4QEUA

Crystal structure of brd2(bd2) mutant in free form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
112
structure length
112
Chain Sequence
GKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGAHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain-containing protein 2
publication title Chemical biology. A bump-and-hole approach to engineer controlled selectivity of BET bromodomain chemical probes.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qeuA00
5EWHA 2DWWA 2DVQA 2F6NA 5D25A 4QZSA 3UVXA 5D3HA 2R10A 3S92A 5A83A 4XUBA 2RFJA 4QY4A 5F61A 4CL9A 5CU8A 4NR8A 4QSTA 4DONA 4HXNA 4QSXA 4O7CA 2WP2A 4Q0NA 4CUTA 4AKNA 4ALGA 3ZYUA 5I83A 4QR4A 5F1LA 4UITA 4IR4A 1JM4B 4TZ8A 4UYDA 4LZRA 5IGNA 5FB0A 4LDFA 5HQ7A 3HMHA 4KV4A 5CZGA 5HRVA 4CUSA 5F5ZA 4PCEA 2KTBB 4HXSA 4LC2A 4YBMA 5H1VA 5KTXA 4QYDA 4A9LA 2E7NA 3GG3A 5E3GA 2D9EA 4HBXA 4J0RA 5I40A 3QZVA 4CUQA 3RCWA 4X2IA 5FG6A 5C89A 5ENEA 4WHUA 2L5EA 4QSWA 4NYVA 5FE7A 2RS9B 3LXJA 5D26A 5EV9A 4E96A 5HLSA 4LYWA 5HEMA 4OGJA 5HFQA 3TLPA 5L8TA 4YATA 4UIXA 4QR5A 4YK0A 5DLXA 5A81A 5HRXA 4NQMA 4UIVA 5DKHA 3O37A 5EK9A 5LJ2A 4PS5A 4NS5A 4O72A 4BW4A 4A9EA 1ZS5A 3JVJA 3MULA 5DYCA 2RI7A 5CQ3A 5D3NA 5CQTA 5D3SA 5ENJA 5CGPA 5EM3A 4LYSA 5A5OA 4OGIA 3P1DA 4CURA 4MENA 4QEWA 4TT4A 5E0RA 2D82A 5F3AA 2YQDA 4KCXA 2F6JA 4MR5A 2YEKA 5LJ1A 5ETBA 4O76A 5D7XA 3LQIA 1WUGA 5C8GA 5FH8A 4TZ2A 4A9JA 4NQNA 5LKXA 2LSPB 3DAIA 4QSUA 5ENGA 4A9FA 5ACYA 4BW1A 3D7CA 5F25A 5LKZA 3JVKA 4QC1A 4CFLA 3MB3A 4NXJA 4C67A 4F3IA 4J1PA 5LKUA 2L85A 3QZSA 3U5PA 2RNYA 4IORA 2R0YA 3LQJA 5A5NA 5A82A 3U5NA 5KHMA 5TB6A 5EWCA 5DW2A 4NRAA 5DFDA 5F63A 4HXRA 4O71A 4BHWA 5ENCA 4MEQA 5HRWA 5I89A 4PCIA 3P1CA 4LZSA 5IGMA 3JVLA 5CRMA 4TT2A 4J0SA 5EQ1A 4HXLA 4A9KA 5CP5A 5L99A 2DATA 5CFWA 3G0LA 3HMFA 4KV1A 5CQ5A 4QSQA 4IR5A 4NR9A 4YABA 5DY7A 4BW2A 5FG4A 5ENIA 5D3RA 4YYJA 5I80A 4ZQLA 5E74A 4UIUA 5CPEA 3U5KA 5FE1A 4RVRA 4A9NA 5E9IA 5A5RA 3U5JA 5CUAA 5AMEA 4C66A 4N4FA 2DVVA 4O78A 3SVGA 4QSVA 5ENBA 3IU6A 5EWDA 5HQ6A 3MB4A 5II1A 5IGKA 5ETDA 2YDWA 5FG5A 4UIZA 3LJWA 3MXFA 4ZC9A 3Q2EA 4HXMA 5DKCA 4O70A 4HXPA 4MR4A 3UV4A 4OUFA 4YC9A 4TU6A 5KU3A 2RO1A 5CQ6A 2H60A 4CUPA 4YAXA 4NR4A 3U5OA 5E9KA 3I3JA 2L84A 4Y03A 4XYAA 2DKWA 4O74A 5L96A 4PTBA 4QYLA 4QNSA 1F68A 5EI4A 5IBNA 4IOOA 5KO4A 5FB1A 2OSSA 5COIA 5KTUA 4A9HA 2I7KA 4O7BA 4QEVA 4LZ2A 3Q2FA 5L97A 3O34A 3UV5A 3MQMA 4TS8A 4FLPA 5AD3A 2MJVB 3UW9A 5BT3A 3O33A 4YH4A 5IIDA 3UVYA 4NR6A 4YY4A 5EPRA 4BJXA 2OUOA 4TT6A 5CTLA 5H1TA 5H85A 5FE5A 4UYFB 4NR7A 4UYGA 5FE8A 5BT5A 4MEOA 4XUAA 4A9OA 5BT4A 5HFRA 5D3JA 4A9MA 5LJ0A 5DYAA 5CQAA 5HJCA 4CLBA 5EVAA 4ALHA 5D24A 2DVSA 5FFYA 5JI8A 4PKLA 1JSPB 2E7OA 4IR6A 5A85A 5C4QA 4QUTA 3FKMX 5CUEA 5F36A 3NXBA 4YYDA 5CQ4A 5FFVA 5FE6A 4LRGA 3JVMA 4CFKA 3UVDA 4NYWA 5A7CA 3G0JA 4O7AA 4ZW1A 4Z1SA 4HBVA 5FFWA 5HCLA 4TTEA 5EPBA 4YYIA 5G4RA 4Z6IA 5JWMA 5E9VA 5LVQA 5L98A 4PY6A 5EPSA 5E9MA 5I29A 4TQNA 5LUUA 1N72A 4UIWA 4NUCA 4CUUA 5DBMA 5FE2A 4QBMA 4N4HA 3P1FA 5FE4A 5E73A 4MR6A 4NR5A 5CQ8A 4QC3A 4O7FA 4HBYA 4QB3A 4QSPA 5EICA 5FH7A 5CUBA 3S91A 5D0CA 2E3KA 5FH6A 2R0VA 2N9GA 4XY8A 5CS8A 5DW1A 4Z1QA 4YY6A 5J0DA 3QZTA 3DWYA 5EU1A 3P5OA 4NRCA 4IOQA 4BW3A 5EWWA 4J3IA 4Z6HA 5FE9A 5K29A 4WIVA 5KTWA 5E3DA 5I7YA 4UIYA 4NRBA 5F60A 2WP1A 3IU5A 5EP7A 4TU4A 1E6IA 4MEPA 4NUDA 5CRZA 5FE3A 3O35A 5D3LA 5HELA 4YYMA 4QSSA 3LQHA 1EQFA 4QEUA 5E9LA 2YYNA 4TYLA 5H1UA 2FSAA 5IGLA 5HENA 5HQ5A 3ONIA 3P1EA 5HM0A 4O77A 4YYNA 5CUDA 3O36A 5I88A 3AADA 4YYHA 5A5PA 4IR3A 5DYXA 5DKDA 3UV2A 5D3PA 5DYUA 2NXBA 4N4IA 4XY9A 4N3WA 2R0SA 4MR3A 5II2A 5G4SA 5AMFA 2DVRA 4YYGA 3AQAA 4Q0OA 5DFBA 5DFCA 5CY9A 4LR6A 3U5LA 5C7NA 5A5SA 5CUGA 5E7DA 4YYKA 4QUUA 4GPJA 1X0JA 2RNWA 4NUEA 4O7EA 2YEMA 3SVFA 5LVRA 5F62A 5DLZA 4UYFA 3U5MA 5F2PA 4HXOA 5IG6A 4HXKA 5EA1A 5DX4A 5EISA 5I86A 2G4AA 5CQ7A 4UYHA 2OO1A 5C85A 4UYEA 3HMEA 4LYIA 5D3TA 5I1QA 4HBWA 5A5QA 3SVHA 4O75A 2YELA 5I7XA 4YBTA 4YH3A 5EWVA 4QSRA 5FDZA 2YW5A 5L8UA 3K2JA 4Z93A 4NYXA 5ENFA 2RNXA 3MUKA 5FBXA 5AD2A 3UVWA 1WUMA 2GRCA 4N4GA 5E9YA 5FE0A 4YADA 2I8NA 5C87A 4YBSA 5CUCA 5EGUA 4QR3A 5LKTA 4WHWA 5ENHA 5F1HA 4A9IA 5TCMA
chains in the Genus database with same CATH superfamily
5EWHA 2DWWA 2DVQA 2F6NA 5D25A 4QZSA 3UVXA 5D3HA 2R10A 3S92A 5A83A 4XUBA 2RFJA 4QY4A 5F61A 4CL9A 5CU8A 4NR8A 4QSTA 4DONA 4HXNA 4QSXA 4O7CA 3VKHA 2WP2A 4Q0NA 4CUTA 4AKNA 4ALGA 3ZYUA 5I83A 4QR4A 5F1LA 4UITA 4IR4A 1JM4B 4TZ8A 4UYDA 4LZRA 5IGNA 5FB0A 4LDFA 5HQ7A 3HMHA 4KV4A 5CZGA 5HRVA 4CUSA 5F5ZA 4PCEA 2KTBB 4HXSA 4LC2A 4YBMA 5H1VA 5KTXA 4QYDA 4A9LA 2E7NA 3GG3A 5E3GA 2D9EA 4HBXA 4J0RA 5I40A 3QZVA 4CUQA 3RCWA 4X2IA 5FG6A 5C89A 5ENEA 4WHUA 2L5EA 4QSWA 4NYVA 5FE7A 2RS9B 3LXJA 5D26A 5EV9A 4E96A 5HLSA 4LYWA 5HEMA 4OGJA 5HFQA 3TLPA 5L8TA 4YATA 4UIXA 4QR5A 4YK0A 5DLXA 5A81A 5HRXA 4NQMA 4UIVA 5DKHA 3O37A 4AKIA 5EK9A 5LJ2A 4PS5A 4NS5A 4O72A 4BW4A 4A9EA 1ZS5A 3JVJA 3MULA 5DYCA 2RI7A 5CQ3A 5D3NA 5CQTA 5D3SA 5ENJA 5CGPA 5EM3A 4LYSA 5A5OA 4OGIA 3P1DA 4CURA 4MENA 4QEWA 4TT4A 5E0RA 2D82A 5F3AA 2YQDA 4KCXA 2F6JA 4MR5A 2YEKA 5LJ1A 5ETBA 4O76A 5D7XA 3LQIA 1WUGA 5C8GA 5FH8A 4TZ2A 4A9JA 1ZKRA 4NQNA 5LKXA 2LSPB 3DAIA 4QSUA 5ENGA 4A9FA 5ACYA 4BW1A 3D7CA 5F25A 5LKZA 3JVKA 4QC1A 4CFLA 3MB3A 4NXJA 4C67A 4F3IA 4J1PA 5LKUA 2L85A 3QZSA 3U5PA 2RNYA 4IORA 2R0YA 3LQJA 5A5NA 5A82A 3U5NA 5KHMA 5TB6A 5EWCA 5DW2A 4NRAA 5DFDA 5F63A 4HXRA 4O71A 4BHWA 5ENCA 4MEQA 5HRWA 5I89A 4PCIA 3P1CA 4LZSA 5IGMA 3JVLA 5CRMA 4TT2A 4J0SA 5EQ1A 4HXLA 4A9KA 5CP5A 5L99A 2DATA 5CFWA 3G0LA 3HMFA 4KV1A 5CQ5A 4QSQA 4IR5A 4NR9A 4YABA 5DY7A 4BW2A 5FG4A 5ENIA 5D3RA 4YYJA 5I80A 4ZQLA 5E74A 4UIUA 5CPEA 3U5KA 5FE1A 4RVRA 4A9NA 5E9IA 5A5RA 3U5JA 5CUAA 5AMEA 4C66A 4N4FA 2DVVA 4O78A 3SVGA 4QSVA 5ENBA 3IU6A 5EWDA 5HQ6A 3MB4A 5II1A 5IGKA 5ETDA 2YDWA 5FG5A 4UIZA 3LJWA 3MXFA 4ZC9A 3Q2EA 4HXMA 5DKCA 4O70A 4HXPA 4MR4A 3UV4A 4OUFA 4YC9A 4TU6A 2EJNA 5KU3A 2RO1A 5CQ6A 2H60A 4CUPA 4YAXA 4NR4A 3U5OA 5E9KA 3I3JA 2L84A 4Y03A 4XYAA 2DKWA 4O74A 5L96A 4PTBA 4QYLA 4QNSA 1F68A 5EI4A 5IBNA 4IOOA 5KO4A 5FB1A 2OSSA 3VKGA 5COIA 5KTUA 4A9HA 2I7KA 4O7BA 4QEVA 4LZ2A 3Q2FA 5L97A 3O34A 3UV5A 3MQMA 4TS8A 4FLPA 5AD3A 2MJVB 3UW9A 5BT3A 3O33A 4YH4A 5IIDA 3UVYA 4NR6A 4YY4A 5EPRA 4BJXA 2OUOA 4TT6A 5CTLA 5H1TA 5H85A 5FE5A 4UYFB 4NR7A 4UYGA 5FE8A 5BT5A 4MEOA 4XUAA 4A9OA 5BT4A 5HFRA 5D3JA 4A9MA 5LJ0A 5DYAA 5CQAA 5HJCA 4CLBA 5EVAA 4ALHA 5D24A 2DVSA 5FFYA 5JI8A 4PKLA 1JSPB 2E7OA 4IR6A 5A85A 5C4QA 4QUTA 3FKMX 5CUEA 5F36A 3NXBA 4YYDA 5CQ4A 5FFVA 5FE6A 4LRGA 3JVMA 4CFKA 3UVDA 4NYWA 5A7CA 3G0JA 4O7AA 4ZW1A 4Z1SA 4HBVA 5FFWA 5HCLA 4TTEA 5EPBA 4YYIA 4AI6A 5G4RA 4Z6IA 5JWMA 5E9VA 5LVQA 3D1DA 5L98A 4PY6A 5EPSA 5E9MA 5I29A 4TQNA 5LUUA 1N72A 4UIWA 4NUCA 4CUUA 5DBMA 5FE2A 4QBMA 4N4HA 3P1FA 5FE4A 5E73A 4MR6A 4NR5A 5CQ8A 1PUOA 4QC3A 4O7FA 4HBYA 4QB3A 4QSPA 5EICA 5FH7A 5CUBA 3S91A 5D0CA 2E3KA 5FH6A 2R0VA 2N9GA 4XY8A 5CS8A 5DW1A 4Z1QA 4YY6A 5J0DA 3QZTA 3DWYA 5EU1A 3P5OA 4NRCA 4IOQA 4BW3A 5EWWA 4J3IA 4Z6HA 5FE9A 5K29A 4WIVA 5KTWA 5E3DA 5I7YA 4UIYA 4NRBA 5F60A 2WP1A 3IU5A 5EP7A 4TU4A 1E6IA 4MEPA 4NUDA 5CRZA 5FE3A 3O35A 5D3LA 5HELA 4YYMA 4QSSA 3LQHA 1EQFA 4QEUA 5E9LA 2YYNA 4TYLA 5H1UA 2FSAA 5IGLA 5HENA 5HQ5A 3ONIA 3P1EA 5HM0A 4O77A 4YYNA 5CUDA 3O36A 5I88A 3AADA 4YYHA 5A5PA 4IR3A 5DYXA 5DKDA 3UV2A 5D3PA 5DYUA 2NXBA 4N4IA 4XY9A 4N3WA 2R0SA 4MR3A 5II2A 5G4SA 5AMFA 3D1BA 2DVRA 4YYGA 3AQAA 4Q0OA 5DFBA 5DFCA 5CY9A 4LR6A 3U5LA 5C7NA 5A5SA 5CUGA 5E7DA 4YYKA 4QUUA 4GPJA 1X0JA 2RNWA 4NUEA 4O7EA 2YEMA 3SVFA 5LVRA 5F62A 5DLZA 4UYFA 3U5MA 5F2PA 4HXOA 5IG6A 4HXKA 5EA1A 5DX4A 5EISA 5I86A 2G4AA 5CQ7A 4UYHA 2OO1A 5C85A 4UYEA 3HMEA 4AKGA 4LYIA 5D3TA 5I1QA 4HBWA 5A5QA 3SVHA 4O75A 4AKHA 2YELA 5I7XA 4YBTA 4YH3A 5EWVA 4QSRA 5FDZA 2YW5A 5L8UA 3K2JA 4Z93A 4NYXA 5ENFA 2RNXA 3MUKA 5FBXA 5AD2A 3UVWA 1WUMA 2GRCA 4N4GA 5E9YA 5FE0A 4YADA 2I8NA 5C87A 4YBSA 5CUCA 3ERRA 4QR3A 5EGUA 5LKTA 4WHWA 5ENHA 5F1HA 4A9IA 5TCMA
chains in the Genus database with same CATH topology
5EWHA 2DWWA 2DVQA 2F6NA 5D25A 4QZSA 3UVXA 5D3HA 2R10A 3S92A 5A83A 4XUBA 2RFJA 4QY4A 5F61A 4CL9A 5CU8A 4NR8A 4QSTA 4DONA 4HXNA 4QSXA 4O7CA 2WP2A 4Q0NA 4CUTA 4AKNA 4ALGA 3ZYUA 5I83A 4QR4A 5F1LA 4UITA 4IR4A 1JM4B 4TZ8A 4UYDA 4LZRA 5IGNA 5FB0A 4LDFA 5HQ7A 3HMHA 4KV4A 5CZGA 5HRVA 4CUSA 5F5ZA 4PCEA 2KTBB 4HXSA 4LC2A 4YBMA 5H1VA 5KTXA 4QYDA 4A9LA 2E7NA 3GG3A 5E3GA 2D9EA 4HBXA 4J0RA 5I40A 3QZVA 4CUQA 3RCWA 4X2IA 5FG6A 5C89A 5ENEA 4WHUA 2L5EA 4QSWA 4NYVA 5FE7A 2RS9B 3LXJA 5D26A 5EV9A 4E96A 5HLSA 4LYWA 5HEMA 4OGJA 5HFQA 3TLPA 5L8TA 4YATA 4UIXA 4QR5A 4YK0A 5DLXA 5A81A 5HRXA 4NQMA 4UIVA 5DKHA 3O37A 5EK9A 5LJ2A 4PS5A 4NS5A 4O72A 4BW4A 4A9EA 1ZS5A 3JVJA 3MULA 5DYCA 2RI7A 5CQ3A 5D3NA 5CQTA 5D3SA 5ENJA 5CGPA 5EM3A 4LYSA 5A5OA 4OGIA 3P1DA 4CURA 4MENA 4QEWA 4TT4A 5E0RA 2D82A 5F3AA 2YQDA 4KCXA 2F6JA 4MR5A 2YEKA 5LJ1A 5ETBA 4O76A 5D7XA 3LQIA 1WUGA 5C8GA 5FH8A 4TZ2A 4A9JA 4NQNA 5LKXA 2LSPB 3DAIA 4QSUA 5ENGA 4A9FA 5ACYA 4BW1A 3D7CA 5F25A 5LKZA 3JVKA 4QC1A 4CFLA 3MB3A 4NXJA 4C67A 4F3IA 4J1PA 5LKUA 2L85A 3QZSA 3U5PA 2RNYA 4IORA 2R0YA 3LQJA 5A5NA 5A82A 3U5NA 5KHMA 5TB6A 5EWCA 5DW2A 4NRAA 5DFDA 5F63A 4HXRA 4O71A 4BHWA 5ENCA 4MEQA 5HRWA 5I89A 4PCIA 3P1CA 4LZSA 5IGMA 3JVLA 5CRMA 4TT2A 4J0SA 5EQ1A 4HXLA 4A9KA 5CP5A 5L99A 2DATA 5CFWA 3G0LA 3HMFA 4KV1A 5CQ5A 4QSQA 4IR5A 4NR9A 4YABA 5DY7A 4BW2A 5FG4A 5ENIA 5D3RA 4YYJA 5I80A 4ZQLA 5E74A 4UIUA 5CPEA 3U5KA 5FE1A 4RVRA 4A9NA 5E9IA 5A5RA 3U5JA 5CUAA 5AMEA 4C66A 4N4FA 2DVVA 4O78A 3SVGA 4QSVA 5ENBA 3IU6A 5EWDA 5HQ6A 3MB4A 5II1A 5IGKA 5ETDA 2YDWA 5FG5A 4UIZA 3LJWA 3MXFA 4ZC9A 3Q2EA 4HXMA 5DKCA 4O70A 4HXPA 4MR4A 3UV4A 4OUFA 4YC9A 4TU6A 5KU3A 2RO1A 5CQ6A 2H60A 4CUPA 4YAXA 4NR4A 3U5OA 5E9KA 3I3JA 2L84A 4Y03A 4XYAA 2DKWA 4O74A 5L96A 4PTBA 4QYLA 4QNSA 1F68A 5EI4A 5IBNA 4IOOA 5KO4A 5FB1A 2OSSA 5COIA 5KTUA 4A9HA 2I7KA 4O7BA 4QEVA 4LZ2A 3Q2FA 5L97A 3O34A 3UV5A 3MQMA 4TS8A 4FLPA 5AD3A 2MJVB 3UW9A 5BT3A 3O33A 4YH4A 5IIDA 3UVYA 4NR6A 4YY4A 5EPRA 4BJXA 2OUOA 4TT6A 5CTLA 5H1TA 5H85A 5FE5A 4UYFB 4NR7A 4UYGA 5FE8A 5BT5A 4MEOA 4XUAA 4A9OA 5BT4A 5HFRA 5D3JA 4A9MA 5LJ0A 5DYAA 5CQAA 5HJCA 4CLBA 5EVAA 4ALHA 5D24A 2DVSA 5FFYA 5JI8A 4PKLA 1JSPB 2E7OA 4IR6A 5A85A 5C4QA 4QUTA 3FKMX 5CUEA 5F36A 3NXBA 4YYDA 5CQ4A 5FFVA 5FE6A 4LRGA 3JVMA 4CFKA 3UVDA 4NYWA 5A7CA 3G0JA 4O7AA 4ZW1A 4Z1SA 4HBVA 5FFWA 5HCLA 4TTEA 5EPBA 4YYIA 5G4RA 4Z6IA 5JWMA 5E9VA 5LVQA 5L98A 4PY6A 5EPSA 5E9MA 5I29A 4TQNA 5LUUA 1N72A 4UIWA 4NUCA 4CUUA 5DBMA 5FE2A 4QBMA 4N4HA 3P1FA 5FE4A 5E73A 4MR6A 4NR5A 5CQ8A 4QC3A 4O7FA 4HBYA 4QB3A 4QSPA 5EICA 5FH7A 5CUBA 3S91A 5D0CA 2E3KA 5FH6A 2R0VA 2N9GA 4XY8A 5CS8A 5DW1A 4Z1QA 4YY6A 5J0DA 3QZTA 3DWYA 5EU1A 3P5OA 4NRCA 4IOQA 4BW3A 5EWWA 4J3IA 4Z6HA 5FE9A 5K29A 4WIVA 5KTWA 5E3DA 5I7YA 4UIYA 4NRBA 5F60A 2WP1A 3IU5A 5EP7A 4TU4A 1E6IA 4MEPA 4NUDA 5CRZA 5FE3A 3O35A 5D3LA 5HELA 4YYMA 4QSSA 3LQHA 1EQFA 4QEUA 5E9LA 2YYNA 4TYLA 5H1UA 2FSAA 5IGLA 5HENA 5HQ5A 3ONIA 3P1EA 5HM0A 4O77A 4YYNA 5CUDA 3O36A 5I88A 3AADA 4YYHA 5A5PA 4IR3A 5DYXA 5DKDA 3UV2A 5D3PA 5DYUA 2NXBA 4N4IA 4XY9A 4N3WA 2R0SA 4MR3A 5II2A 5G4SA 5AMFA 2DVRA 4YYGA 3AQAA 4Q0OA 5DFBA 5DFCA 5CY9A 4LR6A 3U5LA 5C7NA 5A5SA 5CUGA 5E7DA 4YYKA 4QUUA 4GPJA 1X0JA 2RNWA 4NUEA 4O7EA 2YEMA 3SVFA 5LVRA 5F62A 5DLZA 4UYFA 3U5MA 5F2PA 4HXOA 5IG6A 4HXKA 5EA1A 5DX4A 5EISA 5I86A 2G4AA 5CQ7A 4UYHA 2OO1A 5C85A 4UYEA 3HMEA 4LYIA 5D3TA 5I1QA 4HBWA 5A5QA 3SVHA 4O75A 2YELA 5I7XA 4YBTA 4YH3A 5EWVA 4QSRA 5FDZA 2YW5A 5L8UA 3K2JA 4Z93A 4NYXA 5ENFA 2RNXA 3MUKA 5FBXA 5AD2A 3UVWA 1WUMA 2GRCA 4N4GA 5E9YA 5FE0A 4YADA 2I8NA 5C87A 4YBSA 5CUCA 5EGUA 4QR3A 5LKTA 4WHWA 5ENHA 5F1HA 4A9IA 5TCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWH A;  2DWW A;  2DVQ A;  2F6N A;  5D25 A;  4QZS A;  3UVX A;  5D3H A;  2R10 A;  3S92 A;  5A83 A;  4XUB A;  2RFJ A;  4QY4 A;  5F61 A;  4CL9 A;  5CU8 A;  4NR8 A;  4QST A;  4DON A;  4HXN A;  4QSX A;  4O7C A;  2WP2 A;  4Q0N A;  4CUT A;  4AKN A;  4ALG A;  3ZYU A;  5I83 A;  4QR4 A;  5F1L A;  4UIT A;  4IR4 A;  1JM4 B;  4TZ8 A;  4UYD A;  4LZR A;  5IGN A;  5FB0 A;  4LDF A;  5HQ7 A;  3HMH A;  4KV4 A;  5CZG A;  5HRV A;  4CUS A;  5F5Z A;  4PCE A;  2KTB B;  4HXS A;  4LC2 A;  4YBM A;  5H1V A;  5KTX A;  4QYD A;  4A9L A;  2E7N A;  3GG3 A;  5E3G A;  2D9E A;  4HBX A;  4J0R A;  5I40 A;  3QZV A;  4CUQ A;  3RCW A;  4X2I A;  5FG6 A;  5C89 A;  5ENE A;  4WHU A;  2L5E A;  4QSW A;  4NYV A;  5FE7 A;  2RS9 B;  3LXJ A;  5D26 A;  5EV9 A;  4E96 A;  5HLS A;  4LYW A;  5HEM A;  4OGJ A;  5HFQ A;  3TLP A;  5L8T A;  4YAT A;  4UIX A;  4QR5 A;  4YK0 A;  5DLX A;  5A81 A;  5HRX A;  4NQM A;  4UIV A;  5DKH A;  3O37 A;  5EK9 A;  5LJ2 A;  4PS5 A;  4NS5 A;  4O72 A;  4BW4 A;  4A9E A;  1ZS5 A;  3JVJ A;  3MUL A;  5DYC A;  2RI7 A;  5CQ3 A;  5D3N A;  5CQT A;  5D3S A;  5ENJ A;  5CGP A;  5EM3 A;  4LYS A;  5A5O A;  4OGI A;  3P1D A;  4CUR A;  4MEN A;  4QEW A;  4TT4 A;  5E0R A;  2D82 A;  5F3A A;  2YQD A;  4KCX A;  2F6J A;  4MR5 A;  2YEK A;  5LJ1 A;  5ETB A;  4O76 A;  5D7X A;  3LQI A;  1WUG A;  5C8G A;  5FH8 A;  4TZ2 A;  4A9J A;  4NQN A;  5LKX A;  2LSP B;  3DAI A;  4QSU A;  5ENG A;  4A9F A;  5ACY A;  4BW1 A;  3D7C A;  5F25 A;  5LKZ A;  3JVK A;  4QC1 A;  4CFL A;  3MB3 A;  4NXJ A;  4C67 A;  4F3I A;  4J1P A;  5LKU A;  2L85 A;  3QZS A;  3U5P A;  2RNY A;  4IOR A;  2R0Y A;  3LQJ A;  5A5N A;  5A82 A;  3U5N A;  5KHM A;  5TB6 A;  5EWC A;  5DW2 A;  4NRA A;  5DFD A;  5F63 A;  4HXR A;  4O71 A;  4BHW A;  5ENC A;  4MEQ A;  5HRW A;  5I89 A;  4PCI A;  3P1C A;  4LZS A;  5IGM A;  3JVL A;  5CRM A;  4TT2 A;  4J0S A;  5EQ1 A;  4HXL A;  4A9K A;  5CP5 A;  5L99 A;  2DAT A;  5CFW A;  3G0L A;  3HMF A;  4KV1 A;  5CQ5 A;  4QSQ A;  4IR5 A;  4NR9 A;  4YAB A;  5DY7 A;  4BW2 A;  5FG4 A;  5ENI A;  5D3R A;  4YYJ A;  5I80 A;  4ZQL A;  5E74 A;  4UIU A;  5CPE A;  3U5K A;  5FE1 A;  4RVR A;  4A9N A;  5E9I A;  5A5R A;  3U5J A;  5CUA A;  5AME A;  4C66 A;  4N4F A;  2DVV A;  4O78 A;  3SVG A;  4QSV A;  5ENB A;  3IU6 A;  5EWD A;  5HQ6 A;  3MB4 A;  5II1 A;  5IGK A;  5ETD A;  2YDW A;  5FG5 A;  4UIZ A;  3LJW A;  3MXF A;  4ZC9 A;  3Q2E A;  4HXM A;  5DKC A;  4O70 A;  4HXP A;  4MR4 A;  3UV4 A;  4OUF A;  4YC9 A;  4TU6 A;  5KU3 A;  2RO1 A;  5CQ6 A;  2H60 A;  4CUP A;  4YAX A;  4NR4 A;  3U5O A;  5E9K A;  3I3J A;  2L84 A;  4Y03 A;  4XYA A;  2DKW A;  4O74 A;  5L96 A;  4PTB A;  4QYL A;  4QNS A;  1F68 A;  5EI4 A;  5IBN A;  4IOO A;  5KO4 A;  5FB1 A;  2OSS A;  5COI A;  5KTU A;  4A9H A;  2I7K A;  4O7B A;  4QEV A;  4LZ2 A;  3Q2F A;  5L97 A;  3O34 A;  3UV5 A;  3MQM A;  4TS8 A;  4FLP A;  5AD3 A;  2MJV B;  3UW9 A;  5BT3 A;  3O33 A;  4YH4 A;  5IID A;  3UVY A;  4NR6 A;  4YY4 A;  5EPR A;  4BJX A;  2OUO A;  4TT6 A;  5CTL A;  5H1T A;  5H85 A;  5FE5 A;  4UYF B;  4NR7 A;  4UYG A;  5FE8 A;  5BT5 A;  4MEO A;  4XUA A;  4A9O A;  5BT4 A;  5HFR A;  5D3J A;  4A9M A;  5LJ0 A;  5DYA A;  5CQA A;  5HJC A;  4CLB A;  5EVA A;  4ALH A;  5D24 A;  2DVS A;  5FFY A;  5JI8 A;  4PKL A;  1JSP B;  2E7O A;  4IR6 A;  5A85 A;  5C4Q A;  4QUT A;  3FKM X;  5CUE A;  5F36 A;  3NXB A;  4YYD A;  5CQ4 A;  5FFV A;  5FE6 A;  4LRG A;  3JVM A;  4CFK A;  3UVD A;  4NYW A;  5A7C A;  3G0J A;  4O7A A;  4ZW1 A;  4Z1S A;  4HBV A;  5FFW A;  5HCL A;  4TTE A;  5EPB A;  4YYI A;  5G4R A;  4Z6I A;  5JWM A;  5E9V A;  5LVQ A;  5L98 A;  4PY6 A;  5EPS A;  5E9M A;  5I29 A;  4TQN A;  5LUU A;  1N72 A;  4UIW A;  4NUC A;  4CUU A;  5DBM A;  5FE2 A;  4QBM A;  4N4H A;  3P1F A;  5FE4 A;  5E73 A;  4MR6 A;  4NR5 A;  5CQ8 A;  4QC3 A;  4O7F A;  4HBY A;  4QB3 A;  4QSP A;  5EIC A;  5FH7 A;  5CUB A;  3S91 A;  5D0C A;  2E3K A;  5FH6 A;  2R0V A;  2N9G A;  4XY8 A;  5CS8 A;  5DW1 A;  4Z1Q A;  4YY6 A;  5J0D A;  3QZT A;  3DWY A;  5EU1 A;  3P5O A;  4NRC A;  4IOQ A;  4BW3 A;  5EWW A;  4J3I A;  4Z6H A;  5FE9 A;  5K29 A;  4WIV A;  5KTW A;  5E3D A;  5I7Y A;  4UIY A;  4NRB A;  5F60 A;  2WP1 A;  3IU5 A;  5EP7 A;  4TU4 A;  1E6I A;  4MEP A;  4NUD A;  5CRZ A;  5FE3 A;  3O35 A;  5D3L A;  5HEL A;  4YYM A;  4QSS A;  3LQH A;  1EQF A;  4QEU A;  5E9L A;  2YYN A;  4TYL A;  5H1U A;  2FSA A;  5IGL A;  5HEN A;  5HQ5 A;  3ONI A;  3P1E A;  5HM0 A;  4O77 A;  4YYN A;  5CUD A;  3O36 A;  5I88 A;  3AAD A;  4YYH A;  5A5P A;  4IR3 A;  5DYX A;  5DKD A;  3UV2 A;  5D3P A;  5DYU A;  2NXB A;  4N4I A;  4XY9 A;  4N3W A;  2R0S A;  4MR3 A;  5II2 A;  5G4S A;  5AMF A;  2DVR A;  4YYG A;  3AQA A;  4Q0O A;  5DFB A;  5DFC A;  5CY9 A;  4LR6 A;  3U5L A;  5C7N A;  5A5S A;  5CUG A;  5E7D A;  4YYK A;  4QUU A;  4GPJ A;  1X0J A;  2RNW A;  4NUE A;  4O7E A;  2YEM A;  3SVF A;  5LVR A;  5F62 A;  5DLZ A;  4UYF A;  3U5M A;  5F2P A;  4HXO A;  5IG6 A;  4HXK A;  5EA1 A;  5DX4 A;  5EIS A;  5I86 A;  2G4A A;  5CQ7 A;  4UYH A;  2OO1 A;  5C85 A;  4UYE A;  3HME A;  4LYI A;  5D3T A;  5I1Q A;  4HBW A;  5A5Q A;  3SVH A;  4O75 A;  2YEL A;  5I7X A;  4YBT A;  4YH3 A;  5EWV A;  4QSR A;  5FDZ A;  2YW5 A;  5L8U A;  3K2J A;  4Z93 A;  4NYX A;  5ENF A;  2RNX A;  3MUK A;  5FBX A;  5AD2 A;  3UVW A;  1WUM A;  2GRC A;  4N4G A;  5E9Y A;  5FE0 A;  4YAD A;  2I8N A;  5C87 A;  4YBS A;  5CUC A;  5EGU A;  4QR3 A;  5LKT A;  4WHW A;  5ENH A;  5F1H A;  4A9I A;  5TCM A; 
#chains in the Genus database with same CATH topology
 5EWH A;  2DWW A;  2DVQ A;  2F6N A;  5D25 A;  4QZS A;  3UVX A;  5D3H A;  2R10 A;  3S92 A;  5A83 A;  4XUB A;  2RFJ A;  4QY4 A;  5F61 A;  4CL9 A;  5CU8 A;  4NR8 A;  4QST A;  4DON A;  4HXN A;  4QSX A;  4O7C A;  3VKH A;  2WP2 A;  4Q0N A;  4CUT A;  4AKN A;  4ALG A;  3ZYU A;  5I83 A;  4QR4 A;  5F1L A;  4UIT A;  4IR4 A;  1JM4 B;  4TZ8 A;  4UYD A;  4LZR A;  5IGN A;  5FB0 A;  4LDF A;  5HQ7 A;  3HMH A;  4KV4 A;  5CZG A;  5HRV A;  4CUS A;  5F5Z A;  4PCE A;  2KTB B;  4HXS A;  4LC2 A;  4YBM A;  5H1V A;  5KTX A;  4QYD A;  4A9L A;  2E7N A;  3GG3 A;  5E3G A;  2D9E A;  4HBX A;  4J0R A;  5I40 A;  3QZV A;  4CUQ A;  3RCW A;  4X2I A;  5FG6 A;  5C89 A;  5ENE A;  4WHU A;  2L5E A;  4QSW A;  4NYV A;  5FE7 A;  2RS9 B;  3LXJ A;  5D26 A;  5EV9 A;  4E96 A;  5HLS A;  4LYW A;  5HEM A;  4OGJ A;  5HFQ A;  3TLP A;  5L8T A;  4YAT A;  4UIX A;  4QR5 A;  4YK0 A;  5DLX A;  5A81 A;  5HRX A;  4NQM A;  4UIV A;  5DKH A;  3O37 A;  4AKI A;  5EK9 A;  5LJ2 A;  4PS5 A;  4NS5 A;  4O72 A;  4BW4 A;  4A9E A;  1ZS5 A;  3JVJ A;  3MUL A;  5DYC A;  2RI7 A;  5CQ3 A;  5D3N A;  5CQT A;  5D3S A;  5ENJ A;  5CGP A;  5EM3 A;  4LYS A;  5A5O A;  4OGI A;  3P1D A;  4CUR A;  4MEN A;  4QEW A;  4TT4 A;  5E0R A;  2D82 A;  5F3A A;  2YQD A;  4KCX A;  2F6J A;  4MR5 A;  2YEK A;  5LJ1 A;  5ETB A;  4O76 A;  5D7X A;  3LQI A;  1WUG A;  5C8G A;  5FH8 A;  4TZ2 A;  4A9J A;  1ZKR A;  4NQN A;  5LKX A;  2LSP B;  3DAI A;  4QSU A;  5ENG A;  4A9F A;  5ACY A;  4BW1 A;  3D7C A;  5F25 A;  5LKZ A;  3JVK A;  4QC1 A;  4CFL A;  3MB3 A;  4NXJ A;  4C67 A;  4F3I A;  4J1P A;  5LKU A;  2L85 A;  3QZS A;  3U5P A;  2RNY A;  4IOR A;  2R0Y A;  3LQJ A;  5A5N A;  5A82 A;  3U5N A;  5KHM A;  5TB6 A;  5EWC A;  5DW2 A;  4NRA A;  5DFD A;  5F63 A;  4HXR A;  4O71 A;  4BHW A;  5ENC A;  4MEQ A;  5HRW A;  5I89 A;  4PCI A;  3P1C A;  4LZS A;  5IGM A;  3JVL A;  5CRM A;  4TT2 A;  4J0S A;  5EQ1 A;  4HXL A;  4A9K A;  5CP5 A;  5L99 A;  2DAT A;  5CFW A;  3G0L A;  3HMF A;  4KV1 A;  5CQ5 A;  4QSQ A;  4IR5 A;  4NR9 A;  4YAB A;  5DY7 A;  4BW2 A;  5FG4 A;  5ENI A;  5D3R A;  4YYJ A;  5I80 A;  4ZQL A;  5E74 A;  4UIU A;  5CPE A;  3U5K A;  5FE1 A;  4RVR A;  4A9N A;  5E9I A;  5A5R A;  3U5J A;  5CUA A;  5AME A;  4C66 A;  4N4F A;  2DVV A;  4O78 A;  3SVG A;  4QSV A;  5ENB A;  3IU6 A;  5EWD A;  5HQ6 A;  3MB4 A;  5II1 A;  5IGK A;  5ETD A;  2YDW A;  5FG5 A;  4UIZ A;  3LJW A;  3MXF A;  4ZC9 A;  3Q2E A;  4HXM A;  5DKC A;  4O70 A;  4HXP A;  4MR4 A;  3UV4 A;  4OUF A;  4YC9 A;  4TU6 A;  2EJN A;  5KU3 A;  2RO1 A;  5CQ6 A;  2H60 A;  4CUP A;  4YAX A;  4NR4 A;  3U5O A;  5E9K A;  3I3J A;  2L84 A;  4Y03 A;  4XYA A;  2DKW A;  4O74 A;  5L96 A;  4PTB A;  4QYL A;  4QNS A;  1F68 A;  5EI4 A;  5IBN A;  4IOO A;  5KO4 A;  5FB1 A;  2OSS A;  3VKG A;  5COI A;  5KTU A;  4A9H A;  2I7K A;  4O7B A;  4QEV A;  4LZ2 A;  3Q2F A;  5L97 A;  3O34 A;  3UV5 A;  3MQM A;  4TS8 A;  4FLP A;  5AD3 A;  2MJV B;  3UW9 A;  5BT3 A;  3O33 A;  4YH4 A;  5IID A;  3UVY A;  4NR6 A;  4YY4 A;  5EPR A;  4BJX A;  2OUO A;  4TT6 A;  5CTL A;  5H1T A;  5H85 A;  5FE5 A;  4UYF B;  4NR7 A;  4UYG A;  5FE8 A;  5BT5 A;  4MEO A;  4XUA A;  4A9O A;  5BT4 A;  5HFR A;  5D3J A;  4A9M A;  5LJ0 A;  5DYA A;  5CQA A;  5HJC A;  4CLB A;  5EVA A;  4ALH A;  5D24 A;  2DVS A;  5FFY A;  5JI8 A;  4PKL A;  1JSP B;  2E7O A;  4IR6 A;  5A85 A;  5C4Q A;  4QUT A;  3FKM X;  5CUE A;  5F36 A;  3NXB A;  4YYD A;  5CQ4 A;  5FFV A;  5FE6 A;  4LRG A;  3JVM A;  4CFK A;  3UVD A;  4NYW A;  5A7C A;  3G0J A;  4O7A A;  4ZW1 A;  4Z1S A;  4HBV A;  5FFW A;  5HCL A;  4TTE A;  5EPB A;  4YYI A;  4AI6 A;  5G4R A;  4Z6I A;  5JWM A;  5E9V A;  5LVQ A;  3D1D A;  5L98 A;  4PY6 A;  5EPS A;  5E9M A;  5I29 A;  4TQN A;  5LUU A;  1N72 A;  4UIW A;  4NUC A;  4CUU A;  5DBM A;  5FE2 A;  4QBM A;  4N4H A;  3P1F A;  5FE4 A;  5E73 A;  4MR6 A;  4NR5 A;  5CQ8 A;  1PUO A;  4QC3 A;  4O7F A;  4HBY A;  4QB3 A;  4QSP A;  5EIC A;  5FH7 A;  5CUB A;  3S91 A;  5D0C A;  2E3K A;  5FH6 A;  2R0V A;  2N9G A;  4XY8 A;  5CS8 A;  5DW1 A;  4Z1Q A;  4YY6 A;  5J0D A;  3QZT A;  3DWY A;  5EU1 A;  3P5O A;  4NRC A;  4IOQ A;  4BW3 A;  5EWW A;  4J3I A;  4Z6H A;  5FE9 A;  5K29 A;  4WIV A;  5KTW A;  5E3D A;  5I7Y A;  4UIY A;  4NRB A;  5F60 A;  2WP1 A;  3IU5 A;  5EP7 A;  4TU4 A;  1E6I A;  4MEP A;  4NUD A;  5CRZ A;  5FE3 A;  3O35 A;  5D3L A;  5HEL A;  4YYM A;  4QSS A;  3LQH A;  1EQF A;  4QEU A;  5E9L A;  2YYN A;  4TYL A;  5H1U A;  2FSA A;  5IGL A;  5HEN A;  5HQ5 A;  3ONI A;  3P1E A;  5HM0 A;  4O77 A;  4YYN A;  5CUD A;  3O36 A;  5I88 A;  3AAD A;  4YYH A;  5A5P A;  4IR3 A;  5DYX A;  5DKD A;  3UV2 A;  5D3P A;  5DYU A;  2NXB A;  4N4I A;  4XY9 A;  4N3W A;  2R0S A;  4MR3 A;  5II2 A;  5G4S A;  5AMF A;  3D1B A;  2DVR A;  4YYG A;  3AQA A;  4Q0O A;  5DFB A;  5DFC A;  5CY9 A;  4LR6 A;  3U5L A;  5C7N A;  5A5S A;  5CUG A;  5E7D A;  4YYK A;  4QUU A;  4GPJ A;  1X0J A;  2RNW A;  4NUE A;  4O7E A;  2YEM A;  3SVF A;  5LVR A;  5F62 A;  5DLZ A;  4UYF A;  3U5M A;  5F2P A;  4HXO A;  5IG6 A;  4HXK A;  5EA1 A;  5DX4 A;  5EIS A;  5I86 A;  2G4A A;  5CQ7 A;  4UYH A;  2OO1 A;  5C85 A;  4UYE A;  3HME A;  4AKG A;  4LYI A;  5D3T A;  5I1Q A;  4HBW A;  5A5Q A;  3SVH A;  4O75 A;  4AKH A;  2YEL A;  5I7X A;  4YBT A;  4YH3 A;  5EWV A;  4QSR A;  5FDZ A;  2YW5 A;  5L8U A;  3K2J A;  4Z93 A;  4NYX A;  5ENF A;  2RNX A;  3MUK A;  5FBX A;  5AD2 A;  3UVW A;  1WUM A;  2GRC A;  4N4G A;  5E9Y A;  5FE0 A;  4YAD A;  2I8N A;  5C87 A;  4YBS A;  5CUC A;  3ERR A;  4QR3 A;  5EGU A;  5LKT A;  4WHW A;  5ENH A;  5F1H A;  4A9I A;  5TCM A; 
#chains in the Genus database with same CATH homology
 5EWH A;  2DWW A;  2DVQ A;  2F6N A;  5D25 A;  4QZS A;  3UVX A;  5D3H A;  2R10 A;  3S92 A;  5A83 A;  4XUB A;  2RFJ A;  4QY4 A;  5F61 A;  4CL9 A;  5CU8 A;  4NR8 A;  4QST A;  4DON A;  4HXN A;  4QSX A;  4O7C A;  2WP2 A;  4Q0N A;  4CUT A;  4AKN A;  4ALG A;  3ZYU A;  5I83 A;  4QR4 A;  5F1L A;  4UIT A;  4IR4 A;  1JM4 B;  4TZ8 A;  4UYD A;  4LZR A;  5IGN A;  5FB0 A;  4LDF A;  5HQ7 A;  3HMH A;  4KV4 A;  5CZG A;  5HRV A;  4CUS A;  5F5Z A;  4PCE A;  2KTB B;  4HXS A;  4LC2 A;  4YBM A;  5H1V A;  5KTX A;  4QYD A;  4A9L A;  2E7N A;  3GG3 A;  5E3G A;  2D9E A;  4HBX A;  4J0R A;  5I40 A;  3QZV A;  4CUQ A;  3RCW A;  4X2I A;  5FG6 A;  5C89 A;  5ENE A;  4WHU A;  2L5E A;  4QSW A;  4NYV A;  5FE7 A;  2RS9 B;  3LXJ A;  5D26 A;  5EV9 A;  4E96 A;  5HLS A;  4LYW A;  5HEM A;  4OGJ A;  5HFQ A;  3TLP A;  5L8T A;  4YAT A;  4UIX A;  4QR5 A;  4YK0 A;  5DLX A;  5A81 A;  5HRX A;  4NQM A;  4UIV A;  5DKH A;  3O37 A;  5EK9 A;  5LJ2 A;  4PS5 A;  4NS5 A;  4O72 A;  4BW4 A;  4A9E A;  1ZS5 A;  3JVJ A;  3MUL A;  5DYC A;  2RI7 A;  5CQ3 A;  5D3N A;  5CQT A;  5D3S A;  5ENJ A;  5CGP A;  5EM3 A;  4LYS A;  5A5O A;  4OGI A;  3P1D A;  4CUR A;  4MEN A;  4QEW A;  4TT4 A;  5E0R A;  2D82 A;  5F3A A;  2YQD A;  4KCX A;  2F6J A;  4MR5 A;  2YEK A;  5LJ1 A;  5ETB A;  4O76 A;  5D7X A;  3LQI A;  1WUG A;  5C8G A;  5FH8 A;  4TZ2 A;  4A9J A;  4NQN A;  5LKX A;  2LSP B;  3DAI A;  4QSU A;  5ENG A;  4A9F A;  5ACY A;  4BW1 A;  3D7C A;  5F25 A;  5LKZ A;  3JVK A;  4QC1 A;  4CFL A;  3MB3 A;  4NXJ A;  4C67 A;  4F3I A;  4J1P A;  5LKU A;  2L85 A;  3QZS A;  3U5P A;  2RNY A;  4IOR A;  2R0Y A;  3LQJ A;  5A5N A;  5A82 A;  3U5N A;  5KHM A;  5TB6 A;  5EWC A;  5DW2 A;  4NRA A;  5DFD A;  5F63 A;  4HXR A;  4O71 A;  4BHW A;  5ENC A;  4MEQ A;  5HRW A;  5I89 A;  4PCI A;  3P1C A;  4LZS A;  5IGM A;  3JVL A;  5CRM A;  4TT2 A;  4J0S A;  5EQ1 A;  4HXL A;  4A9K A;  5CP5 A;  5L99 A;  2DAT A;  5CFW A;  3G0L A;  3HMF A;  4KV1 A;  5CQ5 A;  4QSQ A;  4IR5 A;  4NR9 A;  4YAB A;  5DY7 A;  4BW2 A;  5FG4 A;  5ENI A;  5D3R A;  4YYJ A;  5I80 A;  4ZQL A;  5E74 A;  4UIU A;  5CPE A;  3U5K A;  5FE1 A;  4RVR A;  4A9N A;  5E9I A;  5A5R A;  3U5J A;  5CUA A;  5AME A;  4C66 A;  4N4F A;  2DVV A;  4O78 A;  3SVG A;  4QSV A;  5ENB A;  3IU6 A;  5EWD A;  5HQ6 A;  3MB4 A;  5II1 A;  5IGK A;  5ETD A;  2YDW A;  5FG5 A;  4UIZ A;  3LJW A;  3MXF A;  4ZC9 A;  3Q2E A;  4HXM A;  5DKC A;  4O70 A;  4HXP A;  4MR4 A;  3UV4 A;  4OUF A;  4YC9 A;  4TU6 A;  5KU3 A;  2RO1 A;  5CQ6 A;  2H60 A;  4CUP A;  4YAX A;  4NR4 A;  3U5O A;  5E9K A;  3I3J A;  2L84 A;  4Y03 A;  4XYA A;  2DKW A;  4O74 A;  5L96 A;  4PTB A;  4QYL A;  4QNS A;  1F68 A;  5EI4 A;  5IBN A;  4IOO A;  5KO4 A;  5FB1 A;  2OSS A;  5COI A;  5KTU A;  4A9H A;  2I7K A;  4O7B A;  4QEV A;  4LZ2 A;  3Q2F A;  5L97 A;  3O34 A;  3UV5 A;  3MQM A;  4TS8 A;  4FLP A;  5AD3 A;  2MJV B;  3UW9 A;  5BT3 A;  3O33 A;  4YH4 A;  5IID A;  3UVY A;  4NR6 A;  4YY4 A;  5EPR A;  4BJX A;  2OUO A;  4TT6 A;  5CTL A;  5H1T A;  5H85 A;  5FE5 A;  4UYF B;  4NR7 A;  4UYG A;  5FE8 A;  5BT5 A;  4MEO A;  4XUA A;  4A9O A;  5BT4 A;  5HFR A;  5D3J A;  4A9M A;  5LJ0 A;  5DYA A;  5CQA A;  5HJC A;  4CLB A;  5EVA A;  4ALH A;  5D24 A;  2DVS A;  5FFY A;  5JI8 A;  4PKL A;  1JSP B;  2E7O A;  4IR6 A;  5A85 A;  5C4Q A;  4QUT A;  3FKM X;  5CUE A;  5F36 A;  3NXB A;  4YYD A;  5CQ4 A;  5FFV A;  5FE6 A;  4LRG A;  3JVM A;  4CFK A;  3UVD A;  4NYW A;  5A7C A;  3G0J A;  4O7A A;  4ZW1 A;  4Z1S A;  4HBV A;  5FFW A;  5HCL A;  4TTE A;  5EPB A;  4YYI A;  5G4R A;  4Z6I A;  5JWM A;  5E9V A;  5LVQ A;  5L98 A;  4PY6 A;  5EPS A;  5E9M A;  5I29 A;  4TQN A;  5LUU A;  1N72 A;  4UIW A;  4NUC A;  4CUU A;  5DBM A;  5FE2 A;  4QBM A;  4N4H A;  3P1F A;  5FE4 A;  5E73 A;  4MR6 A;  4NR5 A;  5CQ8 A;  4QC3 A;  4O7F A;  4HBY A;  4QB3 A;  4QSP A;  5EIC A;  5FH7 A;  5CUB A;  3S91 A;  5D0C A;  2E3K A;  5FH6 A;  2R0V A;  2N9G A;  4XY8 A;  5CS8 A;  5DW1 A;  4Z1Q A;  4YY6 A;  5J0D A;  3QZT A;  3DWY A;  5EU1 A;  3P5O A;  4NRC A;  4IOQ A;  4BW3 A;  5EWW A;  4J3I A;  4Z6H A;  5FE9 A;  5K29 A;  4WIV A;  5KTW A;  5E3D A;  5I7Y A;  4UIY A;  4NRB A;  5F60 A;  2WP1 A;  3IU5 A;  5EP7 A;  4TU4 A;  1E6I A;  4MEP A;  4NUD A;  5CRZ A;  5FE3 A;  3O35 A;  5D3L A;  5HEL A;  4YYM A;  4QSS A;  3LQH A;  1EQF A;  4QEU A;  5E9L A;  2YYN A;  4TYL A;  5H1U A;  2FSA A;  5IGL A;  5HEN A;  5HQ5 A;  3ONI A;  3P1E A;  5HM0 A;  4O77 A;  4YYN A;  5CUD A;  3O36 A;  5I88 A;  3AAD A;  4YYH A;  5A5P A;  4IR3 A;  5DYX A;  5DKD A;  3UV2 A;  5D3P A;  5DYU A;  2NXB A;  4N4I A;  4XY9 A;  4N3W A;  2R0S A;  4MR3 A;  5II2 A;  5G4S A;  5AMF A;  2DVR A;  4YYG A;  3AQA A;  4Q0O A;  5DFB A;  5DFC A;  5CY9 A;  4LR6 A;  3U5L A;  5C7N A;  5A5S A;  5CUG A;  5E7D A;  4YYK A;  4QUU A;  4GPJ A;  1X0J A;  2RNW A;  4NUE A;  4O7E A;  2YEM A;  3SVF A;  5LVR A;  5F62 A;  5DLZ A;  4UYF A;  3U5M A;  5F2P A;  4HXO A;  5IG6 A;  4HXK A;  5EA1 A;  5DX4 A;  5EIS A;  5I86 A;  2G4A A;  5CQ7 A;  4UYH A;  2OO1 A;  5C85 A;  4UYE A;  3HME A;  4LYI A;  5D3T A;  5I1Q A;  4HBW A;  5A5Q A;  3SVH A;  4O75 A;  2YEL A;  5I7X A;  4YBT A;  4YH3 A;  5EWV A;  4QSR A;  5FDZ A;  2YW5 A;  5L8U A;  3K2J A;  4Z93 A;  4NYX A;  5ENF A;  2RNX A;  3MUK A;  5FBX A;  5AD2 A;  3UVW A;  1WUM A;  2GRC A;  4N4G A;  5E9Y A;  5FE0 A;  4YAD A;  2I8N A;  5C87 A;  4YBS A;  5CUC A;  5EGU A;  4QR3 A;  5LKT A;  4WHW A;  5ENH A;  5F1H A;  4A9I A;  5TCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...