4NS5A 4ZC9A 3G0LA 4UIWA 4NRBA 4O74A 5I29A 2RNWA 3O34A 5A82A 5I86A 4TT2A 4BW4A 4O7CA 5LVQA 5I1QA 4LYSA 4XYAA 5CUEA 4QSXA 4FLPA 5IGMA 5HEMA 4HBWA 4YAXA 2GRCA 4NQMA 5D26A 4YY4A 5AD2A 5H1TA 2RO1A 4E96A 4CL9A 5HENA 4OUFA 5E74A 3QZTA 5F63A 5CFWA 3U5LA 5FG6A 5A81A 4MR3A 5LKZA 3JVMA 5FH7A 4YYHA 5D3PA 4PY6A 3MQMA 4UIYA 5EWWA 5KTUA 2N9GA 5ENIA 5CUGA 5EPRA 4Z1SA 5DY7A 5HRXA 5LJ0A 5F36A 2WP1A 4A9KA 5D3LA 3P1DA 2DWWA 4O7BA 5H85A 3P1EA 4A9JA 3LQIA 4PS5A 2OSSA 4NR4A 4YYNA 4CFKA 4LYIA 4J0RA 5A5NA 4QB3A 5CQ7A 5E7DA 2YELA 4ALHA 5DFCA 4QEUA 4TQNA 5EQ1A 5FDZA 2DVRA 2YQDA 4TU4A 2MJVB 5FB1A 3JVJA 4TTEA 2OO1A 5DW1A 5FE2A 5F2PA 5EM3A 1ZS5A 2DVSA 4NXJA 4TT4A 4TS8A 5I7XA 5AMFA 4BW2A 5ENBA 2L84A 5JWMA 4MR5A 5FE4A 5LJ1A 5D3TA 5I89A 5FFWA 2YEMA 5D25A 4UIZA 5CGPA 5IGNA 5CY9A 4HXRA 4Q0NA 5G4RA 3P5OA 2H60A 4KCXA 4IORA 4QZSA 5E9LA 4YK0A 4IR6A 4PKLA 5A85A 4DONA 3UVXA 5H1VA 5C7NA 4HXKA 4UYDA 5E0RA 4Y03A 5HQ7A 4XUBA 5EWHA 4NQNA 5HFRA 4N3WA 4LYWA 3UV2A 3SVGA 4XY8A 3RCWA 2R0VA 4N4IA 5FE1A 4LRGA 5HQ5A 5I7YA 2F6JA 5EWDA 5EPSA 5KHMA 4MENA 5ENGA 4QSPA 5DLXA 1WUGA 2G4AA 1E6IA 5C8GA 5FFYA 4J3IA 3SVHA 4NR9A 5FE6A 5ACYA 5FE0A 4A9HA 5CQ3A 5ETDA 5E73A 4HBYA 4OGIA 4QSTA 4QC1A 3U5JA 3HMEA 4UYGA 4CUSA 4YBSA 4MEQA 4IR5A 4QEVA 4J1PA 5I40A 3S92A 4A9IA 3TLPA 5FE3A 5E3DA 5L97A 5KU3A 4Z93A 5HRWA 5LUUA 5KO4A 5EA1A 4HXSA 5G4SA 4O77A 5KTXA 5L98A 4YABA 4YYMA 4WIVA 4NUCA 4PCIA 5CUDA 5CPEA 4O7EA 2I8NA 4TZ8A 4YBTA 5CP5A 4HXPA 5DX4A 2F6NA 2RNYA 5D0CA 4Z1QA 5ENEA 5C4QA 5EI4A 4LZRA 4QYDA 4O7FA 4UYEA 5DKDA 2DVQA 5D3NA 2KTBB 2L85A 4IOOA 5FG4A 3IU6A 4X2IA 5FFVA 4OGJA 2R0YA 2RI7A 4NRCA 5F5ZA 5EISA 5C87A 4YYJA 5JI8A 5F1LA 5DYCA 4A9NA 2E7OA 5ENCA 5E9IA 2WP2A 4MR4A 4Q0OA 5DBMA 4YY6A 5CS8A 5E9KA 4YADA 1JSPB 3O35A 3I3JA 2L5EA 2DVVA 5TB6A 3O36A 4PCEA 3Q2EA 5EGUA 5LKXA 5CUCA 4UIUA 5CUBA 4Z6HA 4C66A 5LKTA 3U5NA 4YYGA 4CUQA 3U5KA 4IOQA 5AD3A 5ENFA 5CUAA 5E9YA 4CFLA 2YYNA 5EU1A 3P1CA 5EP7A 4QR3A 4NR7A 5FG5A 4QSUA 5J0DA 5HM0A 5DW2A 4PTBA 4ZQLA 5F60A 4LDFA 4QSRA 4UYFB 5DYAA 3MB4A 3U5OA 5FE8A 3JVKA 5DLZA 3IU5A 4TYLA 4QYLA 4KV1A 4O75A 4CURA 2R0SA 3LQJA 5C85A 2NXBA 5EV9A 4GPJA 5ETBA 5HLSA 3JVLA 5FH6A 5D3SA 2R10A 5I80A 4A9FA 5CQ8A 5DFDA 3DWYA 5L8TA 5DKHA 3MULA 4YYIA 4QSVA 5A5SA 4WHUA 4BJXA 5II2A 4NR8A 3GG3A 4IR3A 4ALGA 2I7KA 4HXNA 3U5PA 4UITA 4QNSA 2RFJA 5II1A 5DKCA 4QSWA 3Q2FA 5FE9A 4NR6A 5ENHA 3HMHA 5D3RA 4O76A 5C89A 4MEPA 3QZVA 3LXJA 2E7NA 4HXLA 4C67A 5EVAA 5D3JA 5DYUA 3QZSA 5A5QA 2D82A 5H1UA 5HRVA 5FE7A 5F62A 4N4GA 4YATA 4LC2A 4YYDA 4TZ2A 3S91A 2OUOA 5CRZA 5CQ4A 5FB0A 4UYHA 5CU8A 5BT3A 5A5RA 4O78A 4A9LA 3ZYUA 4NUEA 5A5PA 4NYVA 1N72A 5LJ2A 5KTWA 2YEKA 2E3KA 4YC9A 3MXFA 5FE5A 4KV4A 5IIDA 5LKUA 4N4HA 4A9EA 5HJCA 4NYXA 5EWVA 4NUDA 4CUUA 4WHWA 5D7XA 5IGKA 3P1FA 4UIXA 5TCMA 3LJWA 4QSSA 4XUAA 1WUMA 4UIVA 3UVDA 5IGLA 2YW5A 2DATA 5FBXA 2YDWA 4AKNA 2D9EA 4YH3A 5I88A 5FH8A 1EQFA 4HXMA 5HELA 4O7AA 3UV4A 4YYKA 5HCLA 4CUTA 4NRAA 5K29A 5CRMA 5E9MA 4TT6A 1JM4B 3DAIA 4F3IA 5LVRA 4MEOA 4A9MA 5F61A 3MUKA 5A5OA 1F68A 5CQTA 4A9OA 3O33A 4O70A 4UYFA 4LZSA 4ZW1A 3FKMX 3G0JA 3UVWA 3U5MA 4YBMA 5EK9A 5L99A 2LSPB 5HFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8U A;  5I83 A;  4HBX A;  5D24 A;  2RS9 B;  4QSQ A;  5EIC A;  5CZG A;  4QBM A;  3UW9 A;  4TU6 A;  1X0J A;  5ENJ A;  5CTL A;  4NR5 A;  5IG6 A;  4N4F A;  4LR6 A;  3ONI A;  5COI A;  5HQ6 A;  4O71 A;  3LQH A;  4CUP A;  3MB3 A;  4Z6I A;  4QEW A;  3SVF A;  4QR5 A;  5AME A;  4IR4 A;  3AAD A;  3NXB A;  4QC3 A;  3HMF A;  4J0S A;  4QR4 A;  3AQA A;  5F25 A;  5E3G A;  5DYX A;  4LZ2 A;  4BW1 A;  3UVY A;  4QY4 A;  2DKW A;  4HXO A;  5CQ6 A;  5IBN A;  3K2J A;  5EWC A;  4BW3 A;  5EPB A;  5F3A A;  4O72 A;  5BT4 A;  4QUU A;  5L96 A;  4XY9 A;  3UV5 A;  5A7C A;  4RVR A;  5E9V A;  3O37 A;  5DFB A;  5CQA A;  4YH4 A;  2RNX A;  4HBV A;  4NYW A;  5D3H A;  5A83 A;  4MR6 A;  5F1H A;  4QUT A;  5CQ5 A;  4CLB A;  5BT5 A;  3D7C A;  4BHW A;  2FSA A;  4NS5 A;  4ZC9 A;  3G0L A;  4UIW A;  4NRB A;  4O74 A;  5I29 A;  2RNW A;  3O34 A;  5A82 A;  5I86 A;  4TT2 A;  4BW4 A;  4O7C A;  5LVQ A;  5I1Q A;  4LYS A;  4XYA A;  5CUE A;  4QSX A;  4FLP A;  5IGM A;  5HEM A;  4HBW A;  4YAX A;  2GRC A;  4NQM A;  5D26 A;  4YY4 A;  5AD2 A;  5H1T A;  2RO1 A;  4E96 A;  4CL9 A;  5HEN A;  4OUF A;  5E74 A;  3QZT A;  5F63 A;  5CFW A;  3U5L A;  5FG6 A;  5A81 A;  4MR3 A;  5LKZ A;  3JVM A;  5FH7 A;  4YYH A;  5D3P A;  4PY6 A;  3MQM A;  4UIY A;  5EWW A;  5KTU A;  2N9G A;  5ENI A;  5CUG A;  5EPR A;  4Z1S A;  5DY7 A;  5HRX A;  5LJ0 A;  5F36 A;  2WP1 A;  4A9K A;  5D3L A;  3P1D A;  2DWW A;  4O7B A;  5H85 A;  3P1E A;  4A9J A;  3LQI A;  4PS5 A;  2OSS A;  4NR4 A;  4YYN A;  4CFK A;  4LYI A;  4J0R A;  5A5N A;  4QB3 A;  5CQ7 A;  5E7D A;  2YEL A;  4ALH A;  5DFC A;  4QEU A;  4TQN A;  5EQ1 A;  5FDZ A;  2DVR A;  2YQD A;  4TU4 A;  2MJV B;  5FB1 A;  3JVJ A;  4TTE A;  2OO1 A;  5DW1 A;  5FE2 A;  5F2P A;  5EM3 A;  1ZS5 A;  2DVS A;  4NXJ A;  4TT4 A;  4TS8 A;  5I7X A;  5AMF A;  4BW2 A;  5ENB A;  2L84 A;  5JWM A;  4MR5 A;  5FE4 A;  5LJ1 A;  5D3T A;  5I89 A;  5FFW A;  2YEM A;  5D25 A;  4UIZ A;  5CGP A;  5IGN A;  5CY9 A;  4HXR A;  4Q0N A;  5G4R A;  3P5O A;  2H60 A;  4KCX A;  4IOR A;  4QZS A;  5E9L A;  4YK0 A;  4IR6 A;  4PKL A;  5A85 A;  4DON A;  3UVX A;  5H1V A;  5C7N A;  4HXK A;  4UYD A;  5E0R A;  4Y03 A;  5HQ7 A;  4XUB A;  5EWH A;  4NQN A;  5HFR A;  4N3W A;  4LYW A;  3UV2 A;  3SVG A;  4XY8 A;  3RCW A;  2R0V A;  4N4I A;  5FE1 A;  4LRG A;  5HQ5 A;  5I7Y A;  2F6J A;  5EWD A;  5EPS A;  5KHM A;  4MEN A;  5ENG A;  4QSP A;  5DLX A;  1WUG A;  2G4A A;  1E6I A;  5C8G A;  5FFY A;  4J3I A;  3SVH A;  4NR9 A;  5FE6 A;  5ACY A;  5FE0 A;  4A9H A;  5CQ3 A;  5ETD A;  5E73 A;  4HBY A;  4OGI A;  4QST A;  4QC1 A;  3U5J A;  3HME A;  4UYG A;  4CUS A;  4YBS A;  4MEQ A;  4IR5 A;  4QEV A;  4J1P A;  5I40 A;  3S92 A;  4A9I A;  3TLP A;  5FE3 A;  5E3D A;  5L97 A;  5KU3 A;  4Z93 A;  5HRW A;  5LUU A;  5KO4 A;  5EA1 A;  4HXS A;  5G4S A;  4O77 A;  5KTX A;  5L98 A;  4YAB A;  4YYM A;  4WIV A;  4NUC A;  4PCI A;  5CUD A;  5CPE A;  4O7E A;  2I8N A;  4TZ8 A;  4YBT A;  5CP5 A;  4HXP A;  5DX4 A;  2F6N A;  2RNY A;  5D0C A;  4Z1Q A;  5ENE A;  5C4Q A;  5EI4 A;  4LZR A;  4QYD A;  4O7F A;  4UYE A;  5DKD A;  2DVQ A;  5D3N A;  2KTB B;  2L85 A;  4IOO A;  5FG4 A;  3IU6 A;  4X2I A;  5FFV A;  4OGJ A;  2R0Y A;  2RI7 A;  4NRC A;  5F5Z A;  5EIS A;  5C87 A;  4YYJ A;  5JI8 A;  5F1L A;  5DYC A;  4A9N A;  2E7O A;  5ENC A;  5E9I A;  2WP2 A;  4MR4 A;  4Q0O A;  5DBM A;  4YY6 A;  5CS8 A;  5E9K A;  4YAD A;  1JSP B;  3O35 A;  3I3J A;  2L5E A;  2DVV A;  5TB6 A;  3O36 A;  4PCE A;  3Q2E A;  5EGU A;  5LKX A;  5CUC A;  4UIU A;  5CUB A;  4Z6H A;  4C66 A;  5LKT A;  3U5N A;  4YYG A;  4CUQ A;  3U5K A;  4IOQ A;  5AD3 A;  5ENF A;  5CUA A;  5E9Y A;  4CFL A;  2YYN A;  5EU1 A;  3P1C A;  5EP7 A;  4QR3 A;  4NR7 A;  5FG5 A;  4QSU A;  5J0D A;  5HM0 A;  5DW2 A;  4PTB A;  4ZQL A;  5F60 A;  4LDF A;  4QSR A;  4UYF B;  5DYA A;  3MB4 A;  3U5O A;  5FE8 A;  3JVK A;  5DLZ A;  3IU5 A;  4TYL A;  4QYL A;  4KV1 A;  4O75 A;  4CUR A;  2R0S A;  3LQJ A;  5C85 A;  2NXB A;  5EV9 A;  4GPJ A;  5ETB A;  5HLS A;  3JVL A;  5FH6 A;  5D3S A;  2R10 A;  5I80 A;  4A9F A;  5CQ8 A;  5DFD A;  3DWY A;  5L8T A;  5DKH A;  3MUL A;  4YYI A;  4QSV A;  5A5S A;  4WHU A;  4BJX A;  5II2 A;  4NR8 A;  3GG3 A;  4IR3 A;  4ALG A;  2I7K A;  4HXN A;  3U5P A;  4UIT A;  4QNS A;  2RFJ A;  5II1 A;  5DKC A;  4QSW A;  3Q2F A;  5FE9 A;  4NR6 A;  5ENH A;  3HMH A;  5D3R A;  4O76 A;  5C89 A;  4MEP A;  3QZV A;  3LXJ A;  2E7N A;  4HXL A;  4C67 A;  5EVA A;  5D3J A;  5DYU A;  3QZS A;  5A5Q A;  2D82 A;  5H1U A;  5HRV A;  5FE7 A;  5F62 A;  4N4G A;  4YAT A;  4LC2 A;  4YYD A;  4TZ2 A;  3S91 A;  2OUO A;  5CRZ A;  5CQ4 A;  5FB0 A;  4UYH A;  5CU8 A;  5BT3 A;  5A5R A;  4O78 A;  4A9L A;  3ZYU A;  4NUE A;  5A5P A;  4NYV A;  1N72 A;  5LJ2 A;  5KTW A;  2YEK A;  2E3K A;  4YC9 A;  3MXF A;  5FE5 A;  4KV4 A;  5IID A;  5LKU A;  4N4H A;  4A9E A;  5HJC A;  4NYX A;  5EWV A;  4NUD A;  4CUU A;  4WHW A;  5D7X A;  5IGK A;  3P1F A;  4UIX A;  5TCM A;  3LJW A;  4QSS A;  4XUA A;  1WUM A;  4UIV A;  3UVD A;  5IGL A;  2YW5 A;  2DAT A;  5FBX A;  2YDW A;  4AKN A;  2D9E A;  4YH3 A;  5I88 A;  5FH8 A;  1EQF A;  4HXM A;  5HEL A;  4O7A A;  3UV4 A;  4YYK A;  5HCL A;  4CUT A;  4NRA A;  5K29 A;  5CRM A;  5E9M A;  4TT6 A;  1JM4 B;  3DAI A;  4F3I A;  5LVR A;  4MEO A;  4A9M A;  5F61 A;  3MUK A;  5A5O A;  1F68 A;  5CQT A;  4A9O A;  3O33 A;  4O70 A;  4UYF A;  4LZS A;  4ZW1 A;  3FKM X;  3G0J A;  3UVW A;  3U5M A;  4YBM A;  5EK9 A;  5L99 A;  2LSP B;  5HFQ A; 
#chains in the Genus database with same CATH topology
 5L8U A;  5I83 A;  4HBX A;  5D24 A;  2RS9 B;  4QSQ A;  5EIC A;  5CZG A;  4QBM A;  3UW9 A;  4TU6 A;  1X0J A;  5ENJ A;  5CTL A;  4NR5 A;  5IG6 A;  4N4F A;  4LR6 A;  3ONI A;  5COI A;  5HQ6 A;  4O71 A;  3LQH A;  4CUP A;  3MB3 A;  4Z6I A;  4QEW A;  3SVF A;  4QR5 A;  5AME A;  4IR4 A;  3AAD A;  3NXB A;  4QC3 A;  3HMF A;  4J0S A;  4QR4 A;  3AQA A;  5F25 A;  5E3G A;  5DYX A;  3D1D A;  4LZ2 A;  4BW1 A;  3UVY A;  4QY4 A;  2DKW A;  4HXO A;  5CQ6 A;  5IBN A;  3K2J A;  5EWC A;  4BW3 A;  5EPB A;  5F3A A;  4O72 A;  5BT4 A;  4QUU A;  5L96 A;  4XY9 A;  3UV5 A;  5A7C A;  4RVR A;  5E9V A;  3O37 A;  5DFB A;  5CQA A;  4YH4 A;  2RNX A;  4HBV A;  4NYW A;  5D3H A;  5A83 A;  4MR6 A;  5F1H A;  4QUT A;  5CQ5 A;  4CLB A;  5BT5 A;  3D7C A;  4BHW A;  2FSA A;  3D1B A;  4NS5 A;  4ZC9 A;  3G0L A;  4UIW A;  4NRB A;  4O74 A;  5I29 A;  2RNW A;  3O34 A;  5A82 A;  5I86 A;  4TT2 A;  4BW4 A;  4O7C A;  5LVQ A;  5I1Q A;  4LYS A;  4XYA A;  5CUE A;  4QSX A;  4FLP A;  5IGM A;  5HEM A;  4HBW A;  4YAX A;  2GRC A;  4NQM A;  5D26 A;  4YY4 A;  5AD2 A;  5H1T A;  2RO1 A;  4E96 A;  4CL9 A;  5HEN A;  4OUF A;  5E74 A;  3QZT A;  5F63 A;  5CFW A;  3U5L A;  5FG6 A;  5A81 A;  4MR3 A;  5LKZ A;  3JVM A;  5FH7 A;  4YYH A;  5D3P A;  4PY6 A;  3MQM A;  4UIY A;  5EWW A;  5KTU A;  2N9G A;  5ENI A;  5CUG A;  5EPR A;  4Z1S A;  5DY7 A;  5HRX A;  5LJ0 A;  5F36 A;  2WP1 A;  4A9K A;  5D3L A;  3P1D A;  2DWW A;  4O7B A;  5H85 A;  3P1E A;  4A9J A;  3LQI A;  4PS5 A;  2OSS A;  3VKG A;  4NR4 A;  4YYN A;  4CFK A;  4LYI A;  4J0R A;  5A5N A;  4QB3 A;  5CQ7 A;  5E7D A;  2YEL A;  4ALH A;  5DFC A;  4QEU A;  4TQN A;  5EQ1 A;  5FDZ A;  2DVR A;  2YQD A;  4TU4 A;  2MJV B;  5FB1 A;  3JVJ A;  4TTE A;  2OO1 A;  5DW1 A;  5FE2 A;  5F2P A;  5EM3 A;  1ZS5 A;  2DVS A;  4NXJ A;  4TT4 A;  4TS8 A;  5I7X A;  5AMF A;  4BW2 A;  5ENB A;  2L84 A;  5JWM A;  4MR5 A;  5FE4 A;  5LJ1 A;  5D3T A;  5I89 A;  5FFW A;  2YEM A;  5D25 A;  4UIZ A;  5CGP A;  5IGN A;  5CY9 A;  4HXR A;  4Q0N A;  5G4R A;  3P5O A;  2H60 A;  4KCX A;  4IOR A;  4QZS A;  5E9L A;  4YK0 A;  4IR6 A;  4PKL A;  5A85 A;  4DON A;  3UVX A;  5H1V A;  5C7N A;  1ZKR A;  4HXK A;  4UYD A;  5E0R A;  4Y03 A;  5HQ7 A;  4XUB A;  5EWH A;  4NQN A;  5HFR A;  4N3W A;  4LYW A;  3UV2 A;  3SVG A;  4XY8 A;  3RCW A;  2R0V A;  4N4I A;  5FE1 A;  4LRG A;  5HQ5 A;  5I7Y A;  2F6J A;  5EWD A;  5EPS A;  5KHM A;  4MEN A;  5ENG A;  4QSP A;  5DLX A;  1WUG A;  2G4A A;  1E6I A;  5C8G A;  5FFY A;  4J3I A;  3SVH A;  4NR9 A;  5FE6 A;  5ACY A;  5FE0 A;  4A9H A;  5CQ3 A;  5ETD A;  5E73 A;  4HBY A;  4OGI A;  4QST A;  4QC1 A;  3U5J A;  3HME A;  4UYG A;  4CUS A;  4YBS A;  4MEQ A;  4IR5 A;  4QEV A;  4J1P A;  5I40 A;  3S92 A;  4A9I A;  3TLP A;  5FE3 A;  5E3D A;  5L97 A;  5KU3 A;  4Z93 A;  5HRW A;  5LUU A;  5KO4 A;  5EA1 A;  4HXS A;  5G4S A;  4O77 A;  5KTX A;  5L98 A;  4YAB A;  4YYM A;  4WIV A;  4NUC A;  4PCI A;  5CUD A;  5CPE A;  4O7E A;  2I8N A;  4TZ8 A;  4YBT A;  5CP5 A;  4HXP A;  5DX4 A;  2F6N A;  2RNY A;  5D0C A;  4Z1Q A;  5ENE A;  5C4Q A;  5EI4 A;  4LZR A;  4QYD A;  4O7F A;  4UYE A;  5DKD A;  2DVQ A;  5D3N A;  2KTB B;  2L85 A;  4IOO A;  5FG4 A;  3IU6 A;  4X2I A;  5FFV A;  4OGJ A;  2R0Y A;  2RI7 A;  4NRC A;  5F5Z A;  5EIS A;  5C87 A;  4YYJ A;  5JI8 A;  3VKH A;  5F1L A;  5DYC A;  4A9N A;  2E7O A;  4AKG A;  5ENC A;  5E9I A;  2WP2 A;  4MR4 A;  4Q0O A;  5DBM A;  4YY6 A;  5CS8 A;  5E9K A;  4YAD A;  1JSP B;  3O35 A;  3I3J A;  2L5E A;  2DVV A;  5TB6 A;  3O36 A;  4PCE A;  2EJN A;  3Q2E A;  5EGU A;  5LKX A;  5CUC A;  4UIU A;  5CUB A;  4Z6H A;  4C66 A;  5LKT A;  3U5N A;  4YYG A;  4CUQ A;  4AI6 A;  3U5K A;  4IOQ A;  5AD3 A;  5ENF A;  5CUA A;  5E9Y A;  4CFL A;  2YYN A;  5EU1 A;  3P1C A;  5EP7 A;  4QR3 A;  4NR7 A;  5FG5 A;  4QSU A;  5J0D A;  5HM0 A;  5DW2 A;  4PTB A;  4ZQL A;  5F60 A;  4LDF A;  4QSR A;  4UYF B;  5DYA A;  3MB4 A;  3U5O A;  5FE8 A;  3JVK A;  5DLZ A;  3IU5 A;  4TYL A;  4QYL A;  4KV1 A;  4O75 A;  4CUR A;  2R0S A;  3LQJ A;  5C85 A;  2NXB A;  5EV9 A;  4GPJ A;  3ERR A;  5ETB A;  5HLS A;  3JVL A;  4AKI A;  5FH6 A;  5D3S A;  2R10 A;  5I80 A;  4A9F A;  5CQ8 A;  5DFD A;  3DWY A;  5L8T A;  5DKH A;  3MUL A;  4YYI A;  4QSV A;  5A5S A;  4WHU A;  4BJX A;  5II2 A;  4NR8 A;  3GG3 A;  4IR3 A;  4ALG A;  2I7K A;  4HXN A;  3U5P A;  4UIT A;  4QNS A;  2RFJ A;  5II1 A;  5DKC A;  4QSW A;  3Q2F A;  5FE9 A;  4NR6 A;  5ENH A;  3HMH A;  5D3R A;  4O76 A;  5C89 A;  4MEP A;  3QZV A;  3LXJ A;  2E7N A;  4HXL A;  4C67 A;  5EVA A;  5D3J A;  5DYU A;  3QZS A;  5A5Q A;  2D82 A;  5H1U A;  5HRV A;  5FE7 A;  5F62 A;  4N4G A;  4YAT A;  4LC2 A;  4YYD A;  4TZ2 A;  3S91 A;  2OUO A;  5CRZ A;  5CQ4 A;  5FB0 A;  4UYH A;  5CU8 A;  5BT3 A;  5A5R A;  4O78 A;  4A9L A;  3ZYU A;  4NUE A;  5A5P A;  4NYV A;  1N72 A;  5LJ2 A;  5KTW A;  2YEK A;  2E3K A;  4YC9 A;  3MXF A;  5FE5 A;  4KV4 A;  5IID A;  5LKU A;  4N4H A;  4A9E A;  5HJC A;  4NYX A;  5EWV A;  4NUD A;  4CUU A;  4WHW A;  5D7X A;  5IGK A;  1PUO A;  3P1F A;  4UIX A;  5TCM A;  3LJW A;  4QSS A;  4XUA A;  1WUM A;  4UIV A;  3UVD A;  5IGL A;  2YW5 A;  2DAT A;  5FBX A;  2YDW A;  4AKN A;  2D9E A;  4YH3 A;  5I88 A;  5FH8 A;  1EQF A;  4HXM A;  5HEL A;  4O7A A;  3UV4 A;  4YYK A;  5HCL A;  4CUT A;  4NRA A;  5K29 A;  5CRM A;  5E9M A;  4TT6 A;  1JM4 B;  3DAI A;  4F3I A;  5LVR A;  4MEO A;  4A9M A;  4AKH A;  5F61 A;  3MUK A;  5A5O A;  1F68 A;  5CQT A;  4A9O A;  3O33 A;  4O70 A;  4UYF A;  4LZS A;  4ZW1 A;  3FKM X;  3G0J A;  3UVW A;  3U5M A;  4YBM A;  5EK9 A;  5L99 A;  2LSP B;  5HFQ A; 
#chains in the Genus database with same CATH homology
 5L8U A;  5I83 A;  4HBX A;  5D24 A;  2RS9 B;  4QSQ A;  5EIC A;  5CZG A;  4QBM A;  3UW9 A;  4TU6 A;  1X0J A;  5ENJ A;  5CTL A;  4NR5 A;  5IG6 A;  4N4F A;  4LR6 A;  3ONI A;  5COI A;  5HQ6 A;  4O71 A;  3LQH A;  4CUP A;  3MB3 A;  4Z6I A;  4QEW A;  3SVF A;  4QR5 A;  5AME A;  4IR4 A;  3AAD A;  3NXB A;  4QC3 A;  3HMF A;  4J0S A;  4QR4 A;  3AQA A;  5F25 A;  5E3G A;  5DYX A;  4LZ2 A;  4BW1 A;  3UVY A;  4QY4 A;  2DKW A;  4HXO A;  5CQ6 A;  5IBN A;  3K2J A;  5EWC A;  4BW3 A;  5EPB A;  5F3A A;  4O72 A;  5BT4 A;  4QUU A;  5L96 A;  4XY9 A;  3UV5 A;  5A7C A;  4RVR A;  5E9V A;  3O37 A;  5DFB A;  5CQA A;  4YH4 A;  2RNX A;  4HBV A;  4NYW A;  5D3H A;  5A83 A;  4MR6 A;  5F1H A;  4QUT A;  5CQ5 A;  4CLB A;  5BT5 A;  3D7C A;  4BHW A;  2FSA A;  4NS5 A;  4ZC9 A;  3G0L A;  4UIW A;  4NRB A;  4O74 A;  5I29 A;  2RNW A;  3O34 A;  5A82 A;  5I86 A;  4TT2 A;  4BW4 A;  4O7C A;  5LVQ A;  5I1Q A;  4LYS A;  4XYA A;  5CUE A;  4QSX A;  4FLP A;  5IGM A;  5HEM A;  4HBW A;  4YAX A;  2GRC A;  4NQM A;  5D26 A;  4YY4 A;  5AD2 A;  5H1T A;  2RO1 A;  4E96 A;  4CL9 A;  5HEN A;  4OUF A;  5E74 A;  3QZT A;  5F63 A;  5CFW A;  3U5L A;  5FG6 A;  5A81 A;  4MR3 A;  5LKZ A;  3JVM A;  5FH7 A;  4YYH A;  5D3P A;  4PY6 A;  3MQM A;  4UIY A;  5EWW A;  5KTU A;  2N9G A;  5ENI A;  5CUG A;  5EPR A;  4Z1S A;  5DY7 A;  5HRX A;  5LJ0 A;  5F36 A;  2WP1 A;  4A9K A;  5D3L A;  3P1D A;  2DWW A;  4O7B A;  5H85 A;  3P1E A;  4A9J A;  3LQI A;  4PS5 A;  2OSS A;  4NR4 A;  4YYN A;  4CFK A;  4LYI A;  4J0R A;  5A5N A;  4QB3 A;  5CQ7 A;  5E7D A;  2YEL A;  4ALH A;  5DFC A;  4QEU A;  4TQN A;  5EQ1 A;  5FDZ A;  2DVR A;  2YQD A;  4TU4 A;  2MJV B;  5FB1 A;  3JVJ A;  4TTE A;  2OO1 A;  5DW1 A;  5FE2 A;  5F2P A;  5EM3 A;  1ZS5 A;  2DVS A;  4NXJ A;  4TT4 A;  4TS8 A;  5I7X A;  5AMF A;  4BW2 A;  5ENB A;  2L84 A;  5JWM A;  4MR5 A;  5FE4 A;  5LJ1 A;  5D3T A;  5I89 A;  5FFW A;  2YEM A;  5D25 A;  4UIZ A;  5CGP A;  5IGN A;  5CY9 A;  4HXR A;  4Q0N A;  5G4R A;  3P5O A;  2H60 A;  4KCX A;  4IOR A;  4QZS A;  5E9L A;  4YK0 A;  4IR6 A;  4PKL A;  5A85 A;  4DON A;  3UVX A;  5H1V A;  5C7N A;  4HXK A;  4UYD A;  5E0R A;  4Y03 A;  5HQ7 A;  4XUB A;  5EWH A;  4NQN A;  5HFR A;  4N3W A;  4LYW A;  3UV2 A;  3SVG A;  4XY8 A;  3RCW A;  2R0V A;  4N4I A;  5FE1 A;  4LRG A;  5HQ5 A;  5I7Y A;  2F6J A;  5EWD A;  5EPS A;  5KHM A;  4MEN A;  5ENG A;  4QSP A;  5DLX A;  1WUG A;  2G4A A;  1E6I A;  5C8G A;  5FFY A;  4J3I A;  3SVH A;  4NR9 A;  5FE6 A;  5ACY A;  5FE0 A;  4A9H A;  5CQ3 A;  5ETD A;  5E73 A;  4HBY A;  4OGI A;  4QST A;  4QC1 A;  3U5J A;  3HME A;  4UYG A;  4CUS A;  4YBS A;  4MEQ A;  4IR5 A;  4QEV A;  4J1P A;  5I40 A;  3S92 A;  4A9I A;  3TLP A;  5FE3 A;  5E3D A;  5L97 A;  5KU3 A;  4Z93 A;  5HRW A;  5LUU A;  5KO4 A;  5EA1 A;  4HXS A;  5G4S A;  4O77 A;  5KTX A;  5L98 A;  4YAB A;  4YYM A;  4WIV A;  4NUC A;  4PCI A;  5CUD A;  5CPE A;  4O7E A;  2I8N A;  4TZ8 A;  4YBT A;  5CP5 A;  4HXP A;  5DX4 A;  2F6N A;  2RNY A;  5D0C A;  4Z1Q A;  5ENE A;  5C4Q A;  5EI4 A;  4LZR A;  4QYD A;  4O7F A;  4UYE A;  5DKD A;  2DVQ A;  5D3N A;  2KTB B;  2L85 A;  4IOO A;  5FG4 A;  3IU6 A;  4X2I A;  5FFV A;  4OGJ A;  2R0Y A;  2RI7 A;  4NRC A;  5F5Z A;  5EIS A;  5C87 A;  4YYJ A;  5JI8 A;  5F1L A;  5DYC A;  4A9N A;  2E7O A;  5ENC A;  5E9I A;  2WP2 A;  4MR4 A;  4Q0O A;  5DBM A;  4YY6 A;  5CS8 A;  5E9K A;  4YAD A;  1JSP B;  3O35 A;  3I3J A;  2L5E A;  2DVV A;  5TB6 A;  3O36 A;  4PCE A;  3Q2E A;  5EGU A;  5LKX A;  5CUC A;  4UIU A;  5CUB A;  4Z6H A;  4C66 A;  5LKT A;  3U5N A;  4YYG A;  4CUQ A;  3U5K A;  4IOQ A;  5AD3 A;  5ENF A;  5CUA A;  5E9Y A;  4CFL A;  2YYN A;  5EU1 A;  3P1C A;  5EP7 A;  4QR3 A;  4NR7 A;  5FG5 A;  4QSU A;  5J0D A;  5HM0 A;  5DW2 A;  4PTB A;  4ZQL A;  5F60 A;  4LDF A;  4QSR A;  4UYF B;  5DYA A;  3MB4 A;  3U5O A;  5FE8 A;  3JVK A;  5DLZ A;  3IU5 A;  4TYL A;  4QYL A;  4KV1 A;  4O75 A;  4CUR A;  2R0S A;  3LQJ A;  5C85 A;  2NXB A;  5EV9 A;  4GPJ A;  5ETB A;  5HLS A;  3JVL A;  5FH6 A;  5D3S A;  2R10 A;  5I80 A;  4A9F A;  5CQ8 A;  5DFD A;  3DWY A;  5L8T A;  5DKH A;  3MUL A;  4YYI A;  4QSV A;  5A5S A;  4WHU A;  4BJX A;  5II2 A;  4NR8 A;  3GG3 A;  4IR3 A;  4ALG A;  2I7K A;  4HXN A;  3U5P A;  4UIT A;  4QNS A;  2RFJ A;  5II1 A;  5DKC A;  4QSW A;  3Q2F A;  5FE9 A;  4NR6 A;  5ENH A;  3HMH A;  5D3R A;  4O76 A;  5C89 A;  4MEP A;  3QZV A;  3LXJ A;  2E7N A;  4HXL A;  4C67 A;  5EVA A;  5D3J A;  5DYU A;  3QZS A;  5A5Q A;  2D82 A;  5H1U A;  5HRV A;  5FE7 A;  5F62 A;  4N4G A;  4YAT A;  4LC2 A;  4YYD A;  4TZ2 A;  3S91 A;  2OUO A;  5CRZ A;  5CQ4 A;  5FB0 A;  4UYH A;  5CU8 A;  5BT3 A;  5A5R A;  4O78 A;  4A9L A;  3ZYU A;  4NUE A;  5A5P A;  4NYV A;  1N72 A;  5LJ2 A;  5KTW A;  2YEK A;  2E3K A;  4YC9 A;  3MXF A;  5FE5 A;  4KV4 A;  5IID A;  5LKU A;  4N4H A;  4A9E A;  5HJC A;  4NYX A;  5EWV A;  4NUD A;  4CUU A;  4WHW A;  5D7X A;  5IGK A;  3P1F A;  4UIX A;  5TCM A;  3LJW A;  4QSS A;  4XUA A;  1WUM A;  4UIV A;  3UVD A;  5IGL A;  2YW5 A;  2DAT A;  5FBX A;  2YDW A;  4AKN A;  2D9E A;  4YH3 A;  5I88 A;  5FH8 A;  1EQF A;  4HXM A;  5HEL A;  4O7A A;  3UV4 A;  4YYK A;  5HCL A;  4CUT A;  4NRA A;  5K29 A;  5CRM A;  5E9M A;  4TT6 A;  1JM4 B;  3DAI A;  4F3I A;  5LVR A;  4MEO A;  4A9M A;  5F61 A;  3MUK A;  5A5O A;  1F68 A;  5CQT A;  4A9O A;  3O33 A;  4O70 A;  4UYF A;  4LZS A;  4ZW1 A;  3FKM X;  3G0J A;  3UVW A;  3U5M A;  4YBM A;  5EK9 A;  5L99 A;  2LSP B;  5HFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...