5J0DA

Crystal structure of the bromodomain of human crebbp in complex with a benzoxazepine compound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Development of Selective CBP/P300 Benzoxazepine Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 117
sequence length 117
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5j0dA00
5BT4A 3JVKA 5DYXA 1E6IA 4YAXA 2F6NA 4LRGA 5E9YA 5EV9A 4YC9A 4QC1A 2MJVB 4O70A 2DKWA 4MR5A 4N4IA 5F5ZA 4XUAA 5D26A 4TZ2A 2RNYA 5CZGA 5EPRA 4PTBA 1WUMA 3LJWA 4TU6A 4A9MA 5IG6A 3UW9A 2WP1A 4YYMA 5CUCA 4A9FA 4MR6A 4TQNA 5I40A 5D3SA 3JVMA 4TYLA 2YDWA 4YYJA 5F1LA 4MENA 4QSWA 4UIVA 4UITA 4NYXA 4HXLA 4MEQA 4PCIA 4N4HA 4A9IA 4BW4A 5HRXA 3LXJA 5D25A 4BW2A 4HBWA 5HM0A 3NXBA 5F25A 5FE4A 5FB0A 4TTEA 4HBXA 4UIYA 4HBVA 5HRVA 2DWWA 3ONIA 5EWWA 4IR5A 4N3WA 4Q0NA 5DX4A 5EA1A 4YH4A 3QZVA 5KU3A 4HXPA 4TS8A 5D3HA 5F63A 4HXOA 3LQIA 5F3AA 5DFCA 3UVYA 5F61A 4YBMA 4UYHA 4QNSA 5LKXA 5FE7A 1JSPB 3HMEA 4NR7A 4IR4A 4LZSA 3K2JA 4Q0OA 5CUAA 5H1UA 3UV2A 5F60A 5K29A 5ENGA 4NQNA 4YY4A 4O75A 1EQFA 5AMEA 4YBTA 5EISA 5C89A 5EWCA 5ENEA 4O7FA 4HBYA 4PCEA 5E9IA 5BT5A 4CURA 2R0SA 4A9HA 5CQ7A 3I3JA 4GPJA 4A9KA 3U5PA 4QZSA 5KO4A 3U5MA 5HFQA 5CRMA 4QSQA 4O77A 2G4AA 3TLPA 4MEPA 5D3RA 5G4RA 5A5OA 4IR3A 4AKNA 4LYWA 4A9NA 5E7DA 5DFDA 5KTUA 2RO1A 2DATA 4YYIA 2RFJA 4A9OA 5CQ5A 5FG5A 3HMFA 5E9KA 4MEOA 4LZ2A 5I7XA 4XUBA 2E3KA 4UYGA 5HLSA 4QSPA 5F2PA 5TCMA 4KV4A 3DAIA 5LJ2A 4ZQLA 4CFLA 5D3NA 3Q2EA 3SVFA 5FE5A 5C7NA 4QYDA 5L8UA 2YELA 5HJCA 3P1CA 4QR4A 3P5OA 3UV5A 5FH8A 5I89A 5DYCA 5I83A 5ENJA 5II2A 3IU6A 4YYNA 4NR8A 3O36A 5H1VA 4Z1SA 3LQJA 5IGMA 5DKHA 4UIXA 5I86A 1ZS5A 5I88A 2H60A 5CQ6A 5CUEA 5I80A 4TU4A 3QZSA 5FG4A 5HQ6A 3U5OA 5CUBA 5J0DA 2DVSA 3HMHA 1JM4B 4NRAA 5A85A 5KTXA 5L99A 2DVQA 5CFWA 4WHUA 4NQMA 4Z6HA 3P1EA 5E0RA 4C67A 5LVQA 2F6JA 5CS8A 5TB6A 4NR6A 5CU8A 5KTWA 1WUGA 4X2IA 2OO1A 4QSXA 2R0VA 5CUDA 4QSTA 4QSSA 4BW3A 4O71A 5FE1A 3SVGA 4O76A 5D24A 5IGLA 5D3LA 3U5NA 4QSUA 5II1A 3O34A 4CUUA 5A83A 5CP5A 4KCXA 4O72A 5C87A 4MR3A 3S91A 2OSSA 2YYNA 4IOOA 5C85A 2E7NA 4PKLA 4HXNA 4Y03A 3GG3A 3DWYA 3P1FA 2R0YA 4J1PA 2YW5A 4UYEA 5I29A 5EI4A 4A9JA 5CGPA 4UIUA 4HXMA 4YBSA 4QYLA 4TZ8A 3AQAA 5CUGA 5E3DA 4BHWA 5DBMA 5CQ4A 5D3JA 3UVWA 4ZC9A 5L98A 5HEMA 5DW1A 3D7CA 5DYUA 3U5LA 4UYFA 3MXFA 4UIWA 5H85A 4CL9A 3JVLA 3JVJA 5EGUA 4YYHA 5E9MA 3AADA 5F1HA 5LJ1A 4OGJA 4TT2A 2YQDA 5FE6A 5ETDA 5LJ0A 5FFWA 2YEKA 5ENBA 4LYSA 2NXBA 4O7EA 5JWMA 4QSVA 4BJXA 5JI8A 3FKMX 5A82A 4NR4A 4NUCA 4QB3A 4YY6A 5FE2A 5I7YA 4QEWA 4XY8A 5HQ5A 4CUQA 2RS9B 5DLXA 2FSAA 4NRBA 3MUKA 3MB4A 2L5EA 1X0JA 4NS5A 5LKUA 5D3TA 4NR9A 5FFVA 3O37A 5ENHA 4J3IA 2RNXA 4O7BA 4O7CA 4NXJA 4QEVA 4J0SA 2WP2A 5HQ7A 4YYDA 5EK9A 1F68A 5CPEA 4LZRA 2E7OA 4YH3A 2N9GA 4O74A 5C8GA 2LSPB 4WHWA 2RNWA 4IR6A 4PY6A 4NRCA 2GRCA 2D82A 3UVDA 4UIZA 4OGIA 3O33A 5FE8A 3UVXA 5CRZA 5D3PA 3UV4A 4CUTA 3MULA 3G0JA 5EP7A 5IIDA 4N4FA 4CLBA 4LDFA 5ACYA 4PS5A 4NUDA 5DKCA 4QR3A 5IBNA 4QC3A 4YADA 2RI7A 5ENIA 4NUEA 4J0RA 5D7XA 5DW2A 5A5NA 5FE0A 4N4GA 5EM3A 4IORA 5LKTA 4NYWA 5AD3A 4NYVA 3G0LA 4CUPA 1N72A 4Z93A 4ALGA 4NR5A 3MB3A 4A9LA 4QBMA 4IOQA 5FG6A 3MQMA 5IGKA 5HELA 3S92A 4OUFA 5H1TA 5EWHA 2D9EA 3QZTA 5HRWA 5L8TA 4HXKA 5DFBA 4QUUA 4XYAA 2R10A 4ALHA 4QY4A 5DY7A 4O78A 4QEUA 5DKDA 4YK0A 5DLZA 5D0CA 3O35A 3U5JA 4YYGA 2L85A 2KTBB 3P1DA 4QSRA 5F62A 4LR6A 5A5QA 5A81A 4QUTA 5EPSA 4YABA 5ETBA 5LKZA 3IU5A 4RVRA 5L97A 4CUSA 5HCLA 5FB1A 4BW1A 5KHMA 4E96A 2DVRA 5FFYA 4FLPA 4DONA 4LYIA 5CQAA 5CQ3A 5BT3A 5G4SA 5LVRA 5CQ8A 2DVVA 5EPBA 4LC2A 5A7CA 4UYDA 4ZW1A 4QR5A 5A5SA 4XY9A 5EQ1A 5EWVA 3RCWA 4WIVA 3Q2FA 5FE3A 5E73A 5A5RA 2I8NA 2OUOA 5FH7A 2YEMA 5IGNA 4TT4A 5CTLA 5E9LA 5E9VA 5HENA 5HFRA 4Z6IA 4O7AA 4MR4A 5CQTA 5F36A 5DYAA 5E3GA 5EICA 2I7KA 5CY9A 5AD2A 4C66A 4HXSA 4YATA 2L84A 5A5PA 5FBXA 5EVAA 5ENCA 5I1QA 5FH6A 4TT6A 4Z1QA 3LQHA 5C4QA 4UYFB 4CFKA 4A9EA 5ENFA 3SVHA 5AMFA 3ZYUA 5L96A 5FDZA 5FE9A 5LUUA 3U5KA 5EWDA 5E74A 4HXRA 4F3IA 5COIA 5EU1A 4YYKA 4KV1A
chains in the Genus database with same CATH superfamily
5BT4A 3JVKA 5DYXA 1E6IA 4YAXA 2F6NA 4LRGA 5E9YA 5EV9A 4YC9A 4QC1A 2MJVB 4O70A 2DKWA 4MR5A 3D1BA 4N4IA 5F5ZA 4XUAA 5D26A 4TZ2A 2RNYA 5CZGA 5EPRA 4PTBA 4AI6A 1WUMA 3LJWA 4TU6A 4A9MA 5IG6A 3UW9A 2WP1A 4YYMA 5CUCA 4A9FA 4MR6A 4TQNA 5I40A 5D3SA 3JVMA 4TYLA 2YDWA 4YYJA 5F1LA 4MENA 4QSWA 4UIVA 4UITA 4NYXA 4HXLA 4MEQA 4PCIA 4N4HA 4A9IA 4BW4A 5HRXA 3LXJA 5D25A 4BW2A 4HBWA 5HM0A 3NXBA 5F25A 5FE4A 5FB0A 4TTEA 4HBXA 4UIYA 4HBVA 5HRVA 2DWWA 3ONIA 5EWWA 4IR5A 4N3WA 4Q0NA 5DX4A 5EA1A 4YH4A 3QZVA 5KU3A 4HXPA 4TS8A 5D3HA 5F63A 4HXOA 3LQIA 5F3AA 5DFCA 3UVYA 5F61A 4YBMA 4UYHA 4QNSA 5LKXA 5FE7A 3ERRA 1JSPB 3HMEA 4NR7A 4IR4A 4LZSA 3K2JA 4Q0OA 5CUAA 5H1UA 3UV2A 5F60A 5K29A 5ENGA 4NQNA 4YY4A 4O75A 1EQFA 5AMEA 4YBTA 5EISA 5C89A 5EWCA 5ENEA 4O7FA 4HBYA 4PCEA 5E9IA 5BT5A 4CURA 2R0SA 4A9HA 5CQ7A 3I3JA 4GPJA 4A9KA 3U5PA 4QZSA 5KO4A 3U5MA 5HFQA 5CRMA 4QSQA 4O77A 2G4AA 3TLPA 4MEPA 5D3RA 5G4RA 5A5OA 4IR3A 4AKNA 4LYWA 4A9NA 5E7DA 5DFDA 5KTUA 2RO1A 2DATA 4YYIA 2RFJA 4A9OA 5CQ5A 5FG5A 3HMFA 5E9KA 4MEOA 4LZ2A 5I7XA 4XUBA 2E3KA 4UYGA 5HLSA 4QSPA 5F2PA 5TCMA 4KV4A 3DAIA 5LJ2A 4ZQLA 4CFLA 5D3NA 3Q2EA 3SVFA 5FE5A 5C7NA 4QYDA 5L8UA 2YELA 5HJCA 3P1CA 4QR4A 3P5OA 3UV5A 5FH8A 5I89A 5DYCA 5I83A 5ENJA 5II2A 3IU6A 4YYNA 4NR8A 3D1DA 3O36A 5H1VA 4Z1SA 3LQJA 5IGMA 5DKHA 4UIXA 5I86A 1ZS5A 5I88A 2H60A 5CQ6A 5CUEA 5I80A 4TU4A 3QZSA 5FG4A 5HQ6A 3U5OA 5CUBA 5J0DA 2DVSA 3HMHA 1JM4B 4NRAA 5A85A 5KTXA 5L99A 2DVQA 5CFWA 4WHUA 4NQMA 4Z6HA 3P1EA 5E0RA 4C67A 5LVQA 2F6JA 5CS8A 5TB6A 4NR6A 3VKGA 5CU8A 5KTWA 1WUGA 4X2IA 2OO1A 4QSXA 2R0VA 5CUDA 4QSTA 4QSSA 4BW3A 4O71A 5FE1A 3SVGA 4O76A 5D24A 5IGLA 5D3LA 3U5NA 4QSUA 5II1A 3O34A 4CUUA 5A83A 5CP5A 4KCXA 2EJNA 4O72A 5C87A 4MR3A 3S91A 2OSSA 2YYNA 4IOOA 5C85A 2E7NA 4PKLA 4HXNA 4Y03A 3GG3A 3DWYA 3P1FA 2R0YA 4J1PA 2YW5A 4UYEA 5I29A 5EI4A 4A9JA 5CGPA 4UIUA 4HXMA 4YBSA 4QYLA 4TZ8A 3AQAA 5CUGA 5E3DA 4BHWA 5DBMA 5CQ4A 5D3JA 3UVWA 4ZC9A 5L98A 5HEMA 5DW1A 3D7CA 5DYUA 3U5LA 4UYFA 3MXFA 4UIWA 5H85A 4CL9A 3JVLA 3JVJA 5EGUA 4YYHA 5E9MA 3AADA 5F1HA 5LJ1A 4OGJA 4TT2A 2YQDA 5FE6A 5ETDA 5LJ0A 5FFWA 2YEKA 5ENBA 4LYSA 2NXBA 4O7EA 5JWMA 4QSVA 4BJXA 5JI8A 3FKMX 5A82A 4NR4A 4NUCA 4QB3A 4YY6A 5FE2A 5I7YA 4QEWA 4XY8A 5HQ5A 4CUQA 2RS9B 5DLXA 2FSAA 4NRBA 3MUKA 3MB4A 2L5EA 1X0JA 4NS5A 5LKUA 5D3TA 4NR9A 5FFVA 3O37A 5ENHA 4J3IA 2RNXA 4O7BA 4O7CA 4NXJA 4QEVA 4J0SA 2WP2A 5HQ7A 4YYDA 5EK9A 1F68A 5CPEA 4LZRA 2E7OA 4YH3A 2N9GA 4O74A 5C8GA 2LSPB 4WHWA 2RNWA 4IR6A 4PY6A 4NRCA 2GRCA 2D82A 3UVDA 4UIZA 4OGIA 3O33A 5FE8A 3UVXA 5CRZA 5D3PA 3UV4A 4CUTA 3MULA 3G0JA 5EP7A 5IIDA 4N4FA 4CLBA 4LDFA 5ACYA 4PS5A 4NUDA 5DKCA 4QR3A 5IBNA 4QC3A 4YADA 2RI7A 5ENIA 4NUEA 4J0RA 5D7XA 5DW2A 5A5NA 5FE0A 4N4GA 5EM3A 4IORA 5LKTA 4NYWA 5AD3A 4NYVA 3G0LA 4CUPA 1N72A 4Z93A 4ALGA 4NR5A 3MB3A 4A9LA 4QBMA 4IOQA 5FG6A 3MQMA 5IGKA 4AKGA 5HELA 3S92A 4OUFA 5H1TA 5EWHA 2D9EA 3QZTA 5HRWA 5L8TA 4HXKA 4AKIA 5DFBA 4QUUA 4XYAA 2R10A 4ALHA 4QY4A 5DY7A 4O78A 4QEUA 4AKHA 5DKDA 4YK0A 5DLZA 5D0CA 3O35A 3U5JA 4YYGA 2L85A 2KTBB 3P1DA 4QSRA 5F62A 4LR6A 5A5QA 5A81A 4QUTA 5EPSA 4YABA 5ETBA 5LKZA 3IU5A 4RVRA 5L97A 4CUSA 5HCLA 5FB1A 4BW1A 5KHMA 4E96A 2DVRA 5FFYA 4FLPA 4DONA 4LYIA 5CQAA 5CQ3A 5BT3A 5G4SA 5LVRA 5CQ8A 2DVVA 5EPBA 4LC2A 1PUOA 5A7CA 4UYDA 4ZW1A 4QR5A 5A5SA 4XY9A 5EQ1A 5EWVA 3RCWA 4WIVA 3Q2FA 5FE3A 5E73A 5A5RA 2I8NA 2OUOA 5FH7A 2YEMA 5IGNA 4TT4A 5CTLA 5E9LA 5E9VA 5HENA 5HFRA 4Z6IA 4O7AA 4MR4A 5CQTA 5F36A 5DYAA 1ZKRA 3VKHA 5E3GA 5EICA 2I7KA 5CY9A 5AD2A 4C66A 4HXSA 4YATA 2L84A 5A5PA 5FBXA 5EVAA 5ENCA 5I1QA 5FH6A 4TT6A 4Z1QA 3LQHA 5C4QA 4UYFB 4CFKA 4A9EA 5ENFA 3SVHA 5AMFA 3ZYUA 5L96A 5FDZA 5FE9A 5LUUA 3U5KA 5EWDA 5E74A 4HXRA 4F3IA 5COIA 5EU1A 4YYKA 4KV1A
chains in the Genus database with same CATH topology
5BT4A 3JVKA 5DYXA 1E6IA 4YAXA 2F6NA 4LRGA 5E9YA 5EV9A 4YC9A 4QC1A 2MJVB 4O70A 2DKWA 4MR5A 4N4IA 5F5ZA 4XUAA 5D26A 4TZ2A 2RNYA 5CZGA 5EPRA 4PTBA 1WUMA 3LJWA 4TU6A 4A9MA 5IG6A 3UW9A 2WP1A 4YYMA 5CUCA 4A9FA 4MR6A 4TQNA 5I40A 5D3SA 3JVMA 4TYLA 2YDWA 4YYJA 5F1LA 4MENA 4QSWA 4UIVA 4UITA 4NYXA 4HXLA 4MEQA 4PCIA 4N4HA 4A9IA 4BW4A 5HRXA 3LXJA 5D25A 4BW2A 4HBWA 5HM0A 3NXBA 5F25A 5FE4A 5FB0A 4TTEA 4HBXA 4UIYA 4HBVA 5HRVA 2DWWA 3ONIA 5EWWA 4IR5A 4N3WA 4Q0NA 5DX4A 5EA1A 4YH4A 3QZVA 5KU3A 4HXPA 4TS8A 5D3HA 5F63A 4HXOA 3LQIA 5F3AA 5DFCA 3UVYA 5F61A 4YBMA 4UYHA 4QNSA 5LKXA 5FE7A 1JSPB 3HMEA 4NR7A 4IR4A 4LZSA 3K2JA 4Q0OA 5CUAA 5H1UA 3UV2A 5F60A 5K29A 5ENGA 4NQNA 4YY4A 4O75A 1EQFA 5AMEA 4YBTA 5EISA 5C89A 5EWCA 5ENEA 4O7FA 4HBYA 4PCEA 5E9IA 5BT5A 4CURA 2R0SA 4A9HA 5CQ7A 3I3JA 4GPJA 4A9KA 3U5PA 4QZSA 5KO4A 3U5MA 5HFQA 5CRMA 4QSQA 4O77A 2G4AA 3TLPA 4MEPA 5D3RA 5G4RA 5A5OA 4IR3A 4AKNA 4LYWA 4A9NA 5E7DA 5DFDA 5KTUA 2RO1A 2DATA 4YYIA 2RFJA 4A9OA 5CQ5A 5FG5A 3HMFA 5E9KA 4MEOA 4LZ2A 5I7XA 4XUBA 2E3KA 4UYGA 5HLSA 4QSPA 5F2PA 5TCMA 4KV4A 3DAIA 5LJ2A 4ZQLA 4CFLA 5D3NA 3Q2EA 3SVFA 5FE5A 5C7NA 4QYDA 5L8UA 2YELA 5HJCA 3P1CA 4QR4A 3P5OA 3UV5A 5FH8A 5I89A 5DYCA 5I83A 5ENJA 5II2A 3IU6A 4YYNA 4NR8A 3O36A 5H1VA 4Z1SA 3LQJA 5IGMA 5DKHA 4UIXA 5I86A 1ZS5A 5I88A 2H60A 5CQ6A 5CUEA 5I80A 4TU4A 3QZSA 5FG4A 5HQ6A 3U5OA 5CUBA 5J0DA 2DVSA 3HMHA 1JM4B 4NRAA 5A85A 5KTXA 5L99A 2DVQA 5CFWA 4WHUA 4NQMA 4Z6HA 3P1EA 5E0RA 4C67A 5LVQA 2F6JA 5CS8A 5TB6A 4NR6A 5CU8A 5KTWA 1WUGA 4X2IA 2OO1A 4QSXA 2R0VA 5CUDA 4QSTA 4QSSA 4BW3A 4O71A 5FE1A 3SVGA 4O76A 5D24A 5IGLA 5D3LA 3U5NA 4QSUA 5II1A 3O34A 4CUUA 5A83A 5CP5A 4KCXA 4O72A 5C87A 4MR3A 3S91A 2OSSA 2YYNA 4IOOA 5C85A 2E7NA 4PKLA 4HXNA 4Y03A 3GG3A 3DWYA 3P1FA 2R0YA 4J1PA 2YW5A 4UYEA 5I29A 5EI4A 4A9JA 5CGPA 4UIUA 4HXMA 4YBSA 4QYLA 4TZ8A 3AQAA 5CUGA 5E3DA 4BHWA 5DBMA 5CQ4A 5D3JA 3UVWA 4ZC9A 5L98A 5HEMA 5DW1A 3D7CA 5DYUA 3U5LA 4UYFA 3MXFA 4UIWA 5H85A 4CL9A 3JVLA 3JVJA 5EGUA 4YYHA 5E9MA 3AADA 5F1HA 5LJ1A 4OGJA 4TT2A 2YQDA 5FE6A 5ETDA 5LJ0A 5FFWA 2YEKA 5ENBA 4LYSA 2NXBA 4O7EA 5JWMA 4QSVA 4BJXA 5JI8A 3FKMX 5A82A 4NR4A 4NUCA 4QB3A 4YY6A 5FE2A 5I7YA 4QEWA 4XY8A 5HQ5A 4CUQA 2RS9B 5DLXA 2FSAA 4NRBA 3MUKA 3MB4A 2L5EA 1X0JA 4NS5A 5LKUA 5D3TA 4NR9A 5FFVA 3O37A 5ENHA 4J3IA 2RNXA 4O7BA 4O7CA 4NXJA 4QEVA 4J0SA 2WP2A 5HQ7A 4YYDA 5EK9A 1F68A 5CPEA 4LZRA 2E7OA 4YH3A 2N9GA 4O74A 5C8GA 2LSPB 4WHWA 2RNWA 4IR6A 4PY6A 4NRCA 2GRCA 2D82A 3UVDA 4UIZA 4OGIA 3O33A 5FE8A 3UVXA 5CRZA 5D3PA 3UV4A 4CUTA 3MULA 3G0JA 5EP7A 5IIDA 4N4FA 4CLBA 4LDFA 5ACYA 4PS5A 4NUDA 5DKCA 4QR3A 5IBNA 4QC3A 4YADA 2RI7A 5ENIA 4NUEA 4J0RA 5D7XA 5DW2A 5A5NA 5FE0A 4N4GA 5EM3A 4IORA 5LKTA 4NYWA 5AD3A 4NYVA 3G0LA 4CUPA 1N72A 4Z93A 4ALGA 4NR5A 3MB3A 4A9LA 4QBMA 4IOQA 5FG6A 3MQMA 5IGKA 5HELA 3S92A 4OUFA 5H1TA 5EWHA 2D9EA 3QZTA 5HRWA 5L8TA 4HXKA 5DFBA 4QUUA 4XYAA 2R10A 4ALHA 4QY4A 5DY7A 4O78A 4QEUA 5DKDA 4YK0A 5DLZA 5D0CA 3O35A 3U5JA 4YYGA 2L85A 2KTBB 3P1DA 4QSRA 5F62A 4LR6A 5A5QA 5A81A 4QUTA 5EPSA 4YABA 5ETBA 5LKZA 3IU5A 4RVRA 5L97A 4CUSA 5HCLA 5FB1A 4BW1A 5KHMA 4E96A 2DVRA 5FFYA 4FLPA 4DONA 4LYIA 5CQAA 5CQ3A 5BT3A 5G4SA 5LVRA 5CQ8A 2DVVA 5EPBA 4LC2A 5A7CA 4UYDA 4ZW1A 4QR5A 5A5SA 4XY9A 5EQ1A 5EWVA 3RCWA 4WIVA 3Q2FA 5FE3A 5E73A 5A5RA 2I8NA 2OUOA 5FH7A 2YEMA 5IGNA 4TT4A 5CTLA 5E9LA 5E9VA 5HENA 5HFRA 4Z6IA 4O7AA 4MR4A 5CQTA 5F36A 5DYAA 5E3GA 5EICA 2I7KA 5CY9A 5AD2A 4C66A 4HXSA 4YATA 2L84A 5A5PA 5FBXA 5EVAA 5ENCA 5I1QA 5FH6A 4TT6A 4Z1QA 3LQHA 5C4QA 4UYFB 4CFKA 4A9EA 5ENFA 3SVHA 5AMFA 3ZYUA 5L96A 5FDZA 5FE9A 5LUUA 3U5KA 5EWDA 5E74A 4HXRA 4F3IA 5COIA 5EU1A 4YYKA 4KV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT4 A;  3JVK A;  5DYX A;  1E6I A;  4YAX A;  2F6N A;  4LRG A;  5E9Y A;  5EV9 A;  4YC9 A;  4QC1 A;  2MJV B;  4O70 A;  2DKW A;  4MR5 A;  4N4I A;  5F5Z A;  4XUA A;  5D26 A;  4TZ2 A;  2RNY A;  5CZG A;  5EPR A;  4PTB A;  1WUM A;  3LJW A;  4TU6 A;  4A9M A;  5IG6 A;  3UW9 A;  2WP1 A;  4YYM A;  5CUC A;  4A9F A;  4MR6 A;  4TQN A;  5I40 A;  5D3S A;  3JVM A;  4TYL A;  2YDW A;  4YYJ A;  5F1L A;  4MEN A;  4QSW A;  4UIV A;  4UIT A;  4NYX A;  4HXL A;  4MEQ A;  4PCI A;  4N4H A;  4A9I A;  4BW4 A;  5HRX A;  3LXJ A;  5D25 A;  4BW2 A;  4HBW A;  5HM0 A;  3NXB A;  5F25 A;  5FE4 A;  5FB0 A;  4TTE A;  4HBX A;  4UIY A;  4HBV A;  5HRV A;  2DWW A;  3ONI A;  5EWW A;  4IR5 A;  4N3W A;  4Q0N A;  5DX4 A;  5EA1 A;  4YH4 A;  3QZV A;  5KU3 A;  4HXP A;  4TS8 A;  5D3H A;  5F63 A;  4HXO A;  3LQI A;  5F3A A;  5DFC A;  3UVY A;  5F61 A;  4YBM A;  4UYH A;  4QNS A;  5LKX A;  5FE7 A;  1JSP B;  3HME A;  4NR7 A;  4IR4 A;  4LZS A;  3K2J A;  4Q0O A;  5CUA A;  5H1U A;  3UV2 A;  5F60 A;  5K29 A;  5ENG A;  4NQN A;  4YY4 A;  4O75 A;  1EQF A;  5AME A;  4YBT A;  5EIS A;  5C89 A;  5EWC A;  5ENE A;  4O7F A;  4HBY A;  4PCE A;  5E9I A;  5BT5 A;  4CUR A;  2R0S A;  4A9H A;  5CQ7 A;  3I3J A;  4GPJ A;  4A9K A;  3U5P A;  4QZS A;  5KO4 A;  3U5M A;  5HFQ A;  5CRM A;  4QSQ A;  4O77 A;  2G4A A;  3TLP A;  4MEP A;  5D3R A;  5G4R A;  5A5O A;  4IR3 A;  4AKN A;  4LYW A;  4A9N A;  5E7D A;  5DFD A;  5KTU A;  2RO1 A;  2DAT A;  4YYI A;  2RFJ A;  4A9O A;  5CQ5 A;  5FG5 A;  3HMF A;  5E9K A;  4MEO A;  4LZ2 A;  5I7X A;  4XUB A;  2E3K A;  4UYG A;  5HLS A;  4QSP A;  5F2P A;  5TCM A;  4KV4 A;  3DAI A;  5LJ2 A;  4ZQL A;  4CFL A;  5D3N A;  3Q2E A;  3SVF A;  5FE5 A;  5C7N A;  4QYD A;  5L8U A;  2YEL A;  5HJC A;  3P1C A;  4QR4 A;  3P5O A;  3UV5 A;  5FH8 A;  5I89 A;  5DYC A;  5I83 A;  5ENJ A;  5II2 A;  3IU6 A;  4YYN A;  4NR8 A;  3O36 A;  5H1V A;  4Z1S A;  3LQJ A;  5IGM A;  5DKH A;  4UIX A;  5I86 A;  1ZS5 A;  5I88 A;  2H60 A;  5CQ6 A;  5CUE A;  5I80 A;  4TU4 A;  3QZS A;  5FG4 A;  5HQ6 A;  3U5O A;  5CUB A;  5J0D A;  2DVS A;  3HMH A;  1JM4 B;  4NRA A;  5A85 A;  5KTX A;  5L99 A;  2DVQ A;  5CFW A;  4WHU A;  4NQM A;  4Z6H A;  3P1E A;  5E0R A;  4C67 A;  5LVQ A;  2F6J A;  5CS8 A;  5TB6 A;  4NR6 A;  5CU8 A;  5KTW A;  1WUG A;  4X2I A;  2OO1 A;  4QSX A;  2R0V A;  5CUD A;  4QST A;  4QSS A;  4BW3 A;  4O71 A;  5FE1 A;  3SVG A;  4O76 A;  5D24 A;  5IGL A;  5D3L A;  3U5N A;  4QSU A;  5II1 A;  3O34 A;  4CUU A;  5A83 A;  5CP5 A;  4KCX A;  4O72 A;  5C87 A;  4MR3 A;  3S91 A;  2OSS A;  2YYN A;  4IOO A;  5C85 A;  2E7N A;  4PKL A;  4HXN A;  4Y03 A;  3GG3 A;  3DWY A;  3P1F A;  2R0Y A;  4J1P A;  2YW5 A;  4UYE A;  5I29 A;  5EI4 A;  4A9J A;  5CGP A;  4UIU A;  4HXM A;  4YBS A;  4QYL A;  4TZ8 A;  3AQA A;  5CUG A;  5E3D A;  4BHW A;  5DBM A;  5CQ4 A;  5D3J A;  3UVW A;  4ZC9 A;  5L98 A;  5HEM A;  5DW1 A;  3D7C A;  5DYU A;  3U5L A;  4UYF A;  3MXF A;  4UIW A;  5H85 A;  4CL9 A;  3JVL A;  3JVJ A;  5EGU A;  4YYH A;  5E9M A;  3AAD A;  5F1H A;  5LJ1 A;  4OGJ A;  4TT2 A;  2YQD A;  5FE6 A;  5ETD A;  5LJ0 A;  5FFW A;  2YEK A;  5ENB A;  4LYS A;  2NXB A;  4O7E A;  5JWM A;  4QSV A;  4BJX A;  5JI8 A;  3FKM X;  5A82 A;  4NR4 A;  4NUC A;  4QB3 A;  4YY6 A;  5FE2 A;  5I7Y A;  4QEW A;  4XY8 A;  5HQ5 A;  4CUQ A;  2RS9 B;  5DLX A;  2FSA A;  4NRB A;  3MUK A;  3MB4 A;  2L5E A;  1X0J A;  4NS5 A;  5LKU A;  5D3T A;  4NR9 A;  5FFV A;  3O37 A;  5ENH A;  4J3I A;  2RNX A;  4O7B A;  4O7C A;  4NXJ A;  4QEV A;  4J0S A;  2WP2 A;  5HQ7 A;  4YYD A;  5EK9 A;  1F68 A;  5CPE A;  4LZR A;  2E7O A;  4YH3 A;  2N9G A;  4O74 A;  5C8G A;  2LSP B;  4WHW A;  2RNW A;  4IR6 A;  4PY6 A;  4NRC A;  2GRC A;  2D82 A;  3UVD A;  4UIZ A;  4OGI A;  3O33 A;  5FE8 A;  3UVX A;  5CRZ A;  5D3P A;  3UV4 A;  4CUT A;  3MUL A;  3G0J A;  5EP7 A;  5IID A;  4N4F A;  4CLB A;  4LDF A;  5ACY A;  4PS5 A;  4NUD A;  5DKC A;  4QR3 A;  5IBN A;  4QC3 A;  4YAD A;  2RI7 A;  5ENI A;  4NUE A;  4J0R A;  5D7X A;  5DW2 A;  5A5N A;  5FE0 A;  4N4G A;  5EM3 A;  4IOR A;  5LKT A;  4NYW A;  5AD3 A;  4NYV A;  3G0L A;  4CUP A;  1N72 A;  4Z93 A;  4ALG A;  4NR5 A;  3MB3 A;  4A9L A;  4QBM A;  4IOQ A;  5FG6 A;  3MQM A;  5IGK A;  5HEL A;  3S92 A;  4OUF A;  5H1T A;  5EWH A;  2D9E A;  3QZT A;  5HRW A;  5L8T A;  4HXK A;  5DFB A;  4QUU A;  4XYA A;  2R10 A;  4ALH A;  4QY4 A;  5DY7 A;  4O78 A;  4QEU A;  5DKD A;  4YK0 A;  5DLZ A;  5D0C A;  3O35 A;  3U5J A;  4YYG A;  2L85 A;  2KTB B;  3P1D A;  4QSR A;  5F62 A;  4LR6 A;  5A5Q A;  5A81 A;  4QUT A;  5EPS A;  4YAB A;  5ETB A;  5LKZ A;  3IU5 A;  4RVR A;  5L97 A;  4CUS A;  5HCL A;  5FB1 A;  4BW1 A;  5KHM A;  4E96 A;  2DVR A;  5FFY A;  4FLP A;  4DON A;  4LYI A;  5CQA A;  5CQ3 A;  5BT3 A;  5G4S A;  5LVR A;  5CQ8 A;  2DVV A;  5EPB A;  4LC2 A;  5A7C A;  4UYD A;  4ZW1 A;  4QR5 A;  5A5S A;  4XY9 A;  5EQ1 A;  5EWV A;  3RCW A;  4WIV A;  3Q2F A;  5FE3 A;  5E73 A;  5A5R A;  2I8N A;  2OUO A;  5FH7 A;  2YEM A;  5IGN A;  4TT4 A;  5CTL A;  5E9L A;  5E9V A;  5HEN A;  5HFR A;  4Z6I A;  4O7A A;  4MR4 A;  5CQT A;  5F36 A;  5DYA A;  5E3G A;  5EIC A;  2I7K A;  5CY9 A;  5AD2 A;  4C66 A;  4HXS A;  4YAT A;  2L84 A;  5A5P A;  5FBX A;  5EVA A;  5ENC A;  5I1Q A;  5FH6 A;  4TT6 A;  4Z1Q A;  3LQH A;  5C4Q A;  4UYF B;  4CFK A;  4A9E A;  5ENF A;  3SVH A;  5AMF A;  3ZYU A;  5L96 A;  5FDZ A;  5FE9 A;  5LUU A;  3U5K A;  5EWD A;  5E74 A;  4HXR A;  4F3I A;  5COI A;  5EU1 A;  4YYK A;  4KV1 A; 
#chains in the Genus database with same CATH topology
 5BT4 A;  3JVK A;  5DYX A;  1E6I A;  4YAX A;  2F6N A;  4LRG A;  5E9Y A;  5EV9 A;  4YC9 A;  4QC1 A;  2MJV B;  4O70 A;  2DKW A;  4MR5 A;  3D1B A;  4N4I A;  5F5Z A;  4XUA A;  5D26 A;  4TZ2 A;  2RNY A;  5CZG A;  5EPR A;  4PTB A;  4AI6 A;  1WUM A;  3LJW A;  4TU6 A;  4A9M A;  5IG6 A;  3UW9 A;  2WP1 A;  4YYM A;  5CUC A;  4A9F A;  4MR6 A;  4TQN A;  5I40 A;  5D3S A;  3JVM A;  4TYL A;  2YDW A;  4YYJ A;  5F1L A;  4MEN A;  4QSW A;  4UIV A;  4UIT A;  4NYX A;  4HXL A;  4MEQ A;  4PCI A;  4N4H A;  4A9I A;  4BW4 A;  5HRX A;  3LXJ A;  5D25 A;  4BW2 A;  4HBW A;  5HM0 A;  3NXB A;  5F25 A;  5FE4 A;  5FB0 A;  4TTE A;  4HBX A;  4UIY A;  4HBV A;  5HRV A;  2DWW A;  3ONI A;  5EWW A;  4IR5 A;  4N3W A;  4Q0N A;  5DX4 A;  5EA1 A;  4YH4 A;  3QZV A;  5KU3 A;  4HXP A;  4TS8 A;  5D3H A;  5F63 A;  4HXO A;  3LQI A;  5F3A A;  5DFC A;  3UVY A;  5F61 A;  4YBM A;  4UYH A;  4QNS A;  5LKX A;  5FE7 A;  3ERR A;  1JSP B;  3HME A;  4NR7 A;  4IR4 A;  4LZS A;  3K2J A;  4Q0O A;  5CUA A;  5H1U A;  3UV2 A;  5F60 A;  5K29 A;  5ENG A;  4NQN A;  4YY4 A;  4O75 A;  1EQF A;  5AME A;  4YBT A;  5EIS A;  5C89 A;  5EWC A;  5ENE A;  4O7F A;  4HBY A;  4PCE A;  5E9I A;  5BT5 A;  4CUR A;  2R0S A;  4A9H A;  5CQ7 A;  3I3J A;  4GPJ A;  4A9K A;  3U5P A;  4QZS A;  5KO4 A;  3U5M A;  5HFQ A;  5CRM A;  4QSQ A;  4O77 A;  2G4A A;  3TLP A;  4MEP A;  5D3R A;  5G4R A;  5A5O A;  4IR3 A;  4AKN A;  4LYW A;  4A9N A;  5E7D A;  5DFD A;  5KTU A;  2RO1 A;  2DAT A;  4YYI A;  2RFJ A;  4A9O A;  5CQ5 A;  5FG5 A;  3HMF A;  5E9K A;  4MEO A;  4LZ2 A;  5I7X A;  4XUB A;  2E3K A;  4UYG A;  5HLS A;  4QSP A;  5F2P A;  5TCM A;  4KV4 A;  3DAI A;  5LJ2 A;  4ZQL A;  4CFL A;  5D3N A;  3Q2E A;  3SVF A;  5FE5 A;  5C7N A;  4QYD A;  5L8U A;  2YEL A;  5HJC A;  3P1C A;  4QR4 A;  3P5O A;  3UV5 A;  5FH8 A;  5I89 A;  5DYC A;  5I83 A;  5ENJ A;  5II2 A;  3IU6 A;  4YYN A;  4NR8 A;  3D1D A;  3O36 A;  5H1V A;  4Z1S A;  3LQJ A;  5IGM A;  5DKH A;  4UIX A;  5I86 A;  1ZS5 A;  5I88 A;  2H60 A;  5CQ6 A;  5CUE A;  5I80 A;  4TU4 A;  3QZS A;  5FG4 A;  5HQ6 A;  3U5O A;  5CUB A;  5J0D A;  2DVS A;  3HMH A;  1JM4 B;  4NRA A;  5A85 A;  5KTX A;  5L99 A;  2DVQ A;  5CFW A;  4WHU A;  4NQM A;  4Z6H A;  3P1E A;  5E0R A;  4C67 A;  5LVQ A;  2F6J A;  5CS8 A;  5TB6 A;  4NR6 A;  3VKG A;  5CU8 A;  5KTW A;  1WUG A;  4X2I A;  2OO1 A;  4QSX A;  2R0V A;  5CUD A;  4QST A;  4QSS A;  4BW3 A;  4O71 A;  5FE1 A;  3SVG A;  4O76 A;  5D24 A;  5IGL A;  5D3L A;  3U5N A;  4QSU A;  5II1 A;  3O34 A;  4CUU A;  5A83 A;  5CP5 A;  4KCX A;  2EJN A;  4O72 A;  5C87 A;  4MR3 A;  3S91 A;  2OSS A;  2YYN A;  4IOO A;  5C85 A;  2E7N A;  4PKL A;  4HXN A;  4Y03 A;  3GG3 A;  3DWY A;  3P1F A;  2R0Y A;  4J1P A;  2YW5 A;  4UYE A;  5I29 A;  5EI4 A;  4A9J A;  5CGP A;  4UIU A;  4HXM A;  4YBS A;  4QYL A;  4TZ8 A;  3AQA A;  5CUG A;  5E3D A;  4BHW A;  5DBM A;  5CQ4 A;  5D3J A;  3UVW A;  4ZC9 A;  5L98 A;  5HEM A;  5DW1 A;  3D7C A;  5DYU A;  3U5L A;  4UYF A;  3MXF A;  4UIW A;  5H85 A;  4CL9 A;  3JVL A;  3JVJ A;  5EGU A;  4YYH A;  5E9M A;  3AAD A;  5F1H A;  5LJ1 A;  4OGJ A;  4TT2 A;  2YQD A;  5FE6 A;  5ETD A;  5LJ0 A;  5FFW A;  2YEK A;  5ENB A;  4LYS A;  2NXB A;  4O7E A;  5JWM A;  4QSV A;  4BJX A;  5JI8 A;  3FKM X;  5A82 A;  4NR4 A;  4NUC A;  4QB3 A;  4YY6 A;  5FE2 A;  5I7Y A;  4QEW A;  4XY8 A;  5HQ5 A;  4CUQ A;  2RS9 B;  5DLX A;  2FSA A;  4NRB A;  3MUK A;  3MB4 A;  2L5E A;  1X0J A;  4NS5 A;  5LKU A;  5D3T A;  4NR9 A;  5FFV A;  3O37 A;  5ENH A;  4J3I A;  2RNX A;  4O7B A;  4O7C A;  4NXJ A;  4QEV A;  4J0S A;  2WP2 A;  5HQ7 A;  4YYD A;  5EK9 A;  1F68 A;  5CPE A;  4LZR A;  2E7O A;  4YH3 A;  2N9G A;  4O74 A;  5C8G A;  2LSP B;  4WHW A;  2RNW A;  4IR6 A;  4PY6 A;  4NRC A;  2GRC A;  2D82 A;  3UVD A;  4UIZ A;  4OGI A;  3O33 A;  5FE8 A;  3UVX A;  5CRZ A;  5D3P A;  3UV4 A;  4CUT A;  3MUL A;  3G0J A;  5EP7 A;  5IID A;  4N4F A;  4CLB A;  4LDF A;  5ACY A;  4PS5 A;  4NUD A;  5DKC A;  4QR3 A;  5IBN A;  4QC3 A;  4YAD A;  2RI7 A;  5ENI A;  4NUE A;  4J0R A;  5D7X A;  5DW2 A;  5A5N A;  5FE0 A;  4N4G A;  5EM3 A;  4IOR A;  5LKT A;  4NYW A;  5AD3 A;  4NYV A;  3G0L A;  4CUP A;  1N72 A;  4Z93 A;  4ALG A;  4NR5 A;  3MB3 A;  4A9L A;  4QBM A;  4IOQ A;  5FG6 A;  3MQM A;  5IGK A;  4AKG A;  5HEL A;  3S92 A;  4OUF A;  5H1T A;  5EWH A;  2D9E A;  3QZT A;  5HRW A;  5L8T A;  4HXK A;  4AKI A;  5DFB A;  4QUU A;  4XYA A;  2R10 A;  4ALH A;  4QY4 A;  5DY7 A;  4O78 A;  4QEU A;  4AKH A;  5DKD A;  4YK0 A;  5DLZ A;  5D0C A;  3O35 A;  3U5J A;  4YYG A;  2L85 A;  2KTB B;  3P1D A;  4QSR A;  5F62 A;  4LR6 A;  5A5Q A;  5A81 A;  4QUT A;  5EPS A;  4YAB A;  5ETB A;  5LKZ A;  3IU5 A;  4RVR A;  5L97 A;  4CUS A;  5HCL A;  5FB1 A;  4BW1 A;  5KHM A;  4E96 A;  2DVR A;  5FFY A;  4FLP A;  4DON A;  4LYI A;  5CQA A;  5CQ3 A;  5BT3 A;  5G4S A;  5LVR A;  5CQ8 A;  2DVV A;  5EPB A;  4LC2 A;  1PUO A;  5A7C A;  4UYD A;  4ZW1 A;  4QR5 A;  5A5S A;  4XY9 A;  5EQ1 A;  5EWV A;  3RCW A;  4WIV A;  3Q2F A;  5FE3 A;  5E73 A;  5A5R A;  2I8N A;  2OUO A;  5FH7 A;  2YEM A;  5IGN A;  4TT4 A;  5CTL A;  5E9L A;  5E9V A;  5HEN A;  5HFR A;  4Z6I A;  4O7A A;  4MR4 A;  5CQT A;  5F36 A;  5DYA A;  1ZKR A;  3VKH A;  5E3G A;  5EIC A;  2I7K A;  5CY9 A;  5AD2 A;  4C66 A;  4HXS A;  4YAT A;  2L84 A;  5A5P A;  5FBX A;  5EVA A;  5ENC A;  5I1Q A;  5FH6 A;  4TT6 A;  4Z1Q A;  3LQH A;  5C4Q A;  4UYF B;  4CFK A;  4A9E A;  5ENF A;  3SVH A;  5AMF A;  3ZYU A;  5L96 A;  5FDZ A;  5FE9 A;  5LUU A;  3U5K A;  5EWD A;  5E74 A;  4HXR A;  4F3I A;  5COI A;  5EU1 A;  4YYK A;  4KV1 A; 
#chains in the Genus database with same CATH homology
 5BT4 A;  3JVK A;  5DYX A;  1E6I A;  4YAX A;  2F6N A;  4LRG A;  5E9Y A;  5EV9 A;  4YC9 A;  4QC1 A;  2MJV B;  4O70 A;  2DKW A;  4MR5 A;  4N4I A;  5F5Z A;  4XUA A;  5D26 A;  4TZ2 A;  2RNY A;  5CZG A;  5EPR A;  4PTB A;  1WUM A;  3LJW A;  4TU6 A;  4A9M A;  5IG6 A;  3UW9 A;  2WP1 A;  4YYM A;  5CUC A;  4A9F A;  4MR6 A;  4TQN A;  5I40 A;  5D3S A;  3JVM A;  4TYL A;  2YDW A;  4YYJ A;  5F1L A;  4MEN A;  4QSW A;  4UIV A;  4UIT A;  4NYX A;  4HXL A;  4MEQ A;  4PCI A;  4N4H A;  4A9I A;  4BW4 A;  5HRX A;  3LXJ A;  5D25 A;  4BW2 A;  4HBW A;  5HM0 A;  3NXB A;  5F25 A;  5FE4 A;  5FB0 A;  4TTE A;  4HBX A;  4UIY A;  4HBV A;  5HRV A;  2DWW A;  3ONI A;  5EWW A;  4IR5 A;  4N3W A;  4Q0N A;  5DX4 A;  5EA1 A;  4YH4 A;  3QZV A;  5KU3 A;  4HXP A;  4TS8 A;  5D3H A;  5F63 A;  4HXO A;  3LQI A;  5F3A A;  5DFC A;  3UVY A;  5F61 A;  4YBM A;  4UYH A;  4QNS A;  5LKX A;  5FE7 A;  1JSP B;  3HME A;  4NR7 A;  4IR4 A;  4LZS A;  3K2J A;  4Q0O A;  5CUA A;  5H1U A;  3UV2 A;  5F60 A;  5K29 A;  5ENG A;  4NQN A;  4YY4 A;  4O75 A;  1EQF A;  5AME A;  4YBT A;  5EIS A;  5C89 A;  5EWC A;  5ENE A;  4O7F A;  4HBY A;  4PCE A;  5E9I A;  5BT5 A;  4CUR A;  2R0S A;  4A9H A;  5CQ7 A;  3I3J A;  4GPJ A;  4A9K A;  3U5P A;  4QZS A;  5KO4 A;  3U5M A;  5HFQ A;  5CRM A;  4QSQ A;  4O77 A;  2G4A A;  3TLP A;  4MEP A;  5D3R A;  5G4R A;  5A5O A;  4IR3 A;  4AKN A;  4LYW A;  4A9N A;  5E7D A;  5DFD A;  5KTU A;  2RO1 A;  2DAT A;  4YYI A;  2RFJ A;  4A9O A;  5CQ5 A;  5FG5 A;  3HMF A;  5E9K A;  4MEO A;  4LZ2 A;  5I7X A;  4XUB A;  2E3K A;  4UYG A;  5HLS A;  4QSP A;  5F2P A;  5TCM A;  4KV4 A;  3DAI A;  5LJ2 A;  4ZQL A;  4CFL A;  5D3N A;  3Q2E A;  3SVF A;  5FE5 A;  5C7N A;  4QYD A;  5L8U A;  2YEL A;  5HJC A;  3P1C A;  4QR4 A;  3P5O A;  3UV5 A;  5FH8 A;  5I89 A;  5DYC A;  5I83 A;  5ENJ A;  5II2 A;  3IU6 A;  4YYN A;  4NR8 A;  3O36 A;  5H1V A;  4Z1S A;  3LQJ A;  5IGM A;  5DKH A;  4UIX A;  5I86 A;  1ZS5 A;  5I88 A;  2H60 A;  5CQ6 A;  5CUE A;  5I80 A;  4TU4 A;  3QZS A;  5FG4 A;  5HQ6 A;  3U5O A;  5CUB A;  5J0D A;  2DVS A;  3HMH A;  1JM4 B;  4NRA A;  5A85 A;  5KTX A;  5L99 A;  2DVQ A;  5CFW A;  4WHU A;  4NQM A;  4Z6H A;  3P1E A;  5E0R A;  4C67 A;  5LVQ A;  2F6J A;  5CS8 A;  5TB6 A;  4NR6 A;  5CU8 A;  5KTW A;  1WUG A;  4X2I A;  2OO1 A;  4QSX A;  2R0V A;  5CUD A;  4QST A;  4QSS A;  4BW3 A;  4O71 A;  5FE1 A;  3SVG A;  4O76 A;  5D24 A;  5IGL A;  5D3L A;  3U5N A;  4QSU A;  5II1 A;  3O34 A;  4CUU A;  5A83 A;  5CP5 A;  4KCX A;  4O72 A;  5C87 A;  4MR3 A;  3S91 A;  2OSS A;  2YYN A;  4IOO A;  5C85 A;  2E7N A;  4PKL A;  4HXN A;  4Y03 A;  3GG3 A;  3DWY A;  3P1F A;  2R0Y A;  4J1P A;  2YW5 A;  4UYE A;  5I29 A;  5EI4 A;  4A9J A;  5CGP A;  4UIU A;  4HXM A;  4YBS A;  4QYL A;  4TZ8 A;  3AQA A;  5CUG A;  5E3D A;  4BHW A;  5DBM A;  5CQ4 A;  5D3J A;  3UVW A;  4ZC9 A;  5L98 A;  5HEM A;  5DW1 A;  3D7C A;  5DYU A;  3U5L A;  4UYF A;  3MXF A;  4UIW A;  5H85 A;  4CL9 A;  3JVL A;  3JVJ A;  5EGU A;  4YYH A;  5E9M A;  3AAD A;  5F1H A;  5LJ1 A;  4OGJ A;  4TT2 A;  2YQD A;  5FE6 A;  5ETD A;  5LJ0 A;  5FFW A;  2YEK A;  5ENB A;  4LYS A;  2NXB A;  4O7E A;  5JWM A;  4QSV A;  4BJX A;  5JI8 A;  3FKM X;  5A82 A;  4NR4 A;  4NUC A;  4QB3 A;  4YY6 A;  5FE2 A;  5I7Y A;  4QEW A;  4XY8 A;  5HQ5 A;  4CUQ A;  2RS9 B;  5DLX A;  2FSA A;  4NRB A;  3MUK A;  3MB4 A;  2L5E A;  1X0J A;  4NS5 A;  5LKU A;  5D3T A;  4NR9 A;  5FFV A;  3O37 A;  5ENH A;  4J3I A;  2RNX A;  4O7B A;  4O7C A;  4NXJ A;  4QEV A;  4J0S A;  2WP2 A;  5HQ7 A;  4YYD A;  5EK9 A;  1F68 A;  5CPE A;  4LZR A;  2E7O A;  4YH3 A;  2N9G A;  4O74 A;  5C8G A;  2LSP B;  4WHW A;  2RNW A;  4IR6 A;  4PY6 A;  4NRC A;  2GRC A;  2D82 A;  3UVD A;  4UIZ A;  4OGI A;  3O33 A;  5FE8 A;  3UVX A;  5CRZ A;  5D3P A;  3UV4 A;  4CUT A;  3MUL A;  3G0J A;  5EP7 A;  5IID A;  4N4F A;  4CLB A;  4LDF A;  5ACY A;  4PS5 A;  4NUD A;  5DKC A;  4QR3 A;  5IBN A;  4QC3 A;  4YAD A;  2RI7 A;  5ENI A;  4NUE A;  4J0R A;  5D7X A;  5DW2 A;  5A5N A;  5FE0 A;  4N4G A;  5EM3 A;  4IOR A;  5LKT A;  4NYW A;  5AD3 A;  4NYV A;  3G0L A;  4CUP A;  1N72 A;  4Z93 A;  4ALG A;  4NR5 A;  3MB3 A;  4A9L A;  4QBM A;  4IOQ A;  5FG6 A;  3MQM A;  5IGK A;  5HEL A;  3S92 A;  4OUF A;  5H1T A;  5EWH A;  2D9E A;  3QZT A;  5HRW A;  5L8T A;  4HXK A;  5DFB A;  4QUU A;  4XYA A;  2R10 A;  4ALH A;  4QY4 A;  5DY7 A;  4O78 A;  4QEU A;  5DKD A;  4YK0 A;  5DLZ A;  5D0C A;  3O35 A;  3U5J A;  4YYG A;  2L85 A;  2KTB B;  3P1D A;  4QSR A;  5F62 A;  4LR6 A;  5A5Q A;  5A81 A;  4QUT A;  5EPS A;  4YAB A;  5ETB A;  5LKZ A;  3IU5 A;  4RVR A;  5L97 A;  4CUS A;  5HCL A;  5FB1 A;  4BW1 A;  5KHM A;  4E96 A;  2DVR A;  5FFY A;  4FLP A;  4DON A;  4LYI A;  5CQA A;  5CQ3 A;  5BT3 A;  5G4S A;  5LVR A;  5CQ8 A;  2DVV A;  5EPB A;  4LC2 A;  5A7C A;  4UYD A;  4ZW1 A;  4QR5 A;  5A5S A;  4XY9 A;  5EQ1 A;  5EWV A;  3RCW A;  4WIV A;  3Q2F A;  5FE3 A;  5E73 A;  5A5R A;  2I8N A;  2OUO A;  5FH7 A;  2YEM A;  5IGN A;  4TT4 A;  5CTL A;  5E9L A;  5E9V A;  5HEN A;  5HFR A;  4Z6I A;  4O7A A;  4MR4 A;  5CQT A;  5F36 A;  5DYA A;  5E3G A;  5EIC A;  2I7K A;  5CY9 A;  5AD2 A;  4C66 A;  4HXS A;  4YAT A;  2L84 A;  5A5P A;  5FBX A;  5EVA A;  5ENC A;  5I1Q A;  5FH6 A;  4TT6 A;  4Z1Q A;  3LQH A;  5C4Q A;  4UYF B;  4CFK A;  4A9E A;  5ENF A;  3SVH A;  5AMF A;  3ZYU A;  5L96 A;  5FDZ A;  5FE9 A;  5LUU A;  3U5K A;  5EWD A;  5E74 A;  4HXR A;  4F3I A;  5COI A;  5EU1 A;  4YYK A;  4KV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...