5J0DA

Crystal structure of the bromodomain of human crebbp in complex with a benzoxazepine compound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CREB-binding protein
publication title Development of Selective CBP/P300 Benzoxazepine Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 117
sequence length 117
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5j0dA00
5HRWA 4N4FA 4IR3A 4O7AA 4YABA 5D26A 2E7OA 4LZSA 5HFRA 5DKCA 4A9MA 5CQ7A 4IR5A 5H85A 5E73A 4UYGA 5ETDA 5IGKA 5BT3A 5HM0A 4XUBA 5HRVA 4BW4A 3UV4A 4IR4A 5FE3A 5E3DA 4TS8A 3U5LA 5IGMA 3Q2EA 5CUEA 4NYXA 5E9VA 5FDZA 3UVYA 1F68A 5F25A 5EP7A 4KV4A 3G0JA 4YATA 4CUSA 5EM3A 3Q2FA 3G0LA 5CS8A 5E7DA 3UVDA 4YAXA 5HRXA 4N4HA 4A9LA 5ENEA 5EISA 3P5OA 4CUPA 3HMHA 4HXLA 4O71A 5EA1A 4NUCA 4QSRA 4OGJA 3HMEA 5HCLA 4PCIA 2DATA 5C8GA 5DLXA 4DONA 5C89A 5COIA 4QR3A 4F3IA 5C7NA 1JSPB 2NXBA 4YK0A 5A7CA 5I83A 3UV2A 1WUGA 4A9IA 5LKTA 3U5NA 5E3GA 5A5SA 3O37A 4WHUA 4A9KA 4NUDA 3DAIA 5I88A 4N3WA 5JI8A 5LKZA 3I3JA 3LXJA 2OSSA 4KV1A 4CL9A 3JVKA 3P1DA 4HBYA 4UIWA 4A9JA 5CUAA 5FE4A 4YYGA 4MR6A 5C85A 5IG6A 4TT6A 5ETBA 5HFQA 2RS9B 5FG5A 4YYMA 4TT2A 5A81A 5FH6A 2I8NA 5CQ6A 4QSVA 5FE2A 3IU6A 2R0VA 2I7KA 5L96A 4ZQLA 1X0JA 4UIVA 5KTUA 5KU3A 2H60A 5D3LA 4ZC9A 3AQAA 4YH3A 4IORA 3LJWA 1WUMA 4OGIA 4QZSA 4GPJA 2F6JA 2L84A 4YYDA 5KHMA 2YDWA 4YYKA 2F6NA 2KTBB 4HXSA 4PY6A 4QSSA 5EICA 5D24A 2YW5A 4QEWA 5FE9A 4WIVA 5KTWA 4NRAA 5CQ3A 2G4AA 4HXKA 4BW2A 5DY7A 3MQMA 5CUCA 4X2IA 5E9IA 2R10A 4XY8A 5EK9A 2L85A 4QR5A 5A83A 5FFWA 4CFLA 3SVHA 5C4QA 5LUUA 5L97A 4UYEA 5FE8A 5EVAA 4YYIA 4PCEA 5HQ6A 4LYWA 4XYAA 3O34A 5LJ1A 4OUFA 5C87A 2DVSA 5F61A 2DWWA 4LDFA 3U5MA 3D7CA 4MR4A 3MULA 2OO1A 5D3NA 5E0RA 3NXBA 5D25A 2L5EA 5ACYA 5I1QA 5EI4A 2RFJA 5FE7A 5KTXA 2YYNA 4O74A 4MEPA 4ALGA 4CUQA 4HXRA 4Z1QA 5CQ5A 5FG6A 5LJ0A 5CQ8A 4YBMA 2R0YA 3S91A 5A5OA 3U5PA 2R0SA 5BT4A 3LQHA 4MR3A 5FB0A 5D3HA 2DVVA 5L98A 3ONIA 2DKWA 5F1HA 4BJXA 4MEQA 5F63A 5FH7A 2RI7A 4BW3A 5FBXA 4UYHA 4QC3A 4NRBA 4J0SA 4UIZA 5F1LA 3JVJA 5I80A 4UIXA 5CFWA 5ENJA 5I86A 5HELA 4O72A 3U5OA 4Z93A 4UYDA 5EWHA 5E9LA 5D0CA 5IIDA 2OUOA 5A5PA 5FE1A 4ZW1A 5F5ZA 4PS5A 5D3SA 1N72A 4HXMA 1JM4B 5AD3A 4Q0OA 5A5NA 5EWVA 5HLSA 4UYFB 4O75A 3UVXA 4UYFA 5A82A 4YY4A 5CQTA 4UIYA 5L99A 2YQDA 4LZ2A 4O78A 5G4SA 4NQMA 5DW2A 4TZ2A 4QYDA 4MENA 5ENCA 4BHWA 4QEUA 5IGLA 5CP5A 5FB1A 3U5JA 4QR4A 4YH4A 4QB3A 4CFKA 4N4GA 4O7FA 4J0RA 5CU8A 5D3PA 5ENGA 4QUTA 2LSPB 5FG4A 5FFYA 3ZYUA 4A9HA 4TT4A 4NR7A 3UVWA 3U5KA 4LR6A 5AMFA 5ENIA 4MR5A 3TLPA 2DVQA 4XUAA 3LQJA 3HMFA 3IU5A 5CTLA 5AD2A 3UV5A 3QZVA 5EWCA 4TTEA 5I7YA 5II1A 5TCMA 3P1EA 5JWMA 5I7XA 5CQAA 3GG3A 4QY4A 4AKNA 5DKDA 5EPSA 2YEMA 5H1VA 4TU4A 4QSTA 5EWDA 5D7XA 5L8UA 5CRMA 2YEKA 2RO1A 2RNXA 5CGPA 5EQ1A 4NR6A 4NUEA 4QEVA 4YBTA 4QUUA 4CURA 5DKHA 4Z6HA 5DYUA 4Y03A 3K2JA 4LYIA 4NS5A 3P1CA 5CY9A 3JVLA 4N4IA 4QSUA 5A5RA 4KCXA 4RVRA 5DW1A 3MB4A 3UW9A 4LZRA 5KO4A 3MB3A 4A9NA 5J0DA 4NYWA 4HXNA 5K29A 1E6IA 5EV9A 4NXJA 4O7BA 5G4RA 3O35A 4QSWA 5II2A 3SVFA 4CLBA 3RCWA 4O77A 5CZGA 4Z1SA 4LYSA 4QNSA 5BT5A 4NR9A 4J1PA 4HBXA 4PKLA 5I40A 4PTBA 5IBNA 5I29A 5DBMA 5D3JA 5EPRA 4A9EA 5CUGA 3O36A 4LRGA 5DYCA 5D3TA 4UIUA 5DX4A 4O70A 5HENA 4HBVA 4HXOA 5F62A 5E74A 5A5QA 5D3RA 4TQNA 3JVMA 5A85A 4C66A 4YYHA 5FFVA 3O33A 5F60A 5DLZA 4TYLA 4CUUA 4O7CA 4YY6A 3DWYA 4E96A 2WP2A 4IOQA 3MUKA 5DFDA 1ZS5A 3FKMX 5AMEA 5E9YA 4Z6IA 3QZTA 2YELA 4IR6A 4MEOA 2MJVB 2D9EA 2N9GA 5HJCA 4A9OA 5HQ5A 5F36A 5EGUA 2WP1A 4QSQA 5LKUA 5L8TA 4NYVA 5ENFA 4QSPA 5DYAA 4WHWA 3S92A 5CRZA 4QYLA 4YADA 4J3IA 5EU1A 4QC1A 4IOOA 5EWWA 2GRCA 5IGNA 5DFBA 5CUBA 4LC2A 4HBWA 4HXPA 4UITA 3LQIA 2RNWA 5LVQA 2FSAA 5ENHA 5CPEA 4O76A 5FE6A 4QSXA 3SVGA 2D82A 5CUDA 2DVRA 5E9MA 4O7EA 5FE5A 5DFCA 3AADA 5E9KA 2RNYA 3MXFA 5FH8A 4YBSA 5LJ2A 4C67A 3QZSA 5TB6A 5H1TA 5LVRA 4NQNA 4TU6A 5H1UA 4ALHA 4BW1A 4Q0NA 4FLPA 5CQ4A 4TZ8A 4XY9A 4YC9A 3P1FA 4CUTA 5I89A 4NR4A 4A9FA 5HEMA 4YYNA 4QBMA 5EPBA 4YYJA 5F3AA 5ENBA 5FE0A 2E3KA 5LKXA 5F2PA 1EQFA 5DYXA 4NR5A 2E7NA 4NRCA 5HQ7A 4NR8A
chains in the Genus database with same CATH superfamily
5HRWA 4N4FA 4IR3A 4O7AA 4YABA 5D26A 2E7OA 4LZSA 5HFRA 5DKCA 4A9MA 5CQ7A 4IR5A 5H85A 5E73A 4UYGA 5ETDA 5IGKA 5BT3A 5HM0A 4XUBA 5HRVA 4BW4A 3UV4A 4IR4A 5FE3A 5E3DA 4TS8A 3U5LA 5IGMA 3Q2EA 5CUEA 4NYXA 5E9VA 5FDZA 3UVYA 1F68A 5F25A 5EP7A 4KV4A 3G0JA 4YATA 4CUSA 3ERRA 5EM3A 3Q2FA 3G0LA 5CS8A 5E7DA 3UVDA 4YAXA 5HRXA 4N4HA 4A9LA 5ENEA 5EISA 3P5OA 4CUPA 3HMHA 4HXLA 4O71A 5EA1A 4NUCA 4QSRA 4OGJA 3HMEA 5HCLA 4PCIA 2DATA 5C8GA 5DLXA 4DONA 5C89A 5COIA 4QR3A 4F3IA 5C7NA 1JSPB 2NXBA 1ZKRA 4YK0A 5A7CA 5I83A 3UV2A 1WUGA 4A9IA 5LKTA 2EJNA 3U5NA 5E3GA 5A5SA 3VKGA 3O37A 4WHUA 4A9KA 4NUDA 3DAIA 5I88A 4N3WA 5JI8A 5LKZA 3I3JA 3LXJA 2OSSA 4KV1A 4CL9A 3JVKA 3P1DA 4HBYA 4UIWA 4A9JA 5CUAA 5FE4A 4YYGA 4MR6A 5C85A 3D1BA 5IG6A 4TT6A 5ETBA 5HFQA 2RS9B 5FG5A 4YYMA 4TT2A 5A81A 5FH6A 2I8NA 5CQ6A 4QSVA 5FE2A 3IU6A 2R0VA 2I7KA 5L96A 4ZQLA 1X0JA 4UIVA 5KTUA 5KU3A 4AKIA 2H60A 4AKGA 5D3LA 4ZC9A 3AQAA 4YH3A 4IORA 3LJWA 1WUMA 4OGIA 4QZSA 4GPJA 2F6JA 2L84A 4YYDA 5KHMA 2YDWA 4YYKA 2F6NA 2KTBB 4HXSA 4PY6A 4QSSA 5EICA 5D24A 2YW5A 4QEWA 5FE9A 4WIVA 5KTWA 4NRAA 5CQ3A 2G4AA 4HXKA 4BW2A 5DY7A 3MQMA 5CUCA 4X2IA 5E9IA 2R10A 4XY8A 5EK9A 2L85A 4QR5A 5A83A 5FFWA 4CFLA 3SVHA 5C4QA 5LUUA 5L97A 4UYEA 5FE8A 5EVAA 4YYIA 4PCEA 5HQ6A 4LYWA 4XYAA 3O34A 5LJ1A 4OUFA 5C87A 2DVSA 5F61A 2DWWA 4LDFA 3U5MA 3D7CA 4MR4A 3MULA 2OO1A 5D3NA 5E0RA 3NXBA 5D25A 2L5EA 5ACYA 5I1QA 5EI4A 2RFJA 5FE7A 5KTXA 2YYNA 4O74A 4MEPA 4ALGA 4CUQA 4HXRA 4Z1QA 5CQ5A 5FG6A 5LJ0A 5CQ8A 4YBMA 2R0YA 3S91A 5A5OA 3U5PA 2R0SA 5BT4A 3LQHA 4MR3A 5FB0A 5D3HA 2DVVA 5L98A 3ONIA 2DKWA 5F1HA 4BJXA 4MEQA 5F63A 5FH7A 2RI7A 4BW3A 5FBXA 4UYHA 4QC3A 4NRBA 4J0SA 4UIZA 5F1LA 3JVJA 5I80A 4UIXA 5CFWA 5ENJA 5I86A 5HELA 4O72A 3U5OA 4Z93A 4UYDA 5EWHA 5E9LA 5D0CA 5IIDA 2OUOA 5A5PA 5FE1A 4ZW1A 5F5ZA 4PS5A 5D3SA 1N72A 4HXMA 1JM4B 5AD3A 4Q0OA 5A5NA 5EWVA 4AKHA 5HLSA 4UYFB 4O75A 3UVXA 4UYFA 5A82A 4YY4A 5CQTA 4UIYA 5L99A 2YQDA 4LZ2A 4O78A 5G4SA 4NQMA 5DW2A 4TZ2A 4QYDA 4MENA 5ENCA 4BHWA 4QEUA 5IGLA 5CP5A 5FB1A 3U5JA 4QR4A 4YH4A 4QB3A 4CFKA 4N4GA 4O7FA 4J0RA 5CU8A 5D3PA 5ENGA 3D1DA 4QUTA 2LSPB 5FG4A 5FFYA 3ZYUA 4A9HA 4TT4A 4NR7A 3UVWA 3U5KA 4LR6A 5AMFA 5ENIA 4MR5A 3TLPA 2DVQA 4XUAA 3LQJA 3HMFA 3IU5A 4AI6A 5CTLA 5AD2A 3UV5A 3QZVA 5EWCA 4TTEA 5I7YA 5II1A 5TCMA 3P1EA 5JWMA 5I7XA 5CQAA 3GG3A 4QY4A 4AKNA 5DKDA 5EPSA 2YEMA 5H1VA 4TU4A 4QSTA 5EWDA 5D7XA 5L8UA 5CRMA 2YEKA 2RO1A 2RNXA 5CGPA 5EQ1A 4NR6A 4NUEA 4QEVA 4YBTA 4QUUA 4CURA 5DKHA 4Z6HA 5DYUA 4Y03A 3K2JA 4LYIA 4NS5A 3P1CA 5CY9A 3JVLA 4N4IA 4QSUA 5A5RA 4KCXA 4RVRA 5DW1A 3MB4A 3UW9A 4LZRA 5KO4A 3MB3A 4A9NA 5J0DA 4NYWA 4HXNA 5K29A 1E6IA 5EV9A 4NXJA 4O7BA 5G4RA 3O35A 4QSWA 5II2A 3SVFA 4CLBA 3RCWA 4O77A 5CZGA 4Z1SA 4LYSA 4QNSA 5BT5A 4NR9A 4J1PA 4HBXA 4PKLA 5I40A 4PTBA 5IBNA 5I29A 5DBMA 5D3JA 5EPRA 4A9EA 5CUGA 3O36A 4LRGA 5DYCA 5D3TA 4UIUA 5DX4A 4O70A 5HENA 4HBVA 4HXOA 5F62A 5E74A 5A5QA 5D3RA 4TQNA 3JVMA 5A85A 4C66A 4YYHA 5FFVA 3O33A 5F60A 5DLZA 4TYLA 4CUUA 4O7CA 4YY6A 3DWYA 4E96A 2WP2A 4IOQA 3MUKA 5DFDA 1ZS5A 3FKMX 5AMEA 5E9YA 4Z6IA 3QZTA 2YELA 4IR6A 4MEOA 2MJVB 2D9EA 2N9GA 5HJCA 4A9OA 5HQ5A 5F36A 5EGUA 2WP1A 4QSQA 5LKUA 5L8TA 4NYVA 5ENFA 4QSPA 5DYAA 4WHWA 3S92A 5CRZA 4QYLA 4YADA 4J3IA 5EU1A 4QC1A 3VKHA 4IOOA 5EWWA 2GRCA 5IGNA 5DFBA 5CUBA 4LC2A 1PUOA 4HBWA 4HXPA 4UITA 3LQIA 2RNWA 5LVQA 2FSAA 5ENHA 5CPEA 4O76A 5FE6A 4QSXA 3SVGA 2D82A 5CUDA 2DVRA 5E9MA 4O7EA 5FE5A 5DFCA 3AADA 5E9KA 2RNYA 3MXFA 5FH8A 4YBSA 5LJ2A 4C67A 3QZSA 5TB6A 5H1TA 5LVRA 4NQNA 4TU6A 5H1UA 4ALHA 4BW1A 4Q0NA 4FLPA 5CQ4A 4TZ8A 4XY9A 4YC9A 3P1FA 4CUTA 5I89A 4NR4A 4A9FA 5HEMA 4YYNA 4QBMA 5EPBA 4YYJA 5F3AA 5ENBA 5FE0A 2E3KA 5LKXA 5F2PA 1EQFA 5DYXA 4NR5A 2E7NA 4NRCA 5HQ7A 4NR8A
chains in the Genus database with same CATH topology
5HRWA 4N4FA 4IR3A 4O7AA 4YABA 5D26A 2E7OA 4LZSA 5HFRA 5DKCA 4A9MA 5CQ7A 4IR5A 5H85A 5E73A 4UYGA 5ETDA 5IGKA 5BT3A 5HM0A 4XUBA 5HRVA 4BW4A 3UV4A 4IR4A 5FE3A 5E3DA 4TS8A 3U5LA 5IGMA 3Q2EA 5CUEA 4NYXA 5E9VA 5FDZA 3UVYA 1F68A 5F25A 5EP7A 4KV4A 3G0JA 4YATA 4CUSA 5EM3A 3Q2FA 3G0LA 5CS8A 5E7DA 3UVDA 4YAXA 5HRXA 4N4HA 4A9LA 5ENEA 5EISA 3P5OA 4CUPA 3HMHA 4HXLA 4O71A 5EA1A 4NUCA 4QSRA 4OGJA 3HMEA 5HCLA 4PCIA 2DATA 5C8GA 5DLXA 4DONA 5C89A 5COIA 4QR3A 4F3IA 5C7NA 1JSPB 2NXBA 4YK0A 5A7CA 5I83A 3UV2A 1WUGA 4A9IA 5LKTA 3U5NA 5E3GA 5A5SA 3O37A 4WHUA 4A9KA 4NUDA 3DAIA 5I88A 4N3WA 5JI8A 5LKZA 3I3JA 3LXJA 2OSSA 4KV1A 4CL9A 3JVKA 3P1DA 4HBYA 4UIWA 4A9JA 5CUAA 5FE4A 4YYGA 4MR6A 5C85A 5IG6A 4TT6A 5ETBA 5HFQA 2RS9B 5FG5A 4YYMA 4TT2A 5A81A 5FH6A 2I8NA 5CQ6A 4QSVA 5FE2A 3IU6A 2R0VA 2I7KA 5L96A 4ZQLA 1X0JA 4UIVA 5KTUA 5KU3A 2H60A 5D3LA 4ZC9A 3AQAA 4YH3A 4IORA 3LJWA 1WUMA 4OGIA 4QZSA 4GPJA 2F6JA 2L84A 4YYDA 5KHMA 2YDWA 4YYKA 2F6NA 2KTBB 4HXSA 4PY6A 4QSSA 5EICA 5D24A 2YW5A 4QEWA 5FE9A 4WIVA 5KTWA 4NRAA 5CQ3A 2G4AA 4HXKA 4BW2A 5DY7A 3MQMA 5CUCA 4X2IA 5E9IA 2R10A 4XY8A 5EK9A 2L85A 4QR5A 5A83A 5FFWA 4CFLA 3SVHA 5C4QA 5LUUA 5L97A 4UYEA 5FE8A 5EVAA 4YYIA 4PCEA 5HQ6A 4LYWA 4XYAA 3O34A 5LJ1A 4OUFA 5C87A 2DVSA 5F61A 2DWWA 4LDFA 3U5MA 3D7CA 4MR4A 3MULA 2OO1A 5D3NA 5E0RA 3NXBA 5D25A 2L5EA 5ACYA 5I1QA 5EI4A 2RFJA 5FE7A 5KTXA 2YYNA 4O74A 4MEPA 4ALGA 4CUQA 4HXRA 4Z1QA 5CQ5A 5FG6A 5LJ0A 5CQ8A 4YBMA 2R0YA 3S91A 5A5OA 3U5PA 2R0SA 5BT4A 3LQHA 4MR3A 5FB0A 5D3HA 2DVVA 5L98A 3ONIA 2DKWA 5F1HA 4BJXA 4MEQA 5F63A 5FH7A 2RI7A 4BW3A 5FBXA 4UYHA 4QC3A 4NRBA 4J0SA 4UIZA 5F1LA 3JVJA 5I80A 4UIXA 5CFWA 5ENJA 5I86A 5HELA 4O72A 3U5OA 4Z93A 4UYDA 5EWHA 5E9LA 5D0CA 5IIDA 2OUOA 5A5PA 5FE1A 4ZW1A 5F5ZA 4PS5A 5D3SA 1N72A 4HXMA 1JM4B 5AD3A 4Q0OA 5A5NA 5EWVA 5HLSA 4UYFB 4O75A 3UVXA 4UYFA 5A82A 4YY4A 5CQTA 4UIYA 5L99A 2YQDA 4LZ2A 4O78A 5G4SA 4NQMA 5DW2A 4TZ2A 4QYDA 4MENA 5ENCA 4BHWA 4QEUA 5IGLA 5CP5A 5FB1A 3U5JA 4QR4A 4YH4A 4QB3A 4CFKA 4N4GA 4O7FA 4J0RA 5CU8A 5D3PA 5ENGA 4QUTA 2LSPB 5FG4A 5FFYA 3ZYUA 4A9HA 4TT4A 4NR7A 3UVWA 3U5KA 4LR6A 5AMFA 5ENIA 4MR5A 3TLPA 2DVQA 4XUAA 3LQJA 3HMFA 3IU5A 5CTLA 5AD2A 3UV5A 3QZVA 5EWCA 4TTEA 5I7YA 5II1A 5TCMA 3P1EA 5JWMA 5I7XA 5CQAA 3GG3A 4QY4A 4AKNA 5DKDA 5EPSA 2YEMA 5H1VA 4TU4A 4QSTA 5EWDA 5D7XA 5L8UA 5CRMA 2YEKA 2RO1A 2RNXA 5CGPA 5EQ1A 4NR6A 4NUEA 4QEVA 4YBTA 4QUUA 4CURA 5DKHA 4Z6HA 5DYUA 4Y03A 3K2JA 4LYIA 4NS5A 3P1CA 5CY9A 3JVLA 4N4IA 4QSUA 5A5RA 4KCXA 4RVRA 5DW1A 3MB4A 3UW9A 4LZRA 5KO4A 3MB3A 4A9NA 5J0DA 4NYWA 4HXNA 5K29A 1E6IA 5EV9A 4NXJA 4O7BA 5G4RA 3O35A 4QSWA 5II2A 3SVFA 4CLBA 3RCWA 4O77A 5CZGA 4Z1SA 4LYSA 4QNSA 5BT5A 4NR9A 4J1PA 4HBXA 4PKLA 5I40A 4PTBA 5IBNA 5I29A 5DBMA 5D3JA 5EPRA 4A9EA 5CUGA 3O36A 4LRGA 5DYCA 5D3TA 4UIUA 5DX4A 4O70A 5HENA 4HBVA 4HXOA 5F62A 5E74A 5A5QA 5D3RA 4TQNA 3JVMA 5A85A 4C66A 4YYHA 5FFVA 3O33A 5F60A 5DLZA 4TYLA 4CUUA 4O7CA 4YY6A 3DWYA 4E96A 2WP2A 4IOQA 3MUKA 5DFDA 1ZS5A 3FKMX 5AMEA 5E9YA 4Z6IA 3QZTA 2YELA 4IR6A 4MEOA 2MJVB 2D9EA 2N9GA 5HJCA 4A9OA 5HQ5A 5F36A 5EGUA 2WP1A 4QSQA 5LKUA 5L8TA 4NYVA 5ENFA 4QSPA 5DYAA 4WHWA 3S92A 5CRZA 4QYLA 4YADA 4J3IA 5EU1A 4QC1A 4IOOA 5EWWA 2GRCA 5IGNA 5DFBA 5CUBA 4LC2A 4HBWA 4HXPA 4UITA 3LQIA 2RNWA 5LVQA 2FSAA 5ENHA 5CPEA 4O76A 5FE6A 4QSXA 3SVGA 2D82A 5CUDA 2DVRA 5E9MA 4O7EA 5FE5A 5DFCA 3AADA 5E9KA 2RNYA 3MXFA 5FH8A 4YBSA 5LJ2A 4C67A 3QZSA 5TB6A 5H1TA 5LVRA 4NQNA 4TU6A 5H1UA 4ALHA 4BW1A 4Q0NA 4FLPA 5CQ4A 4TZ8A 4XY9A 4YC9A 3P1FA 4CUTA 5I89A 4NR4A 4A9FA 5HEMA 4YYNA 4QBMA 5EPBA 4YYJA 5F3AA 5ENBA 5FE0A 2E3KA 5LKXA 5F2PA 1EQFA 5DYXA 4NR5A 2E7NA 4NRCA 5HQ7A 4NR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRW A;  4N4F A;  4IR3 A;  4O7A A;  4YAB A;  5D26 A;  2E7O A;  4LZS A;  5HFR A;  5DKC A;  4A9M A;  5CQ7 A;  4IR5 A;  5H85 A;  5E73 A;  4UYG A;  5ETD A;  5IGK A;  5BT3 A;  5HM0 A;  4XUB A;  5HRV A;  4BW4 A;  3UV4 A;  4IR4 A;  5FE3 A;  5E3D A;  4TS8 A;  3U5L A;  5IGM A;  3Q2E A;  5CUE A;  4NYX A;  5E9V A;  5FDZ A;  3UVY A;  1F68 A;  5F25 A;  5EP7 A;  4KV4 A;  3G0J A;  4YAT A;  4CUS A;  5EM3 A;  3Q2F A;  3G0L A;  5CS8 A;  5E7D A;  3UVD A;  4YAX A;  5HRX A;  4N4H A;  4A9L A;  5ENE A;  5EIS A;  3P5O A;  4CUP A;  3HMH A;  4HXL A;  4O71 A;  5EA1 A;  4NUC A;  4QSR A;  4OGJ A;  3HME A;  5HCL A;  4PCI A;  2DAT A;  5C8G A;  5DLX A;  4DON A;  5C89 A;  5COI A;  4QR3 A;  4F3I A;  5C7N A;  1JSP B;  2NXB A;  4YK0 A;  5A7C A;  5I83 A;  3UV2 A;  1WUG A;  4A9I A;  5LKT A;  3U5N A;  5E3G A;  5A5S A;  3O37 A;  4WHU A;  4A9K A;  4NUD A;  3DAI A;  5I88 A;  4N3W A;  5JI8 A;  5LKZ A;  3I3J A;  3LXJ A;  2OSS A;  4KV1 A;  4CL9 A;  3JVK A;  3P1D A;  4HBY A;  4UIW A;  4A9J A;  5CUA A;  5FE4 A;  4YYG A;  4MR6 A;  5C85 A;  5IG6 A;  4TT6 A;  5ETB A;  5HFQ A;  2RS9 B;  5FG5 A;  4YYM A;  4TT2 A;  5A81 A;  5FH6 A;  2I8N A;  5CQ6 A;  4QSV A;  5FE2 A;  3IU6 A;  2R0V A;  2I7K A;  5L96 A;  4ZQL A;  1X0J A;  4UIV A;  5KTU A;  5KU3 A;  2H60 A;  5D3L A;  4ZC9 A;  3AQA A;  4YH3 A;  4IOR A;  3LJW A;  1WUM A;  4OGI A;  4QZS A;  4GPJ A;  2F6J A;  2L84 A;  4YYD A;  5KHM A;  2YDW A;  4YYK A;  2F6N A;  2KTB B;  4HXS A;  4PY6 A;  4QSS A;  5EIC A;  5D24 A;  2YW5 A;  4QEW A;  5FE9 A;  4WIV A;  5KTW A;  4NRA A;  5CQ3 A;  2G4A A;  4HXK A;  4BW2 A;  5DY7 A;  3MQM A;  5CUC A;  4X2I A;  5E9I A;  2R10 A;  4XY8 A;  5EK9 A;  2L85 A;  4QR5 A;  5A83 A;  5FFW A;  4CFL A;  3SVH A;  5C4Q A;  5LUU A;  5L97 A;  4UYE A;  5FE8 A;  5EVA A;  4YYI A;  4PCE A;  5HQ6 A;  4LYW A;  4XYA A;  3O34 A;  5LJ1 A;  4OUF A;  5C87 A;  2DVS A;  5F61 A;  2DWW A;  4LDF A;  3U5M A;  3D7C A;  4MR4 A;  3MUL A;  2OO1 A;  5D3N A;  5E0R A;  3NXB A;  5D25 A;  2L5E A;  5ACY A;  5I1Q A;  5EI4 A;  2RFJ A;  5FE7 A;  5KTX A;  2YYN A;  4O74 A;  4MEP A;  4ALG A;  4CUQ A;  4HXR A;  4Z1Q A;  5CQ5 A;  5FG6 A;  5LJ0 A;  5CQ8 A;  4YBM A;  2R0Y A;  3S91 A;  5A5O A;  3U5P A;  2R0S A;  5BT4 A;  3LQH A;  4MR3 A;  5FB0 A;  5D3H A;  2DVV A;  5L98 A;  3ONI A;  2DKW A;  5F1H A;  4BJX A;  4MEQ A;  5F63 A;  5FH7 A;  2RI7 A;  4BW3 A;  5FBX A;  4UYH A;  4QC3 A;  4NRB A;  4J0S A;  4UIZ A;  5F1L A;  3JVJ A;  5I80 A;  4UIX A;  5CFW A;  5ENJ A;  5I86 A;  5HEL A;  4O72 A;  3U5O A;  4Z93 A;  4UYD A;  5EWH A;  5E9L A;  5D0C A;  5IID A;  2OUO A;  5A5P A;  5FE1 A;  4ZW1 A;  5F5Z A;  4PS5 A;  5D3S A;  1N72 A;  4HXM A;  1JM4 B;  5AD3 A;  4Q0O A;  5A5N A;  5EWV A;  5HLS A;  4UYF B;  4O75 A;  3UVX A;  4UYF A;  5A82 A;  4YY4 A;  5CQT A;  4UIY A;  5L99 A;  2YQD A;  4LZ2 A;  4O78 A;  5G4S A;  4NQM A;  5DW2 A;  4TZ2 A;  4QYD A;  4MEN A;  5ENC A;  4BHW A;  4QEU A;  5IGL A;  5CP5 A;  5FB1 A;  3U5J A;  4QR4 A;  4YH4 A;  4QB3 A;  4CFK A;  4N4G A;  4O7F A;  4J0R A;  5CU8 A;  5D3P A;  5ENG A;  4QUT A;  2LSP B;  5FG4 A;  5FFY A;  3ZYU A;  4A9H A;  4TT4 A;  4NR7 A;  3UVW A;  3U5K A;  4LR6 A;  5AMF A;  5ENI A;  4MR5 A;  3TLP A;  2DVQ A;  4XUA A;  3LQJ A;  3HMF A;  3IU5 A;  5CTL A;  5AD2 A;  3UV5 A;  3QZV A;  5EWC A;  4TTE A;  5I7Y A;  5II1 A;  5TCM A;  3P1E A;  5JWM A;  5I7X A;  5CQA A;  3GG3 A;  4QY4 A;  4AKN A;  5DKD A;  5EPS A;  2YEM A;  5H1V A;  4TU4 A;  4QST A;  5EWD A;  5D7X A;  5L8U A;  5CRM A;  2YEK A;  2RO1 A;  2RNX A;  5CGP A;  5EQ1 A;  4NR6 A;  4NUE A;  4QEV A;  4YBT A;  4QUU A;  4CUR A;  5DKH A;  4Z6H A;  5DYU A;  4Y03 A;  3K2J A;  4LYI A;  4NS5 A;  3P1C A;  5CY9 A;  3JVL A;  4N4I A;  4QSU A;  5A5R A;  4KCX A;  4RVR A;  5DW1 A;  3MB4 A;  3UW9 A;  4LZR A;  5KO4 A;  3MB3 A;  4A9N A;  5J0D A;  4NYW A;  4HXN A;  5K29 A;  1E6I A;  5EV9 A;  4NXJ A;  4O7B A;  5G4R A;  3O35 A;  4QSW A;  5II2 A;  3SVF A;  4CLB A;  3RCW A;  4O77 A;  5CZG A;  4Z1S A;  4LYS A;  4QNS A;  5BT5 A;  4NR9 A;  4J1P A;  4HBX A;  4PKL A;  5I40 A;  4PTB A;  5IBN A;  5I29 A;  5DBM A;  5D3J A;  5EPR A;  4A9E A;  5CUG A;  3O36 A;  4LRG A;  5DYC A;  5D3T A;  4UIU A;  5DX4 A;  4O70 A;  5HEN A;  4HBV A;  4HXO A;  5F62 A;  5E74 A;  5A5Q A;  5D3R A;  4TQN A;  3JVM A;  5A85 A;  4C66 A;  4YYH A;  5FFV A;  3O33 A;  5F60 A;  5DLZ A;  4TYL A;  4CUU A;  4O7C A;  4YY6 A;  3DWY A;  4E96 A;  2WP2 A;  4IOQ A;  3MUK A;  5DFD A;  1ZS5 A;  3FKM X;  5AME A;  5E9Y A;  4Z6I A;  3QZT A;  2YEL A;  4IR6 A;  4MEO A;  2MJV B;  2D9E A;  2N9G A;  5HJC A;  4A9O A;  5HQ5 A;  5F36 A;  5EGU A;  2WP1 A;  4QSQ A;  5LKU A;  5L8T A;  4NYV A;  5ENF A;  4QSP A;  5DYA A;  4WHW A;  3S92 A;  5CRZ A;  4QYL A;  4YAD A;  4J3I A;  5EU1 A;  4QC1 A;  4IOO A;  5EWW A;  2GRC A;  5IGN A;  5DFB A;  5CUB A;  4LC2 A;  4HBW A;  4HXP A;  4UIT A;  3LQI A;  2RNW A;  5LVQ A;  2FSA A;  5ENH A;  5CPE A;  4O76 A;  5FE6 A;  4QSX A;  3SVG A;  2D82 A;  5CUD A;  2DVR A;  5E9M A;  4O7E A;  5FE5 A;  5DFC A;  3AAD A;  5E9K A;  2RNY A;  3MXF A;  5FH8 A;  4YBS A;  5LJ2 A;  4C67 A;  3QZS A;  5TB6 A;  5H1T A;  5LVR A;  4NQN A;  4TU6 A;  5H1U A;  4ALH A;  4BW1 A;  4Q0N A;  4FLP A;  5CQ4 A;  4TZ8 A;  4XY9 A;  4YC9 A;  3P1F A;  4CUT A;  5I89 A;  4NR4 A;  4A9F A;  5HEM A;  4YYN A;  4QBM A;  5EPB A;  4YYJ A;  5F3A A;  5ENB A;  5FE0 A;  2E3K A;  5LKX A;  5F2P A;  1EQF A;  5DYX A;  4NR5 A;  2E7N A;  4NRC A;  5HQ7 A;  4NR8 A; 
#chains in the Genus database with same CATH topology
 5HRW A;  4N4F A;  4IR3 A;  4O7A A;  4YAB A;  5D26 A;  2E7O A;  4LZS A;  5HFR A;  5DKC A;  4A9M A;  5CQ7 A;  4IR5 A;  5H85 A;  5E73 A;  4UYG A;  5ETD A;  5IGK A;  5BT3 A;  5HM0 A;  4XUB A;  5HRV A;  4BW4 A;  3UV4 A;  4IR4 A;  5FE3 A;  5E3D A;  4TS8 A;  3U5L A;  5IGM A;  3Q2E A;  5CUE A;  4NYX A;  5E9V A;  5FDZ A;  3UVY A;  1F68 A;  5F25 A;  5EP7 A;  4KV4 A;  3G0J A;  4YAT A;  4CUS A;  3ERR A;  5EM3 A;  3Q2F A;  3G0L A;  5CS8 A;  5E7D A;  3UVD A;  4YAX A;  5HRX A;  4N4H A;  4A9L A;  5ENE A;  5EIS A;  3P5O A;  4CUP A;  3HMH A;  4HXL A;  4O71 A;  5EA1 A;  4NUC A;  4QSR A;  4OGJ A;  3HME A;  5HCL A;  4PCI A;  2DAT A;  5C8G A;  5DLX A;  4DON A;  5C89 A;  5COI A;  4QR3 A;  4F3I A;  5C7N A;  1JSP B;  2NXB A;  1ZKR A;  4YK0 A;  5A7C A;  5I83 A;  3UV2 A;  1WUG A;  4A9I A;  5LKT A;  2EJN A;  3U5N A;  5E3G A;  5A5S A;  3VKG A;  3O37 A;  4WHU A;  4A9K A;  4NUD A;  3DAI A;  5I88 A;  4N3W A;  5JI8 A;  5LKZ A;  3I3J A;  3LXJ A;  2OSS A;  4KV1 A;  4CL9 A;  3JVK A;  3P1D A;  4HBY A;  4UIW A;  4A9J A;  5CUA A;  5FE4 A;  4YYG A;  4MR6 A;  5C85 A;  3D1B A;  5IG6 A;  4TT6 A;  5ETB A;  5HFQ A;  2RS9 B;  5FG5 A;  4YYM A;  4TT2 A;  5A81 A;  5FH6 A;  2I8N A;  5CQ6 A;  4QSV A;  5FE2 A;  3IU6 A;  2R0V A;  2I7K A;  5L96 A;  4ZQL A;  1X0J A;  4UIV A;  5KTU A;  5KU3 A;  4AKI A;  2H60 A;  4AKG A;  5D3L A;  4ZC9 A;  3AQA A;  4YH3 A;  4IOR A;  3LJW A;  1WUM A;  4OGI A;  4QZS A;  4GPJ A;  2F6J A;  2L84 A;  4YYD A;  5KHM A;  2YDW A;  4YYK A;  2F6N A;  2KTB B;  4HXS A;  4PY6 A;  4QSS A;  5EIC A;  5D24 A;  2YW5 A;  4QEW A;  5FE9 A;  4WIV A;  5KTW A;  4NRA A;  5CQ3 A;  2G4A A;  4HXK A;  4BW2 A;  5DY7 A;  3MQM A;  5CUC A;  4X2I A;  5E9I A;  2R10 A;  4XY8 A;  5EK9 A;  2L85 A;  4QR5 A;  5A83 A;  5FFW A;  4CFL A;  3SVH A;  5C4Q A;  5LUU A;  5L97 A;  4UYE A;  5FE8 A;  5EVA A;  4YYI A;  4PCE A;  5HQ6 A;  4LYW A;  4XYA A;  3O34 A;  5LJ1 A;  4OUF A;  5C87 A;  2DVS A;  5F61 A;  2DWW A;  4LDF A;  3U5M A;  3D7C A;  4MR4 A;  3MUL A;  2OO1 A;  5D3N A;  5E0R A;  3NXB A;  5D25 A;  2L5E A;  5ACY A;  5I1Q A;  5EI4 A;  2RFJ A;  5FE7 A;  5KTX A;  2YYN A;  4O74 A;  4MEP A;  4ALG A;  4CUQ A;  4HXR A;  4Z1Q A;  5CQ5 A;  5FG6 A;  5LJ0 A;  5CQ8 A;  4YBM A;  2R0Y A;  3S91 A;  5A5O A;  3U5P A;  2R0S A;  5BT4 A;  3LQH A;  4MR3 A;  5FB0 A;  5D3H A;  2DVV A;  5L98 A;  3ONI A;  2DKW A;  5F1H A;  4BJX A;  4MEQ A;  5F63 A;  5FH7 A;  2RI7 A;  4BW3 A;  5FBX A;  4UYH A;  4QC3 A;  4NRB A;  4J0S A;  4UIZ A;  5F1L A;  3JVJ A;  5I80 A;  4UIX A;  5CFW A;  5ENJ A;  5I86 A;  5HEL A;  4O72 A;  3U5O A;  4Z93 A;  4UYD A;  5EWH A;  5E9L A;  5D0C A;  5IID A;  2OUO A;  5A5P A;  5FE1 A;  4ZW1 A;  5F5Z A;  4PS5 A;  5D3S A;  1N72 A;  4HXM A;  1JM4 B;  5AD3 A;  4Q0O A;  5A5N A;  5EWV A;  4AKH A;  5HLS A;  4UYF B;  4O75 A;  3UVX A;  4UYF A;  5A82 A;  4YY4 A;  5CQT A;  4UIY A;  5L99 A;  2YQD A;  4LZ2 A;  4O78 A;  5G4S A;  4NQM A;  5DW2 A;  4TZ2 A;  4QYD A;  4MEN A;  5ENC A;  4BHW A;  4QEU A;  5IGL A;  5CP5 A;  5FB1 A;  3U5J A;  4QR4 A;  4YH4 A;  4QB3 A;  4CFK A;  4N4G A;  4O7F A;  4J0R A;  5CU8 A;  5D3P A;  5ENG A;  3D1D A;  4QUT A;  2LSP B;  5FG4 A;  5FFY A;  3ZYU A;  4A9H A;  4TT4 A;  4NR7 A;  3UVW A;  3U5K A;  4LR6 A;  5AMF A;  5ENI A;  4MR5 A;  3TLP A;  2DVQ A;  4XUA A;  3LQJ A;  3HMF A;  3IU5 A;  4AI6 A;  5CTL A;  5AD2 A;  3UV5 A;  3QZV A;  5EWC A;  4TTE A;  5I7Y A;  5II1 A;  5TCM A;  3P1E A;  5JWM A;  5I7X A;  5CQA A;  3GG3 A;  4QY4 A;  4AKN A;  5DKD A;  5EPS A;  2YEM A;  5H1V A;  4TU4 A;  4QST A;  5EWD A;  5D7X A;  5L8U A;  5CRM A;  2YEK A;  2RO1 A;  2RNX A;  5CGP A;  5EQ1 A;  4NR6 A;  4NUE A;  4QEV A;  4YBT A;  4QUU A;  4CUR A;  5DKH A;  4Z6H A;  5DYU A;  4Y03 A;  3K2J A;  4LYI A;  4NS5 A;  3P1C A;  5CY9 A;  3JVL A;  4N4I A;  4QSU A;  5A5R A;  4KCX A;  4RVR A;  5DW1 A;  3MB4 A;  3UW9 A;  4LZR A;  5KO4 A;  3MB3 A;  4A9N A;  5J0D A;  4NYW A;  4HXN A;  5K29 A;  1E6I A;  5EV9 A;  4NXJ A;  4O7B A;  5G4R A;  3O35 A;  4QSW A;  5II2 A;  3SVF A;  4CLB A;  3RCW A;  4O77 A;  5CZG A;  4Z1S A;  4LYS A;  4QNS A;  5BT5 A;  4NR9 A;  4J1P A;  4HBX A;  4PKL A;  5I40 A;  4PTB A;  5IBN A;  5I29 A;  5DBM A;  5D3J A;  5EPR A;  4A9E A;  5CUG A;  3O36 A;  4LRG A;  5DYC A;  5D3T A;  4UIU A;  5DX4 A;  4O70 A;  5HEN A;  4HBV A;  4HXO A;  5F62 A;  5E74 A;  5A5Q A;  5D3R A;  4TQN A;  3JVM A;  5A85 A;  4C66 A;  4YYH A;  5FFV A;  3O33 A;  5F60 A;  5DLZ A;  4TYL A;  4CUU A;  4O7C A;  4YY6 A;  3DWY A;  4E96 A;  2WP2 A;  4IOQ A;  3MUK A;  5DFD A;  1ZS5 A;  3FKM X;  5AME A;  5E9Y A;  4Z6I A;  3QZT A;  2YEL A;  4IR6 A;  4MEO A;  2MJV B;  2D9E A;  2N9G A;  5HJC A;  4A9O A;  5HQ5 A;  5F36 A;  5EGU A;  2WP1 A;  4QSQ A;  5LKU A;  5L8T A;  4NYV A;  5ENF A;  4QSP A;  5DYA A;  4WHW A;  3S92 A;  5CRZ A;  4QYL A;  4YAD A;  4J3I A;  5EU1 A;  4QC1 A;  3VKH A;  4IOO A;  5EWW A;  2GRC A;  5IGN A;  5DFB A;  5CUB A;  4LC2 A;  1PUO A;  4HBW A;  4HXP A;  4UIT A;  3LQI A;  2RNW A;  5LVQ A;  2FSA A;  5ENH A;  5CPE A;  4O76 A;  5FE6 A;  4QSX A;  3SVG A;  2D82 A;  5CUD A;  2DVR A;  5E9M A;  4O7E A;  5FE5 A;  5DFC A;  3AAD A;  5E9K A;  2RNY A;  3MXF A;  5FH8 A;  4YBS A;  5LJ2 A;  4C67 A;  3QZS A;  5TB6 A;  5H1T A;  5LVR A;  4NQN A;  4TU6 A;  5H1U A;  4ALH A;  4BW1 A;  4Q0N A;  4FLP A;  5CQ4 A;  4TZ8 A;  4XY9 A;  4YC9 A;  3P1F A;  4CUT A;  5I89 A;  4NR4 A;  4A9F A;  5HEM A;  4YYN A;  4QBM A;  5EPB A;  4YYJ A;  5F3A A;  5ENB A;  5FE0 A;  2E3K A;  5LKX A;  5F2P A;  1EQF A;  5DYX A;  4NR5 A;  2E7N A;  4NRC A;  5HQ7 A;  4NR8 A; 
#chains in the Genus database with same CATH homology
 5HRW A;  4N4F A;  4IR3 A;  4O7A A;  4YAB A;  5D26 A;  2E7O A;  4LZS A;  5HFR A;  5DKC A;  4A9M A;  5CQ7 A;  4IR5 A;  5H85 A;  5E73 A;  4UYG A;  5ETD A;  5IGK A;  5BT3 A;  5HM0 A;  4XUB A;  5HRV A;  4BW4 A;  3UV4 A;  4IR4 A;  5FE3 A;  5E3D A;  4TS8 A;  3U5L A;  5IGM A;  3Q2E A;  5CUE A;  4NYX A;  5E9V A;  5FDZ A;  3UVY A;  1F68 A;  5F25 A;  5EP7 A;  4KV4 A;  3G0J A;  4YAT A;  4CUS A;  5EM3 A;  3Q2F A;  3G0L A;  5CS8 A;  5E7D A;  3UVD A;  4YAX A;  5HRX A;  4N4H A;  4A9L A;  5ENE A;  5EIS A;  3P5O A;  4CUP A;  3HMH A;  4HXL A;  4O71 A;  5EA1 A;  4NUC A;  4QSR A;  4OGJ A;  3HME A;  5HCL A;  4PCI A;  2DAT A;  5C8G A;  5DLX A;  4DON A;  5C89 A;  5COI A;  4QR3 A;  4F3I A;  5C7N A;  1JSP B;  2NXB A;  4YK0 A;  5A7C A;  5I83 A;  3UV2 A;  1WUG A;  4A9I A;  5LKT A;  3U5N A;  5E3G A;  5A5S A;  3O37 A;  4WHU A;  4A9K A;  4NUD A;  3DAI A;  5I88 A;  4N3W A;  5JI8 A;  5LKZ A;  3I3J A;  3LXJ A;  2OSS A;  4KV1 A;  4CL9 A;  3JVK A;  3P1D A;  4HBY A;  4UIW A;  4A9J A;  5CUA A;  5FE4 A;  4YYG A;  4MR6 A;  5C85 A;  5IG6 A;  4TT6 A;  5ETB A;  5HFQ A;  2RS9 B;  5FG5 A;  4YYM A;  4TT2 A;  5A81 A;  5FH6 A;  2I8N A;  5CQ6 A;  4QSV A;  5FE2 A;  3IU6 A;  2R0V A;  2I7K A;  5L96 A;  4ZQL A;  1X0J A;  4UIV A;  5KTU A;  5KU3 A;  2H60 A;  5D3L A;  4ZC9 A;  3AQA A;  4YH3 A;  4IOR A;  3LJW A;  1WUM A;  4OGI A;  4QZS A;  4GPJ A;  2F6J A;  2L84 A;  4YYD A;  5KHM A;  2YDW A;  4YYK A;  2F6N A;  2KTB B;  4HXS A;  4PY6 A;  4QSS A;  5EIC A;  5D24 A;  2YW5 A;  4QEW A;  5FE9 A;  4WIV A;  5KTW A;  4NRA A;  5CQ3 A;  2G4A A;  4HXK A;  4BW2 A;  5DY7 A;  3MQM A;  5CUC A;  4X2I A;  5E9I A;  2R10 A;  4XY8 A;  5EK9 A;  2L85 A;  4QR5 A;  5A83 A;  5FFW A;  4CFL A;  3SVH A;  5C4Q A;  5LUU A;  5L97 A;  4UYE A;  5FE8 A;  5EVA A;  4YYI A;  4PCE A;  5HQ6 A;  4LYW A;  4XYA A;  3O34 A;  5LJ1 A;  4OUF A;  5C87 A;  2DVS A;  5F61 A;  2DWW A;  4LDF A;  3U5M A;  3D7C A;  4MR4 A;  3MUL A;  2OO1 A;  5D3N A;  5E0R A;  3NXB A;  5D25 A;  2L5E A;  5ACY A;  5I1Q A;  5EI4 A;  2RFJ A;  5FE7 A;  5KTX A;  2YYN A;  4O74 A;  4MEP A;  4ALG A;  4CUQ A;  4HXR A;  4Z1Q A;  5CQ5 A;  5FG6 A;  5LJ0 A;  5CQ8 A;  4YBM A;  2R0Y A;  3S91 A;  5A5O A;  3U5P A;  2R0S A;  5BT4 A;  3LQH A;  4MR3 A;  5FB0 A;  5D3H A;  2DVV A;  5L98 A;  3ONI A;  2DKW A;  5F1H A;  4BJX A;  4MEQ A;  5F63 A;  5FH7 A;  2RI7 A;  4BW3 A;  5FBX A;  4UYH A;  4QC3 A;  4NRB A;  4J0S A;  4UIZ A;  5F1L A;  3JVJ A;  5I80 A;  4UIX A;  5CFW A;  5ENJ A;  5I86 A;  5HEL A;  4O72 A;  3U5O A;  4Z93 A;  4UYD A;  5EWH A;  5E9L A;  5D0C A;  5IID A;  2OUO A;  5A5P A;  5FE1 A;  4ZW1 A;  5F5Z A;  4PS5 A;  5D3S A;  1N72 A;  4HXM A;  1JM4 B;  5AD3 A;  4Q0O A;  5A5N A;  5EWV A;  5HLS A;  4UYF B;  4O75 A;  3UVX A;  4UYF A;  5A82 A;  4YY4 A;  5CQT A;  4UIY A;  5L99 A;  2YQD A;  4LZ2 A;  4O78 A;  5G4S A;  4NQM A;  5DW2 A;  4TZ2 A;  4QYD A;  4MEN A;  5ENC A;  4BHW A;  4QEU A;  5IGL A;  5CP5 A;  5FB1 A;  3U5J A;  4QR4 A;  4YH4 A;  4QB3 A;  4CFK A;  4N4G A;  4O7F A;  4J0R A;  5CU8 A;  5D3P A;  5ENG A;  4QUT A;  2LSP B;  5FG4 A;  5FFY A;  3ZYU A;  4A9H A;  4TT4 A;  4NR7 A;  3UVW A;  3U5K A;  4LR6 A;  5AMF A;  5ENI A;  4MR5 A;  3TLP A;  2DVQ A;  4XUA A;  3LQJ A;  3HMF A;  3IU5 A;  5CTL A;  5AD2 A;  3UV5 A;  3QZV A;  5EWC A;  4TTE A;  5I7Y A;  5II1 A;  5TCM A;  3P1E A;  5JWM A;  5I7X A;  5CQA A;  3GG3 A;  4QY4 A;  4AKN A;  5DKD A;  5EPS A;  2YEM A;  5H1V A;  4TU4 A;  4QST A;  5EWD A;  5D7X A;  5L8U A;  5CRM A;  2YEK A;  2RO1 A;  2RNX A;  5CGP A;  5EQ1 A;  4NR6 A;  4NUE A;  4QEV A;  4YBT A;  4QUU A;  4CUR A;  5DKH A;  4Z6H A;  5DYU A;  4Y03 A;  3K2J A;  4LYI A;  4NS5 A;  3P1C A;  5CY9 A;  3JVL A;  4N4I A;  4QSU A;  5A5R A;  4KCX A;  4RVR A;  5DW1 A;  3MB4 A;  3UW9 A;  4LZR A;  5KO4 A;  3MB3 A;  4A9N A;  5J0D A;  4NYW A;  4HXN A;  5K29 A;  1E6I A;  5EV9 A;  4NXJ A;  4O7B A;  5G4R A;  3O35 A;  4QSW A;  5II2 A;  3SVF A;  4CLB A;  3RCW A;  4O77 A;  5CZG A;  4Z1S A;  4LYS A;  4QNS A;  5BT5 A;  4NR9 A;  4J1P A;  4HBX A;  4PKL A;  5I40 A;  4PTB A;  5IBN A;  5I29 A;  5DBM A;  5D3J A;  5EPR A;  4A9E A;  5CUG A;  3O36 A;  4LRG A;  5DYC A;  5D3T A;  4UIU A;  5DX4 A;  4O70 A;  5HEN A;  4HBV A;  4HXO A;  5F62 A;  5E74 A;  5A5Q A;  5D3R A;  4TQN A;  3JVM A;  5A85 A;  4C66 A;  4YYH A;  5FFV A;  3O33 A;  5F60 A;  5DLZ A;  4TYL A;  4CUU A;  4O7C A;  4YY6 A;  3DWY A;  4E96 A;  2WP2 A;  4IOQ A;  3MUK A;  5DFD A;  1ZS5 A;  3FKM X;  5AME A;  5E9Y A;  4Z6I A;  3QZT A;  2YEL A;  4IR6 A;  4MEO A;  2MJV B;  2D9E A;  2N9G A;  5HJC A;  4A9O A;  5HQ5 A;  5F36 A;  5EGU A;  2WP1 A;  4QSQ A;  5LKU A;  5L8T A;  4NYV A;  5ENF A;  4QSP A;  5DYA A;  4WHW A;  3S92 A;  5CRZ A;  4QYL A;  4YAD A;  4J3I A;  5EU1 A;  4QC1 A;  4IOO A;  5EWW A;  2GRC A;  5IGN A;  5DFB A;  5CUB A;  4LC2 A;  4HBW A;  4HXP A;  4UIT A;  3LQI A;  2RNW A;  5LVQ A;  2FSA A;  5ENH A;  5CPE A;  4O76 A;  5FE6 A;  4QSX A;  3SVG A;  2D82 A;  5CUD A;  2DVR A;  5E9M A;  4O7E A;  5FE5 A;  5DFC A;  3AAD A;  5E9K A;  2RNY A;  3MXF A;  5FH8 A;  4YBS A;  5LJ2 A;  4C67 A;  3QZS A;  5TB6 A;  5H1T A;  5LVR A;  4NQN A;  4TU6 A;  5H1U A;  4ALH A;  4BW1 A;  4Q0N A;  4FLP A;  5CQ4 A;  4TZ8 A;  4XY9 A;  4YC9 A;  3P1F A;  4CUT A;  5I89 A;  4NR4 A;  4A9F A;  5HEM A;  4YYN A;  4QBM A;  5EPB A;  4YYJ A;  5F3A A;  5ENB A;  5FE0 A;  2E3K A;  5LKX A;  5F2P A;  1EQF A;  5DYX A;  4NR5 A;  2E7N A;  4NRC A;  5HQ7 A;  4NR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...