4LDFA

Crystal structure of cpbrd2 from cryptosporidium, cgd3_3190
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
107
structure length
107
Chain Sequence
KVDLSMNDQIWQLLDTLSRHENAWPFRKPVSIGEASDYYEIIKEPTDIQTMKRKAKNKEYKTLSEFSSELKRMFDNCRFYNAKNTIYTKYANQLEAFIWPMLQTIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GCN5 like acetylase + bromodomain
publication title Crystal Structure of CpBRD2 from cryptosporidium, cgd3_3190
rcsb
source organism Cryptosporidium parvum
total genus 42
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ldfA00
5HLSA 2RNYA 3P1DA 4NYWA 4HBXA 5A81A 4PCIA 2YW5A 4IOQA 4CUSA 5D3RA 5HQ6A 5C4QA 4LZRA 3JVJA 4C66A 4O76A 4TU6A 5DYAA 5E9MA 4QSWA 4NRCA 4J3IA 4XYAA 5A5PA 5FH7A 5EWVA 5FE1A 5FE8A 4TTEA 4CUPA 4A9MA 5I83A 4LZSA 3Q2EA 5G4RA 5F2PA 3O37A 5EICA 5CQ6A 4NS5A 5BT5A 5ENFA 5AMFA 3U5MA 5AMEA 3JVKA 4ZW1A 5EWDA 5ENEA 2WP1A 4RVRA 5DYCA 2RNXA 4CL9A 4O72A 5I7XA 4NYXA 2OSSA 5KO4A 4UYHA 3UVDA 5I1QA 2L5EA 5A5SA 4CFKA 5AD2A 5CQ8A 4NYVA 5KU3A 4PS5A 5HQ5A 3MXFA 4YY4A 5H1UA 5A82A 5F25A 4TT2A 5FFYA 4A9IA 2OO1A 4WHUA 5HJCA 3QZTA 2DKWA 3IU5A 5ENHA 4NR5A 5I88A 4CLBA 5K29A 4QSTA 3HMFA 5TCMA 4NUCA 4O7CA 4HBYA 4YBTA 1EQFA 4BW2A 4N4FA 4NRBA 2R0VA 5DW1A 4YYDA 3U5KA 5I29A 4Z6IA 4NR4A 5E3DA 5KTWA 1X0JA 1JM4B 4YBMA 5D3NA 4LC2A 4Z93A 5CY9A 4UITA 5HFRA 5FFWA 5CPEA 5DLZA 5DKCA 5DYUA 2DVRA 4NR8A 5CUGA 5C89A 5DFCA 4HXPA 5FE7A 5DYXA 5CQ7A 2RI7A 2DVSA 4TYLA 5E3GA 4YADA 2RNWA 4QSSA 4MR6A 4Z6HA 4QB3A 5EQ1A 2R0SA 2LSPB 2WP2A 2MJVB 5FE5A 3P5OA 4YATA 4A9EA 4WIVA 4NUEA 5L8TA 3P1EA 5D26A 2DVVA 5EU1A 4HBVA 1WUMA 5EA1A 4CUUA 3U5JA 3ONIA 4TQNA 2KTBB 3K2JA 4O75A 5EPRA 4ZC9A 4IOOA 4O78A 5EISA 5F61A 4QY4A 4ALGA 2NXBA 4NQMA 5CTLA 5D3JA 4KV4A 4QR4A 5A5OA 5A5RA 4CUTA 5F3AA 3UVYA 5CUDA 4YYGA 2E7OA 4QEUA 3UV2A 5COIA 4E96A 4X2IA 5EWHA 5A83A 5LJ1A 4YK0A 4NR6A 4QUUA 3TLPA 5KTUA 4QEVA 3UV4A 5DLXA 4J1PA 5LKXA 5D3SA 4A9FA 3AQAA 4HXOA 3JVLA 4KV1A 4YYMA 5LUUA 4UIVA 3GG3A 3JVMA 5CS8A 5EWWA 5FE2A 2YDWA 5I86A 3HMHA 5CUBA 5D3LA 5CFWA 4J0SA 3U5OA 4NUDA 5DW2A 5BT4A 5ACYA 5LKTA 4QSRA 5I40A 5FH8A 1JSPB 5E73A 4QUTA 5JWMA 5G4SA 4QBMA 3U5LA 4QYDA 1ZS5A 5ENIA 2N9GA 3O36A 5FE6A 5IGLA 5D24A 5A85A 5CQ5A 3HMEA 5ENBA 4MEOA 4NR9A 2RO1A 2YEKA 3QZVA 4Y03A 5L99A 5II2A 5D3PA 4A9KA 3O35A 5E9VA 3UVWA 3U5PA 5IIDA 4HXMA 5E9YA 4OGJA 4N4IA 4O77A 5LKUA 3S92A 5I7YA 4YYHA 4O7FA 5BT3A 4XUBA 5D0CA 4FLPA 3SVHA 5JI8A 3IU6A 5IGKA 5F60A 4NQNA 4YH3A 5FG5A 5LJ0A 5LKZA 4XUAA 4XY9A 4TT6A 3I3JA 3DWYA 3P1CA 4QNSA 5IG6A 3LJWA 4TU4A 5CQ3A 5E0RA 5FB0A 5H1TA 4UIUA 5II1A 4N4GA 2YELA 3G0LA 3UW9A 5DKDA 4IORA 1E6IA 3QZSA 4O71A 5DBMA 4HXNA 5E9IA 5DFBA 5F63A 2D9EA 4IR6A 4TZ8A 2E7NA 4QSPA 2OUOA 4J0RA 4LYWA 4MENA 5EM3A 5A7CA 4QR3A 2F6NA 4UIYA 4TZ2A 5EPSA 5A5NA 5C85A 4UYDA 4BW1A 4OUFA 5CQ4A 5CUEA 4XY8A 4C67A 4QR5A 4PTBA 4A9NA 4HXKA 4TT4A 5ENGA 4QYLA 4QC1A 4Z1QA 5A5QA 3Q2FA 4O7AA 5CUAA 3O34A 5I80A 2E3KA 3MB4A 5FE3A 2FSAA 5TB6A 3NXBA 4MR4A 5F36A 3SVGA 4OGIA 4YH4A 3ZYUA 4YABA 4CFLA 5IGNA 5EWCA 5ETBA 5L8UA 4A9OA 5CGPA 5KTXA 5HQ7A 5L97A 4YYKA 5ENJA 2DVQA 2GRCA 4MEQA 4MR5A 4UYGA 5EK9A 2RS9B 4A9JA 5L96A 5CZGA 5FG6A 5HELA 3D7CA 5C7NA 5DKHA 4NRAA 5C87A 4IR3A 5E9KA 2DWWA 4NXJA 4QSVA 5LVQA 5EP7A 4O74A 4HXRA 5CP5A 4NR7A 2RFJA 5H1VA 5FFVA 5ETDA 5CRZA 5HRVA 4O70A 4N3WA 2I7KA 3MB3A 4KCXA 3S91A 5E7DA 5CQAA 3U5NA 4LZ2A 4BHWA 5E9LA 4YC9A 4CURA 4BJXA 5KHMA 5FE9A 3SVFA 5I89A 4ZQLA 3LQHA 4UYEA 4A9HA 5F1LA 3LQIA 5L98A 5IBNA 5HCLA 5D25A 2L84A 4LYIA 5EV9A 4PCEA 4Z1SA 4ALHA 5LVRA 5F1HA 5FDZA 5E74A 4DONA 2YQDA 5D3TA 2R10A 2G4AA 5EVAA 5FB1A 4YY6A 2F6JA 4YBSA 3UV5A 3AADA 5F62A 4LYSA 2R0YA 5FE0A 5J0DA 5CQTA 3UVXA 4AKNA 5H85A 4IR5A 5LJ2A 4PKLA 4LDFA 4QEWA 5HFQA 5CU8A 2I8NA 5EPBA 4TS8A 5HENA 4QC3A 2DATA 5EGUA 1N72A 4HXLA 4QSXA 4O7BA 4HXSA 5F5ZA 4LRGA 4UIXA 4O7EA 5D7XA 4MR3A 5FG4A 3MQMA 4QZSA 2H60A 3MULA 4HBWA 3FKMX 5CRMA 4QSUA 4QSQA 5AD3A 3LXJA 5IGMA 5HEMA 2YEMA 5HM0A 4YAXA 2YYNA 3P1FA 4GPJA 4UYFB 4Q0OA 5EI4A 5FE4A 4BW3A 1F68A 4CUQA 5FBXA 2D82A 3O33A 5C8GA 2L85A 5DX4A 4F3IA 4YYNA 4Q0NA 3DAIA 4UYFA 4N4HA 5DY7A 4YYJA 3MUKA 1WUGA 4A9LA 3RCWA 4MEPA 5FH6A 4WHWA 3LQJA 5CUCA 5ENCA 4IR4A 3G0JA 4LR6A 4UIWA 4UIZA 5HRWA 5HRXA 4BW4A 5D3HA 4PY6A 5DFDA 4YYIA
chains in the Genus database with same CATH superfamily
3ERRA 5HLSA 2RNYA 3P1DA 4NYWA 4HBXA 5A81A 4PCIA 2YW5A 4IOQA 4CUSA 5D3RA 5HQ6A 5C4QA 4LZRA 3JVJA 4C66A 4O76A 4TU6A 5DYAA 5E9MA 4QSWA 4NRCA 4J3IA 4XYAA 5A5PA 5FH7A 5EWVA 5FE1A 5FE8A 4TTEA 4CUPA 4A9MA 5I83A 4LZSA 3Q2EA 5G4RA 5F2PA 3O37A 5EICA 5CQ6A 4NS5A 1PUOA 5BT5A 5ENFA 5AMFA 3U5MA 5AMEA 3JVKA 4ZW1A 5EWDA 5ENEA 2WP1A 4RVRA 5DYCA 2RNXA 4CL9A 4O72A 5I7XA 4NYXA 2OSSA 5KO4A 4UYHA 3UVDA 5I1QA 2L5EA 5A5SA 4CFKA 5AD2A 5CQ8A 4NYVA 5KU3A 4PS5A 5HQ5A 3MXFA 4YY4A 5H1UA 5A82A 5F25A 4TT2A 5FFYA 4A9IA 2OO1A 4WHUA 5HJCA 3QZTA 2DKWA 3IU5A 5ENHA 4AKGA 4NR5A 5I88A 4CLBA 5K29A 4QSTA 3HMFA 5TCMA 4NUCA 4O7CA 4HBYA 4YBTA 1EQFA 4BW2A 4N4FA 4NRBA 2R0VA 5DW1A 4YYDA 3U5KA 5I29A 4Z6IA 4NR4A 5E3DA 5KTWA 1X0JA 1JM4B 4YBMA 5D3NA 4LC2A 4Z93A 5CY9A 4UITA 5HFRA 5FFWA 5CPEA 5DLZA 2EJNA 5DKCA 5DYUA 2DVRA 4NR8A 5CUGA 5C89A 5DFCA 4HXPA 5FE7A 5DYXA 5CQ7A 2RI7A 2DVSA 4TYLA 5E3GA 4YADA 2RNWA 4QSSA 4MR6A 4Z6HA 4QB3A 4AKIA 5EQ1A 2R0SA 2LSPB 2WP2A 2MJVB 5FE5A 3P5OA 4YATA 4A9EA 4WIVA 4NUEA 5L8TA 3P1EA 5D26A 2DVVA 5EU1A 4HBVA 1WUMA 5EA1A 4CUUA 3VKGA 3U5JA 3ONIA 4TQNA 2KTBB 3K2JA 4O75A 5EPRA 4ZC9A 4IOOA 4O78A 5EISA 5F61A 4QY4A 4ALGA 2NXBA 4NQMA 5CTLA 5D3JA 4KV4A 4QR4A 5A5OA 5A5RA 4CUTA 5F3AA 3UVYA 5CUDA 4YYGA 2E7OA 4QEUA 3UV2A 5COIA 4E96A 4X2IA 5EWHA 5A83A 5LJ1A 4YK0A 4NR6A 4QUUA 3TLPA 5KTUA 4QEVA 3UV4A 5DLXA 4J1PA 5LKXA 5D3SA 4A9FA 3AQAA 4HXOA 3JVLA 4KV1A 4YYMA 5LUUA 4UIVA 3GG3A 3JVMA 5CS8A 5EWWA 5FE2A 2YDWA 5I86A 3HMHA 5CUBA 5D3LA 5CFWA 4J0SA 3U5OA 4NUDA 5DW2A 5BT4A 5ACYA 5LKTA 4QSRA 5I40A 5FH8A 1JSPB 5E73A 4QUTA 5JWMA 5G4SA 4QBMA 3U5LA 4QYDA 1ZS5A 5ENIA 2N9GA 3O36A 5FE6A 5IGLA 5D24A 5A85A 5CQ5A 3HMEA 5ENBA 4MEOA 4NR9A 2RO1A 2YEKA 3QZVA 4Y03A 5L99A 5II2A 5D3PA 4A9KA 3O35A 5E9VA 3UVWA 3U5PA 5IIDA 4HXMA 5E9YA 4OGJA 4N4IA 4O77A 5LKUA 3S92A 5I7YA 4YYHA 4O7FA 5BT3A 4XUBA 5D0CA 4FLPA 3SVHA 5JI8A 3IU6A 5IGKA 5F60A 4NQNA 4YH3A 5FG5A 5LJ0A 5LKZA 4XUAA 4XY9A 4TT6A 3I3JA 3DWYA 3P1CA 4QNSA 5IG6A 3LJWA 4TU4A 5CQ3A 5E0RA 5FB0A 5H1TA 4UIUA 5II1A 4N4GA 2YELA 3G0LA 3UW9A 5DKDA 4IORA 1E6IA 3QZSA 4O71A 5DBMA 4HXNA 5E9IA 5DFBA 5F63A 2D9EA 3D1DA 4IR6A 4TZ8A 2E7NA 4QSPA 2OUOA 4J0RA 4LYWA 4MENA 5EM3A 5A7CA 4QR3A 2F6NA 4UIYA 4TZ2A 5EPSA 5A5NA 5C85A 4UYDA 4BW1A 4OUFA 5CQ4A 5CUEA 4XY8A 4C67A 4QR5A 4PTBA 4A9NA 4HXKA 4TT4A 5ENGA 4QYLA 4QC1A 4Z1QA 5A5QA 3Q2FA 4O7AA 5CUAA 3O34A 5I80A 2E3KA 3MB4A 5FE3A 2FSAA 5TB6A 3NXBA 4MR4A 5F36A 3SVGA 4OGIA 4YH4A 3ZYUA 4YABA 4CFLA 5IGNA 5EWCA 5ETBA 5L8UA 4A9OA 5CGPA 5KTXA 5HQ7A 5L97A 4YYKA 5ENJA 2DVQA 2GRCA 4MEQA 4MR5A 4UYGA 5EK9A 2RS9B 4A9JA 5L96A 5CZGA 5FG6A 5HELA 3D7CA 5C7NA 5DKHA 4NRAA 5C87A 4IR3A 5E9KA 2DWWA 4NXJA 4QSVA 5LVQA 5EP7A 4O74A 4HXRA 5CP5A 4NR7A 2RFJA 5H1VA 5FFVA 5ETDA 5CRZA 5HRVA 4O70A 4N3WA 2I7KA 3MB3A 4KCXA 3S91A 5E7DA 5CQAA 3U5NA 4LZ2A 4BHWA 5E9LA 4YC9A 4CURA 4BJXA 5KHMA 5FE9A 3SVFA 5I89A 4ZQLA 3LQHA 4UYEA 4A9HA 5F1LA 3LQIA 5L98A 5IBNA 5HCLA 5D25A 2L84A 4LYIA 5EV9A 4PCEA 4Z1SA 4ALHA 5LVRA 5F1HA 5FDZA 5E74A 4DONA 2YQDA 5D3TA 2R10A 2G4AA 5EVAA 5FB1A 4YY6A 2F6JA 4YBSA 3UV5A 3AADA 4AKHA 5F62A 4LYSA 2R0YA 5FE0A 5J0DA 5CQTA 3UVXA 4AKNA 5H85A 4IR5A 5LJ2A 4PKLA 4LDFA 4QEWA 5HFQA 5CU8A 2I8NA 5EPBA 4TS8A 5HENA 4QC3A 2DATA 5EGUA 1N72A 4HXLA 4QSXA 3D1BA 4O7BA 4HXSA 3VKHA 5F5ZA 4LRGA 4UIXA 4O7EA 5D7XA 4MR3A 5FG4A 3MQMA 4AI6A 4QZSA 2H60A 3MULA 4HBWA 3FKMX 5CRMA 4QSUA 4QSQA 5AD3A 3LXJA 5IGMA 5HEMA 2YEMA 5HM0A 1ZKRA 4YAXA 2YYNA 3P1FA 4GPJA 4UYFB 4Q0OA 5EI4A 5FE4A 4BW3A 1F68A 4CUQA 5FBXA 2D82A 3O33A 5C8GA 2L85A 5DX4A 4F3IA 4YYNA 4Q0NA 3DAIA 4UYFA 4N4HA 5DY7A 4YYJA 3MUKA 1WUGA 4A9LA 3RCWA 4MEPA 5FH6A 4WHWA 3LQJA 5CUCA 5ENCA 4IR4A 3G0JA 4LR6A 4UIWA 4UIZA 5HRWA 5HRXA 4BW4A 5D3HA 4PY6A 5DFDA 4YYIA
chains in the Genus database with same CATH topology
5HLSA 2RNYA 3P1DA 4NYWA 4HBXA 5A81A 4PCIA 2YW5A 4IOQA 4CUSA 5D3RA 5HQ6A 5C4QA 4LZRA 3JVJA 4C66A 4O76A 4TU6A 5DYAA 5E9MA 4QSWA 4NRCA 4J3IA 4XYAA 5A5PA 5FH7A 5EWVA 5FE1A 5FE8A 4TTEA 4CUPA 4A9MA 5I83A 4LZSA 3Q2EA 5G4RA 5F2PA 3O37A 5EICA 5CQ6A 4NS5A 5BT5A 5ENFA 5AMFA 3U5MA 5AMEA 3JVKA 4ZW1A 5EWDA 5ENEA 2WP1A 4RVRA 5DYCA 2RNXA 4CL9A 4O72A 5I7XA 4NYXA 2OSSA 5KO4A 4UYHA 3UVDA 5I1QA 2L5EA 5A5SA 4CFKA 5AD2A 5CQ8A 4NYVA 5KU3A 4PS5A 5HQ5A 3MXFA 4YY4A 5H1UA 5A82A 5F25A 4TT2A 5FFYA 4A9IA 2OO1A 4WHUA 5HJCA 3QZTA 2DKWA 3IU5A 5ENHA 4NR5A 5I88A 4CLBA 5K29A 4QSTA 3HMFA 5TCMA 4NUCA 4O7CA 4HBYA 4YBTA 1EQFA 4BW2A 4N4FA 4NRBA 2R0VA 5DW1A 4YYDA 3U5KA 5I29A 4Z6IA 4NR4A 5E3DA 5KTWA 1X0JA 1JM4B 4YBMA 5D3NA 4LC2A 4Z93A 5CY9A 4UITA 5HFRA 5FFWA 5CPEA 5DLZA 5DKCA 5DYUA 2DVRA 4NR8A 5CUGA 5C89A 5DFCA 4HXPA 5FE7A 5DYXA 5CQ7A 2RI7A 2DVSA 4TYLA 5E3GA 4YADA 2RNWA 4QSSA 4MR6A 4Z6HA 4QB3A 5EQ1A 2R0SA 2LSPB 2WP2A 2MJVB 5FE5A 3P5OA 4YATA 4A9EA 4WIVA 4NUEA 5L8TA 3P1EA 5D26A 2DVVA 5EU1A 4HBVA 1WUMA 5EA1A 4CUUA 3U5JA 3ONIA 4TQNA 2KTBB 3K2JA 4O75A 5EPRA 4ZC9A 4IOOA 4O78A 5EISA 5F61A 4QY4A 4ALGA 2NXBA 4NQMA 5CTLA 5D3JA 4KV4A 4QR4A 5A5OA 5A5RA 4CUTA 5F3AA 3UVYA 5CUDA 4YYGA 2E7OA 4QEUA 3UV2A 5COIA 4E96A 4X2IA 5EWHA 5A83A 5LJ1A 4YK0A 4NR6A 4QUUA 3TLPA 5KTUA 4QEVA 3UV4A 5DLXA 4J1PA 5LKXA 5D3SA 4A9FA 3AQAA 4HXOA 3JVLA 4KV1A 4YYMA 5LUUA 4UIVA 3GG3A 3JVMA 5CS8A 5EWWA 5FE2A 2YDWA 5I86A 3HMHA 5CUBA 5D3LA 5CFWA 4J0SA 3U5OA 4NUDA 5DW2A 5BT4A 5ACYA 5LKTA 4QSRA 5I40A 5FH8A 1JSPB 5E73A 4QUTA 5JWMA 5G4SA 4QBMA 3U5LA 4QYDA 1ZS5A 5ENIA 2N9GA 3O36A 5FE6A 5IGLA 5D24A 5A85A 5CQ5A 3HMEA 5ENBA 4MEOA 4NR9A 2RO1A 2YEKA 3QZVA 4Y03A 5L99A 5II2A 5D3PA 4A9KA 3O35A 5E9VA 3UVWA 3U5PA 5IIDA 4HXMA 5E9YA 4OGJA 4N4IA 4O77A 5LKUA 3S92A 5I7YA 4YYHA 4O7FA 5BT3A 4XUBA 5D0CA 4FLPA 3SVHA 5JI8A 3IU6A 5IGKA 5F60A 4NQNA 4YH3A 5FG5A 5LJ0A 5LKZA 4XUAA 4XY9A 4TT6A 3I3JA 3DWYA 3P1CA 4QNSA 5IG6A 3LJWA 4TU4A 5CQ3A 5E0RA 5FB0A 5H1TA 4UIUA 5II1A 4N4GA 2YELA 3G0LA 3UW9A 5DKDA 4IORA 1E6IA 3QZSA 4O71A 5DBMA 4HXNA 5E9IA 5DFBA 5F63A 2D9EA 4IR6A 4TZ8A 2E7NA 4QSPA 2OUOA 4J0RA 4LYWA 4MENA 5EM3A 5A7CA 4QR3A 2F6NA 4UIYA 4TZ2A 5EPSA 5A5NA 5C85A 4UYDA 4BW1A 4OUFA 5CQ4A 5CUEA 4XY8A 4C67A 4QR5A 4PTBA 4A9NA 4HXKA 4TT4A 5ENGA 4QYLA 4QC1A 4Z1QA 5A5QA 3Q2FA 4O7AA 5CUAA 3O34A 5I80A 2E3KA 3MB4A 5FE3A 2FSAA 5TB6A 3NXBA 4MR4A 5F36A 3SVGA 4OGIA 4YH4A 3ZYUA 4YABA 4CFLA 5IGNA 5EWCA 5ETBA 5L8UA 4A9OA 5CGPA 5KTXA 5HQ7A 5L97A 4YYKA 5ENJA 2DVQA 2GRCA 4MEQA 4MR5A 4UYGA 5EK9A 2RS9B 4A9JA 5L96A 5CZGA 5FG6A 5HELA 3D7CA 5C7NA 5DKHA 4NRAA 5C87A 4IR3A 5E9KA 2DWWA 4NXJA 4QSVA 5LVQA 5EP7A 4O74A 4HXRA 5CP5A 4NR7A 2RFJA 5H1VA 5FFVA 5ETDA 5CRZA 5HRVA 4O70A 4N3WA 2I7KA 3MB3A 4KCXA 3S91A 5E7DA 5CQAA 3U5NA 4LZ2A 4BHWA 5E9LA 4YC9A 4CURA 4BJXA 5KHMA 5FE9A 3SVFA 5I89A 4ZQLA 3LQHA 4UYEA 4A9HA 5F1LA 3LQIA 5L98A 5IBNA 5HCLA 5D25A 2L84A 4LYIA 5EV9A 4PCEA 4Z1SA 4ALHA 5LVRA 5F1HA 5FDZA 5E74A 4DONA 2YQDA 5D3TA 2R10A 2G4AA 5EVAA 5FB1A 4YY6A 2F6JA 4YBSA 3UV5A 3AADA 5F62A 4LYSA 2R0YA 5FE0A 5J0DA 5CQTA 3UVXA 4AKNA 5H85A 4IR5A 5LJ2A 4PKLA 4LDFA 4QEWA 5HFQA 5CU8A 2I8NA 5EPBA 4TS8A 5HENA 4QC3A 2DATA 5EGUA 1N72A 4HXLA 4QSXA 4O7BA 4HXSA 5F5ZA 4LRGA 4UIXA 4O7EA 5D7XA 4MR3A 5FG4A 3MQMA 4QZSA 2H60A 3MULA 4HBWA 3FKMX 5CRMA 4QSUA 4QSQA 5AD3A 3LXJA 5IGMA 5HEMA 2YEMA 5HM0A 4YAXA 2YYNA 3P1FA 4GPJA 4UYFB 4Q0OA 5EI4A 5FE4A 4BW3A 1F68A 4CUQA 5FBXA 2D82A 3O33A 5C8GA 2L85A 5DX4A 4F3IA 4YYNA 4Q0NA 3DAIA 4UYFA 4N4HA 5DY7A 4YYJA 3MUKA 1WUGA 4A9LA 3RCWA 4MEPA 5FH6A 4WHWA 3LQJA 5CUCA 5ENCA 4IR4A 3G0JA 4LR6A 4UIWA 4UIZA 5HRWA 5HRXA 4BW4A 5D3HA 4PY6A 5DFDA 4YYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLS A;  2RNY A;  3P1D A;  4NYW A;  4HBX A;  5A81 A;  4PCI A;  2YW5 A;  4IOQ A;  4CUS A;  5D3R A;  5HQ6 A;  5C4Q A;  4LZR A;  3JVJ A;  4C66 A;  4O76 A;  4TU6 A;  5DYA A;  5E9M A;  4QSW A;  4NRC A;  4J3I A;  4XYA A;  5A5P A;  5FH7 A;  5EWV A;  5FE1 A;  5FE8 A;  4TTE A;  4CUP A;  4A9M A;  5I83 A;  4LZS A;  3Q2E A;  5G4R A;  5F2P A;  3O37 A;  5EIC A;  5CQ6 A;  4NS5 A;  5BT5 A;  5ENF A;  5AMF A;  3U5M A;  5AME A;  3JVK A;  4ZW1 A;  5EWD A;  5ENE A;  2WP1 A;  4RVR A;  5DYC A;  2RNX A;  4CL9 A;  4O72 A;  5I7X A;  4NYX A;  2OSS A;  5KO4 A;  4UYH A;  3UVD A;  5I1Q A;  2L5E A;  5A5S A;  4CFK A;  5AD2 A;  5CQ8 A;  4NYV A;  5KU3 A;  4PS5 A;  5HQ5 A;  3MXF A;  4YY4 A;  5H1U A;  5A82 A;  5F25 A;  4TT2 A;  5FFY A;  4A9I A;  2OO1 A;  4WHU A;  5HJC A;  3QZT A;  2DKW A;  3IU5 A;  5ENH A;  4NR5 A;  5I88 A;  4CLB A;  5K29 A;  4QST A;  3HMF A;  5TCM A;  4NUC A;  4O7C A;  4HBY A;  4YBT A;  1EQF A;  4BW2 A;  4N4F A;  4NRB A;  2R0V A;  5DW1 A;  4YYD A;  3U5K A;  5I29 A;  4Z6I A;  4NR4 A;  5E3D A;  5KTW A;  1X0J A;  1JM4 B;  4YBM A;  5D3N A;  4LC2 A;  4Z93 A;  5CY9 A;  4UIT A;  5HFR A;  5FFW A;  5CPE A;  5DLZ A;  5DKC A;  5DYU A;  2DVR A;  4NR8 A;  5CUG A;  5C89 A;  5DFC A;  4HXP A;  5FE7 A;  5DYX A;  5CQ7 A;  2RI7 A;  2DVS A;  4TYL A;  5E3G A;  4YAD A;  2RNW A;  4QSS A;  4MR6 A;  4Z6H A;  4QB3 A;  5EQ1 A;  2R0S A;  2LSP B;  2WP2 A;  2MJV B;  5FE5 A;  3P5O A;  4YAT A;  4A9E A;  4WIV A;  4NUE A;  5L8T A;  3P1E A;  5D26 A;  2DVV A;  5EU1 A;  4HBV A;  1WUM A;  5EA1 A;  4CUU A;  3U5J A;  3ONI A;  4TQN A;  2KTB B;  3K2J A;  4O75 A;  5EPR A;  4ZC9 A;  4IOO A;  4O78 A;  5EIS A;  5F61 A;  4QY4 A;  4ALG A;  2NXB A;  4NQM A;  5CTL A;  5D3J A;  4KV4 A;  4QR4 A;  5A5O A;  5A5R A;  4CUT A;  5F3A A;  3UVY A;  5CUD A;  4YYG A;  2E7O A;  4QEU A;  3UV2 A;  5COI A;  4E96 A;  4X2I A;  5EWH A;  5A83 A;  5LJ1 A;  4YK0 A;  4NR6 A;  4QUU A;  3TLP A;  5KTU A;  4QEV A;  3UV4 A;  5DLX A;  4J1P A;  5LKX A;  5D3S A;  4A9F A;  3AQA A;  4HXO A;  3JVL A;  4KV1 A;  4YYM A;  5LUU A;  4UIV A;  3GG3 A;  3JVM A;  5CS8 A;  5EWW A;  5FE2 A;  2YDW A;  5I86 A;  3HMH A;  5CUB A;  5D3L A;  5CFW A;  4J0S A;  3U5O A;  4NUD A;  5DW2 A;  5BT4 A;  5ACY A;  5LKT A;  4QSR A;  5I40 A;  5FH8 A;  1JSP B;  5E73 A;  4QUT A;  5JWM A;  5G4S A;  4QBM A;  3U5L A;  4QYD A;  1ZS5 A;  5ENI A;  2N9G A;  3O36 A;  5FE6 A;  5IGL A;  5D24 A;  5A85 A;  5CQ5 A;  3HME A;  5ENB A;  4MEO A;  4NR9 A;  2RO1 A;  2YEK A;  3QZV A;  4Y03 A;  5L99 A;  5II2 A;  5D3P A;  4A9K A;  3O35 A;  5E9V A;  3UVW A;  3U5P A;  5IID A;  4HXM A;  5E9Y A;  4OGJ A;  4N4I A;  4O77 A;  5LKU A;  3S92 A;  5I7Y A;  4YYH A;  4O7F A;  5BT3 A;  4XUB A;  5D0C A;  4FLP A;  3SVH A;  5JI8 A;  3IU6 A;  5IGK A;  5F60 A;  4NQN A;  4YH3 A;  5FG5 A;  5LJ0 A;  5LKZ A;  4XUA A;  4XY9 A;  4TT6 A;  3I3J A;  3DWY A;  3P1C A;  4QNS A;  5IG6 A;  3LJW A;  4TU4 A;  5CQ3 A;  5E0R A;  5FB0 A;  5H1T A;  4UIU A;  5II1 A;  4N4G A;  2YEL A;  3G0L A;  3UW9 A;  5DKD A;  4IOR A;  1E6I A;  3QZS A;  4O71 A;  5DBM A;  4HXN A;  5E9I A;  5DFB A;  5F63 A;  2D9E A;  4IR6 A;  4TZ8 A;  2E7N A;  4QSP A;  2OUO A;  4J0R A;  4LYW A;  4MEN A;  5EM3 A;  5A7C A;  4QR3 A;  2F6N A;  4UIY A;  4TZ2 A;  5EPS A;  5A5N A;  5C85 A;  4UYD A;  4BW1 A;  4OUF A;  5CQ4 A;  5CUE A;  4XY8 A;  4C67 A;  4QR5 A;  4PTB A;  4A9N A;  4HXK A;  4TT4 A;  5ENG A;  4QYL A;  4QC1 A;  4Z1Q A;  5A5Q A;  3Q2F A;  4O7A A;  5CUA A;  3O34 A;  5I80 A;  2E3K A;  3MB4 A;  5FE3 A;  2FSA A;  5TB6 A;  3NXB A;  4MR4 A;  5F36 A;  3SVG A;  4OGI A;  4YH4 A;  3ZYU A;  4YAB A;  4CFL A;  5IGN A;  5EWC A;  5ETB A;  5L8U A;  4A9O A;  5CGP A;  5KTX A;  5HQ7 A;  5L97 A;  4YYK A;  5ENJ A;  2DVQ A;  2GRC A;  4MEQ A;  4MR5 A;  4UYG A;  5EK9 A;  2RS9 B;  4A9J A;  5L96 A;  5CZG A;  5FG6 A;  5HEL A;  3D7C A;  5C7N A;  5DKH A;  4NRA A;  5C87 A;  4IR3 A;  5E9K A;  2DWW A;  4NXJ A;  4QSV A;  5LVQ A;  5EP7 A;  4O74 A;  4HXR A;  5CP5 A;  4NR7 A;  2RFJ A;  5H1V A;  5FFV A;  5ETD A;  5CRZ A;  5HRV A;  4O70 A;  4N3W A;  2I7K A;  3MB3 A;  4KCX A;  3S91 A;  5E7D A;  5CQA A;  3U5N A;  4LZ2 A;  4BHW A;  5E9L A;  4YC9 A;  4CUR A;  4BJX A;  5KHM A;  5FE9 A;  3SVF A;  5I89 A;  4ZQL A;  3LQH A;  4UYE A;  4A9H A;  5F1L A;  3LQI A;  5L98 A;  5IBN A;  5HCL A;  5D25 A;  2L84 A;  4LYI A;  5EV9 A;  4PCE A;  4Z1S A;  4ALH A;  5LVR A;  5F1H A;  5FDZ A;  5E74 A;  4DON A;  2YQD A;  5D3T A;  2R10 A;  2G4A A;  5EVA A;  5FB1 A;  4YY6 A;  2F6J A;  4YBS A;  3UV5 A;  3AAD A;  5F62 A;  4LYS A;  2R0Y A;  5FE0 A;  5J0D A;  5CQT A;  3UVX A;  4AKN A;  5H85 A;  4IR5 A;  5LJ2 A;  4PKL A;  4LDF A;  4QEW A;  5HFQ A;  5CU8 A;  2I8N A;  5EPB A;  4TS8 A;  5HEN A;  4QC3 A;  2DAT A;  5EGU A;  1N72 A;  4HXL A;  4QSX A;  4O7B A;  4HXS A;  5F5Z A;  4LRG A;  4UIX A;  4O7E A;  5D7X A;  4MR3 A;  5FG4 A;  3MQM A;  4QZS A;  2H60 A;  3MUL A;  4HBW A;  3FKM X;  5CRM A;  4QSU A;  4QSQ A;  5AD3 A;  3LXJ A;  5IGM A;  5HEM A;  2YEM A;  5HM0 A;  4YAX A;  2YYN A;  3P1F A;  4GPJ A;  4UYF B;  4Q0O A;  5EI4 A;  5FE4 A;  4BW3 A;  1F68 A;  4CUQ A;  5FBX A;  2D82 A;  3O33 A;  5C8G A;  2L85 A;  5DX4 A;  4F3I A;  4YYN A;  4Q0N A;  3DAI A;  4UYF A;  4N4H A;  5DY7 A;  4YYJ A;  3MUK A;  1WUG A;  4A9L A;  3RCW A;  4MEP A;  5FH6 A;  4WHW A;  3LQJ A;  5CUC A;  5ENC A;  4IR4 A;  3G0J A;  4LR6 A;  4UIW A;  4UIZ A;  5HRW A;  5HRX A;  4BW4 A;  5D3H A;  4PY6 A;  5DFD A;  4YYI A; 
#chains in the Genus database with same CATH topology
 3ERR A;  5HLS A;  2RNY A;  3P1D A;  4NYW A;  4HBX A;  5A81 A;  4PCI A;  2YW5 A;  4IOQ A;  4CUS A;  5D3R A;  5HQ6 A;  5C4Q A;  4LZR A;  3JVJ A;  4C66 A;  4O76 A;  4TU6 A;  5DYA A;  5E9M A;  4QSW A;  4NRC A;  4J3I A;  4XYA A;  5A5P A;  5FH7 A;  5EWV A;  5FE1 A;  5FE8 A;  4TTE A;  4CUP A;  4A9M A;  5I83 A;  4LZS A;  3Q2E A;  5G4R A;  5F2P A;  3O37 A;  5EIC A;  5CQ6 A;  4NS5 A;  1PUO A;  5BT5 A;  5ENF A;  5AMF A;  3U5M A;  5AME A;  3JVK A;  4ZW1 A;  5EWD A;  5ENE A;  2WP1 A;  4RVR A;  5DYC A;  2RNX A;  4CL9 A;  4O72 A;  5I7X A;  4NYX A;  2OSS A;  5KO4 A;  4UYH A;  3UVD A;  5I1Q A;  2L5E A;  5A5S A;  4CFK A;  5AD2 A;  5CQ8 A;  4NYV A;  5KU3 A;  4PS5 A;  5HQ5 A;  3MXF A;  4YY4 A;  5H1U A;  5A82 A;  5F25 A;  4TT2 A;  5FFY A;  4A9I A;  2OO1 A;  4WHU A;  5HJC A;  3QZT A;  2DKW A;  3IU5 A;  5ENH A;  4AKG A;  4NR5 A;  5I88 A;  4CLB A;  5K29 A;  4QST A;  3HMF A;  5TCM A;  4NUC A;  4O7C A;  4HBY A;  4YBT A;  1EQF A;  4BW2 A;  4N4F A;  4NRB A;  2R0V A;  5DW1 A;  4YYD A;  3U5K A;  5I29 A;  4Z6I A;  4NR4 A;  5E3D A;  5KTW A;  1X0J A;  1JM4 B;  4YBM A;  5D3N A;  4LC2 A;  4Z93 A;  5CY9 A;  4UIT A;  5HFR A;  5FFW A;  5CPE A;  5DLZ A;  2EJN A;  5DKC A;  5DYU A;  2DVR A;  4NR8 A;  5CUG A;  5C89 A;  5DFC A;  4HXP A;  5FE7 A;  5DYX A;  5CQ7 A;  2RI7 A;  2DVS A;  4TYL A;  5E3G A;  4YAD A;  2RNW A;  4QSS A;  4MR6 A;  4Z6H A;  4QB3 A;  4AKI A;  5EQ1 A;  2R0S A;  2LSP B;  2WP2 A;  2MJV B;  5FE5 A;  3P5O A;  4YAT A;  4A9E A;  4WIV A;  4NUE A;  5L8T A;  3P1E A;  5D26 A;  2DVV A;  5EU1 A;  4HBV A;  1WUM A;  5EA1 A;  4CUU A;  3VKG A;  3U5J A;  3ONI A;  4TQN A;  2KTB B;  3K2J A;  4O75 A;  5EPR A;  4ZC9 A;  4IOO A;  4O78 A;  5EIS A;  5F61 A;  4QY4 A;  4ALG A;  2NXB A;  4NQM A;  5CTL A;  5D3J A;  4KV4 A;  4QR4 A;  5A5O A;  5A5R A;  4CUT A;  5F3A A;  3UVY A;  5CUD A;  4YYG A;  2E7O A;  4QEU A;  3UV2 A;  5COI A;  4E96 A;  4X2I A;  5EWH A;  5A83 A;  5LJ1 A;  4YK0 A;  4NR6 A;  4QUU A;  3TLP A;  5KTU A;  4QEV A;  3UV4 A;  5DLX A;  4J1P A;  5LKX A;  5D3S A;  4A9F A;  3AQA A;  4HXO A;  3JVL A;  4KV1 A;  4YYM A;  5LUU A;  4UIV A;  3GG3 A;  3JVM A;  5CS8 A;  5EWW A;  5FE2 A;  2YDW A;  5I86 A;  3HMH A;  5CUB A;  5D3L A;  5CFW A;  4J0S A;  3U5O A;  4NUD A;  5DW2 A;  5BT4 A;  5ACY A;  5LKT A;  4QSR A;  5I40 A;  5FH8 A;  1JSP B;  5E73 A;  4QUT A;  5JWM A;  5G4S A;  4QBM A;  3U5L A;  4QYD A;  1ZS5 A;  5ENI A;  2N9G A;  3O36 A;  5FE6 A;  5IGL A;  5D24 A;  5A85 A;  5CQ5 A;  3HME A;  5ENB A;  4MEO A;  4NR9 A;  2RO1 A;  2YEK A;  3QZV A;  4Y03 A;  5L99 A;  5II2 A;  5D3P A;  4A9K A;  3O35 A;  5E9V A;  3UVW A;  3U5P A;  5IID A;  4HXM A;  5E9Y A;  4OGJ A;  4N4I A;  4O77 A;  5LKU A;  3S92 A;  5I7Y A;  4YYH A;  4O7F A;  5BT3 A;  4XUB A;  5D0C A;  4FLP A;  3SVH A;  5JI8 A;  3IU6 A;  5IGK A;  5F60 A;  4NQN A;  4YH3 A;  5FG5 A;  5LJ0 A;  5LKZ A;  4XUA A;  4XY9 A;  4TT6 A;  3I3J A;  3DWY A;  3P1C A;  4QNS A;  5IG6 A;  3LJW A;  4TU4 A;  5CQ3 A;  5E0R A;  5FB0 A;  5H1T A;  4UIU A;  5II1 A;  4N4G A;  2YEL A;  3G0L A;  3UW9 A;  5DKD A;  4IOR A;  1E6I A;  3QZS A;  4O71 A;  5DBM A;  4HXN A;  5E9I A;  5DFB A;  5F63 A;  2D9E A;  3D1D A;  4IR6 A;  4TZ8 A;  2E7N A;  4QSP A;  2OUO A;  4J0R A;  4LYW A;  4MEN A;  5EM3 A;  5A7C A;  4QR3 A;  2F6N A;  4UIY A;  4TZ2 A;  5EPS A;  5A5N A;  5C85 A;  4UYD A;  4BW1 A;  4OUF A;  5CQ4 A;  5CUE A;  4XY8 A;  4C67 A;  4QR5 A;  4PTB A;  4A9N A;  4HXK A;  4TT4 A;  5ENG A;  4QYL A;  4QC1 A;  4Z1Q A;  5A5Q A;  3Q2F A;  4O7A A;  5CUA A;  3O34 A;  5I80 A;  2E3K A;  3MB4 A;  5FE3 A;  2FSA A;  5TB6 A;  3NXB A;  4MR4 A;  5F36 A;  3SVG A;  4OGI A;  4YH4 A;  3ZYU A;  4YAB A;  4CFL A;  5IGN A;  5EWC A;  5ETB A;  5L8U A;  4A9O A;  5CGP A;  5KTX A;  5HQ7 A;  5L97 A;  4YYK A;  5ENJ A;  2DVQ A;  2GRC A;  4MEQ A;  4MR5 A;  4UYG A;  5EK9 A;  2RS9 B;  4A9J A;  5L96 A;  5CZG A;  5FG6 A;  5HEL A;  3D7C A;  5C7N A;  5DKH A;  4NRA A;  5C87 A;  4IR3 A;  5E9K A;  2DWW A;  4NXJ A;  4QSV A;  5LVQ A;  5EP7 A;  4O74 A;  4HXR A;  5CP5 A;  4NR7 A;  2RFJ A;  5H1V A;  5FFV A;  5ETD A;  5CRZ A;  5HRV A;  4O70 A;  4N3W A;  2I7K A;  3MB3 A;  4KCX A;  3S91 A;  5E7D A;  5CQA A;  3U5N A;  4LZ2 A;  4BHW A;  5E9L A;  4YC9 A;  4CUR A;  4BJX A;  5KHM A;  5FE9 A;  3SVF A;  5I89 A;  4ZQL A;  3LQH A;  4UYE A;  4A9H A;  5F1L A;  3LQI A;  5L98 A;  5IBN A;  5HCL A;  5D25 A;  2L84 A;  4LYI A;  5EV9 A;  4PCE A;  4Z1S A;  4ALH A;  5LVR A;  5F1H A;  5FDZ A;  5E74 A;  4DON A;  2YQD A;  5D3T A;  2R10 A;  2G4A A;  5EVA A;  5FB1 A;  4YY6 A;  2F6J A;  4YBS A;  3UV5 A;  3AAD A;  4AKH A;  5F62 A;  4LYS A;  2R0Y A;  5FE0 A;  5J0D A;  5CQT A;  3UVX A;  4AKN A;  5H85 A;  4IR5 A;  5LJ2 A;  4PKL A;  4LDF A;  4QEW A;  5HFQ A;  5CU8 A;  2I8N A;  5EPB A;  4TS8 A;  5HEN A;  4QC3 A;  2DAT A;  5EGU A;  1N72 A;  4HXL A;  4QSX A;  3D1B A;  4O7B A;  4HXS A;  3VKH A;  5F5Z A;  4LRG A;  4UIX A;  4O7E A;  5D7X A;  4MR3 A;  5FG4 A;  3MQM A;  4AI6 A;  4QZS A;  2H60 A;  3MUL A;  4HBW A;  3FKM X;  5CRM A;  4QSU A;  4QSQ A;  5AD3 A;  3LXJ A;  5IGM A;  5HEM A;  2YEM A;  5HM0 A;  1ZKR A;  4YAX A;  2YYN A;  3P1F A;  4GPJ A;  4UYF B;  4Q0O A;  5EI4 A;  5FE4 A;  4BW3 A;  1F68 A;  4CUQ A;  5FBX A;  2D82 A;  3O33 A;  5C8G A;  2L85 A;  5DX4 A;  4F3I A;  4YYN A;  4Q0N A;  3DAI A;  4UYF A;  4N4H A;  5DY7 A;  4YYJ A;  3MUK A;  1WUG A;  4A9L A;  3RCW A;  4MEP A;  5FH6 A;  4WHW A;  3LQJ A;  5CUC A;  5ENC A;  4IR4 A;  3G0J A;  4LR6 A;  4UIW A;  4UIZ A;  5HRW A;  5HRX A;  4BW4 A;  5D3H A;  4PY6 A;  5DFD A;  4YYI A; 
#chains in the Genus database with same CATH homology
 5HLS A;  2RNY A;  3P1D A;  4NYW A;  4HBX A;  5A81 A;  4PCI A;  2YW5 A;  4IOQ A;  4CUS A;  5D3R A;  5HQ6 A;  5C4Q A;  4LZR A;  3JVJ A;  4C66 A;  4O76 A;  4TU6 A;  5DYA A;  5E9M A;  4QSW A;  4NRC A;  4J3I A;  4XYA A;  5A5P A;  5FH7 A;  5EWV A;  5FE1 A;  5FE8 A;  4TTE A;  4CUP A;  4A9M A;  5I83 A;  4LZS A;  3Q2E A;  5G4R A;  5F2P A;  3O37 A;  5EIC A;  5CQ6 A;  4NS5 A;  5BT5 A;  5ENF A;  5AMF A;  3U5M A;  5AME A;  3JVK A;  4ZW1 A;  5EWD A;  5ENE A;  2WP1 A;  4RVR A;  5DYC A;  2RNX A;  4CL9 A;  4O72 A;  5I7X A;  4NYX A;  2OSS A;  5KO4 A;  4UYH A;  3UVD A;  5I1Q A;  2L5E A;  5A5S A;  4CFK A;  5AD2 A;  5CQ8 A;  4NYV A;  5KU3 A;  4PS5 A;  5HQ5 A;  3MXF A;  4YY4 A;  5H1U A;  5A82 A;  5F25 A;  4TT2 A;  5FFY A;  4A9I A;  2OO1 A;  4WHU A;  5HJC A;  3QZT A;  2DKW A;  3IU5 A;  5ENH A;  4NR5 A;  5I88 A;  4CLB A;  5K29 A;  4QST A;  3HMF A;  5TCM A;  4NUC A;  4O7C A;  4HBY A;  4YBT A;  1EQF A;  4BW2 A;  4N4F A;  4NRB A;  2R0V A;  5DW1 A;  4YYD A;  3U5K A;  5I29 A;  4Z6I A;  4NR4 A;  5E3D A;  5KTW A;  1X0J A;  1JM4 B;  4YBM A;  5D3N A;  4LC2 A;  4Z93 A;  5CY9 A;  4UIT A;  5HFR A;  5FFW A;  5CPE A;  5DLZ A;  5DKC A;  5DYU A;  2DVR A;  4NR8 A;  5CUG A;  5C89 A;  5DFC A;  4HXP A;  5FE7 A;  5DYX A;  5CQ7 A;  2RI7 A;  2DVS A;  4TYL A;  5E3G A;  4YAD A;  2RNW A;  4QSS A;  4MR6 A;  4Z6H A;  4QB3 A;  5EQ1 A;  2R0S A;  2LSP B;  2WP2 A;  2MJV B;  5FE5 A;  3P5O A;  4YAT A;  4A9E A;  4WIV A;  4NUE A;  5L8T A;  3P1E A;  5D26 A;  2DVV A;  5EU1 A;  4HBV A;  1WUM A;  5EA1 A;  4CUU A;  3U5J A;  3ONI A;  4TQN A;  2KTB B;  3K2J A;  4O75 A;  5EPR A;  4ZC9 A;  4IOO A;  4O78 A;  5EIS A;  5F61 A;  4QY4 A;  4ALG A;  2NXB A;  4NQM A;  5CTL A;  5D3J A;  4KV4 A;  4QR4 A;  5A5O A;  5A5R A;  4CUT A;  5F3A A;  3UVY A;  5CUD A;  4YYG A;  2E7O A;  4QEU A;  3UV2 A;  5COI A;  4E96 A;  4X2I A;  5EWH A;  5A83 A;  5LJ1 A;  4YK0 A;  4NR6 A;  4QUU A;  3TLP A;  5KTU A;  4QEV A;  3UV4 A;  5DLX A;  4J1P A;  5LKX A;  5D3S A;  4A9F A;  3AQA A;  4HXO A;  3JVL A;  4KV1 A;  4YYM A;  5LUU A;  4UIV A;  3GG3 A;  3JVM A;  5CS8 A;  5EWW A;  5FE2 A;  2YDW A;  5I86 A;  3HMH A;  5CUB A;  5D3L A;  5CFW A;  4J0S A;  3U5O A;  4NUD A;  5DW2 A;  5BT4 A;  5ACY A;  5LKT A;  4QSR A;  5I40 A;  5FH8 A;  1JSP B;  5E73 A;  4QUT A;  5JWM A;  5G4S A;  4QBM A;  3U5L A;  4QYD A;  1ZS5 A;  5ENI A;  2N9G A;  3O36 A;  5FE6 A;  5IGL A;  5D24 A;  5A85 A;  5CQ5 A;  3HME A;  5ENB A;  4MEO A;  4NR9 A;  2RO1 A;  2YEK A;  3QZV A;  4Y03 A;  5L99 A;  5II2 A;  5D3P A;  4A9K A;  3O35 A;  5E9V A;  3UVW A;  3U5P A;  5IID A;  4HXM A;  5E9Y A;  4OGJ A;  4N4I A;  4O77 A;  5LKU A;  3S92 A;  5I7Y A;  4YYH A;  4O7F A;  5BT3 A;  4XUB A;  5D0C A;  4FLP A;  3SVH A;  5JI8 A;  3IU6 A;  5IGK A;  5F60 A;  4NQN A;  4YH3 A;  5FG5 A;  5LJ0 A;  5LKZ A;  4XUA A;  4XY9 A;  4TT6 A;  3I3J A;  3DWY A;  3P1C A;  4QNS A;  5IG6 A;  3LJW A;  4TU4 A;  5CQ3 A;  5E0R A;  5FB0 A;  5H1T A;  4UIU A;  5II1 A;  4N4G A;  2YEL A;  3G0L A;  3UW9 A;  5DKD A;  4IOR A;  1E6I A;  3QZS A;  4O71 A;  5DBM A;  4HXN A;  5E9I A;  5DFB A;  5F63 A;  2D9E A;  4IR6 A;  4TZ8 A;  2E7N A;  4QSP A;  2OUO A;  4J0R A;  4LYW A;  4MEN A;  5EM3 A;  5A7C A;  4QR3 A;  2F6N A;  4UIY A;  4TZ2 A;  5EPS A;  5A5N A;  5C85 A;  4UYD A;  4BW1 A;  4OUF A;  5CQ4 A;  5CUE A;  4XY8 A;  4C67 A;  4QR5 A;  4PTB A;  4A9N A;  4HXK A;  4TT4 A;  5ENG A;  4QYL A;  4QC1 A;  4Z1Q A;  5A5Q A;  3Q2F A;  4O7A A;  5CUA A;  3O34 A;  5I80 A;  2E3K A;  3MB4 A;  5FE3 A;  2FSA A;  5TB6 A;  3NXB A;  4MR4 A;  5F36 A;  3SVG A;  4OGI A;  4YH4 A;  3ZYU A;  4YAB A;  4CFL A;  5IGN A;  5EWC A;  5ETB A;  5L8U A;  4A9O A;  5CGP A;  5KTX A;  5HQ7 A;  5L97 A;  4YYK A;  5ENJ A;  2DVQ A;  2GRC A;  4MEQ A;  4MR5 A;  4UYG A;  5EK9 A;  2RS9 B;  4A9J A;  5L96 A;  5CZG A;  5FG6 A;  5HEL A;  3D7C A;  5C7N A;  5DKH A;  4NRA A;  5C87 A;  4IR3 A;  5E9K A;  2DWW A;  4NXJ A;  4QSV A;  5LVQ A;  5EP7 A;  4O74 A;  4HXR A;  5CP5 A;  4NR7 A;  2RFJ A;  5H1V A;  5FFV A;  5ETD A;  5CRZ A;  5HRV A;  4O70 A;  4N3W A;  2I7K A;  3MB3 A;  4KCX A;  3S91 A;  5E7D A;  5CQA A;  3U5N A;  4LZ2 A;  4BHW A;  5E9L A;  4YC9 A;  4CUR A;  4BJX A;  5KHM A;  5FE9 A;  3SVF A;  5I89 A;  4ZQL A;  3LQH A;  4UYE A;  4A9H A;  5F1L A;  3LQI A;  5L98 A;  5IBN A;  5HCL A;  5D25 A;  2L84 A;  4LYI A;  5EV9 A;  4PCE A;  4Z1S A;  4ALH A;  5LVR A;  5F1H A;  5FDZ A;  5E74 A;  4DON A;  2YQD A;  5D3T A;  2R10 A;  2G4A A;  5EVA A;  5FB1 A;  4YY6 A;  2F6J A;  4YBS A;  3UV5 A;  3AAD A;  5F62 A;  4LYS A;  2R0Y A;  5FE0 A;  5J0D A;  5CQT A;  3UVX A;  4AKN A;  5H85 A;  4IR5 A;  5LJ2 A;  4PKL A;  4LDF A;  4QEW A;  5HFQ A;  5CU8 A;  2I8N A;  5EPB A;  4TS8 A;  5HEN A;  4QC3 A;  2DAT A;  5EGU A;  1N72 A;  4HXL A;  4QSX A;  4O7B A;  4HXS A;  5F5Z A;  4LRG A;  4UIX A;  4O7E A;  5D7X A;  4MR3 A;  5FG4 A;  3MQM A;  4QZS A;  2H60 A;  3MUL A;  4HBW A;  3FKM X;  5CRM A;  4QSU A;  4QSQ A;  5AD3 A;  3LXJ A;  5IGM A;  5HEM A;  2YEM A;  5HM0 A;  4YAX A;  2YYN A;  3P1F A;  4GPJ A;  4UYF B;  4Q0O A;  5EI4 A;  5FE4 A;  4BW3 A;  1F68 A;  4CUQ A;  5FBX A;  2D82 A;  3O33 A;  5C8G A;  2L85 A;  5DX4 A;  4F3I A;  4YYN A;  4Q0N A;  3DAI A;  4UYF A;  4N4H A;  5DY7 A;  4YYJ A;  3MUK A;  1WUG A;  4A9L A;  3RCW A;  4MEP A;  5FH6 A;  4WHW A;  3LQJ A;  5CUC A;  5ENC A;  4IR4 A;  3G0J A;  4LR6 A;  4UIW A;  4UIZ A;  5HRW A;  5HRX A;  4BW4 A;  5D3H A;  4PY6 A;  5DFD A;  4YYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...