4LDFA

Crystal structure of cpbrd2 from cryptosporidium, cgd3_3190
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
107
structure length
107
Chain Sequence
KVDLSMNDQIWQLLDTLSRHENAWPFRKPVSIGEASDYYEIIKEPTDIQTMKRKAKNKEYKTLSEFSSELKRMFDNCRFYNAKNTIYTKYANQLEAFIWPMLQTIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5 like acetylase + bromodomain
publication title Crystal Structure of CpBRD2 from cryptosporidium, cgd3_3190
rcsb
source organism Cryptosporidium parvum
molecule tags Transferase
total genus 42
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ldfA00
4O7EA 4C66A 5HRWA 5F2PA 4NR6A 4LZ2A 5KTUA 5D3NA 5CZGA 4IOQA 4YY6A 4QY4A 5I7YA 3LQJA 5JI8A 4N4HA 5H1UA 4IOOA 4QEVA 5J0DA 5CQAA 3QZTA 2D82A 5I83A 4QYDA 5IGKA 5LJ0A 4IR5A 4TZ8A 2R0YA 5F62A 4AKNA 4YBSA 2DVQA 5FE3A 5FFYA 4UIVA 5FE2A 5CUGA 4NR7A 5L99A 5E3GA 5EISA 5C85A 5C8GA 4ZQLA 2RNXA 4QSSA 5D3LA 4O72A 3NXBA 4QYLA 5D3HA 4NS5A 1WUGA 3P1CA 5HELA 2F6JA 4CUSA 4UYFB 4YYJA 4LYWA 4IR6A 5LKZA 5HRXA 4Q0OA 5DKHA 5BT5A 2YYNA 2YELA 4QEWA 5TCMA 4ALHA 4Z1QA 5DLZA 3LXJA 4MEQA 5ENEA 4NYWA 5CRZA 4QZSA 5F25A 4C67A 3O36A 5LJ1A 4A9FA 5CTLA 4XYAA 4UYGA 5ENJA 4QSWA 2N9GA 5FB1A 2KTBB 5CUCA 3LQHA 5ETBA 5DFDA 5FE1A 4O75A 5HJCA 2I8NA 4QBMA 5A7CA 4QSTA 5CQ3A 4YAXA 5E9MA 4QSVA 4CUUA 3P1EA 4TQNA 4UIUA 5ETDA 5II1A 5LJ2A 4O7FA 5EK9A 5KHMA 2MJVB 5G4RA 5AMEA 4N4GA 1F68A 4XY8A 2RS9B 3S91A 4TU4A 5A5SA 4QR4A 3G0JA 4O70A 5A5RA 2R0SA 5E9YA 4BW1A 5I7XA 5II2A 5DW1A 5C87A 3ZYUA 2WP2A 4YYDA 3MUKA 4PCEA 3O35A 2F6NA 4N3WA 4HXRA 4YK0A 2E3KA 2OSSA 5CUDA 5DW2A 5EWCA 3JVMA 5DFCA 4CLBA 4CUTA 4QB3A 2DKWA 4CUQA 4IR3A 4NUDA 2H60A 4NR4A 4TZ2A 2YQDA 3JVKA 1ZS5A 5H1VA 4LZSA 4O76A 4CL9A 4MEPA 4XY9A 5HFRA 5DY7A 5F5ZA 4KV1A 5FFVA 5HENA 3O33A 4QUTA 5TB6A 5DKDA 5EVAA 3MB3A 5HLSA 3O37A 2L5EA 4UIWA 4MR6A 5D3JA 1X0JA 2RNYA 5FB0A 5I40A 3UVDA 5E9IA 5DLXA 2DVRA 5CQ8A 5F1HA 4A9IA 4Q0NA 4O7BA 5CGPA 4Z1SA 5F61A 5F3AA 4LDFA 5FE5A 5ENIA 5HQ6A 5I1QA 3HMFA 5A5PA 5LKXA 5LVRA 4QSXA 5IGMA 5KO4A 5COIA 3P1DA 3JVJA 2R10A 3SVGA 5IIDA 3UW9A 4BHWA 5ENFA 5CQ6A 5CRMA 4PS5A 3UV4A 5L98A 4WHWA 4LYIA 4NRBA 5FE4A 4IORA 1EQFA 4YYMA 4NYXA 5DYAA 5C4QA 5D7XA 4F3IA 3D7CA 3DAIA 5CUEA 3UVXA 1JSPB 5IGLA 4A9EA 4HXOA 5IBNA 5D26A 4O78A 5EPRA 4TU6A 4NUEA 4GPJA 4UYHA 5A5OA 5E9LA 3AQAA 2OO1A 4QSRA 4NXJA 4E96A 4NQNA 4QEUA 3UVYA 4Z6IA 2DVSA 4UYEA 3LJWA 4LC2A 4J1PA 5EP7A 4HBYA 3U5KA 5L8TA 4YH3A 3U5LA 5L8UA 4QSUA 4UIZA 4O7AA 5FH7A 4YATA 3DWYA 4UIXA 4CURA 5E9VA 4QSPA 5DX4A 5E73A 5DFBA 4OUFA 4J0RA 4A9OA 5G4SA 5KTXA 3TLPA 4TS8A 4PCIA 5AD3A 3MXFA 5DKCA 5DYCA 4YYGA 4BW2A 5FE7A 4BJXA 4CUPA 5FE8A 5A83A 5EA1A 4HXPA 5L96A 4PKLA 5CQ4A 3QZSA 4QC3A 5ACYA 4A9NA 4J3IA 2LSPB 3LQIA 5KU3A 4YYIA 5FDZA 4UYFA 3IU6A 5FE6A 2RO1A 5IG6A 4YYHA 5HM0A 3U5PA 4FLPA 4OGIA 5I88A 4MR3A 5JWMA 5HFQA 5CS8A 5ENGA 3HMHA 1WUMA 2YEKA 5I86A 3QZVA 5CQ5A 5HQ7A 4HBWA 4LYSA 5A5NA 5LKTA 4HXKA 5K29A 3ONIA 2RI7A 5EV9A 4MEOA 4UYDA 5CUBA 5CY9A 5EICA 5DYUA 4TYLA 5I29A 4YYNA 5E9KA 5CQTA 3JVLA 4O71A 5FH8A 5D3TA 3Q2EA 2R0VA 3Q2FA 5F60A 4NR5A 5C89A 5FE9A 1JM4B 5EM3A 4QR5A 2NXBA 4PY6A 2YDWA 5H1TA 5EU1A 5BT4A 3P1FA 4NYVA 4UITA 4UIYA 5DYXA 4CFLA 3O34A 5D25A 5EPSA 4A9LA 2L85A 4ZC9A 4HBXA 5E7DA 3RCWA 4XUAA 4N4FA 2D9EA 2YEMA 4LRGA 4HXMA 4YYKA 3U5NA 4TT4A 3MB4A 5ENBA 5LVQA 4XUBA 2RNWA 5FG5A 5CP5A 3MULA 5D3RA 5D3SA 5EPBA 5HCLA 4O7CA 5LUUA 4BW3A 4QUUA 3GG3A 5F36A 4QR3A 4A9KA 5CFWA 5A5QA 5CQ7A 5D0CA 3HMEA 5CUAA 3UVWA 5HQ5A 4HXLA 4TT2A 4X2IA 4LR6A 3P5OA 3SVFA 5ENHA 5L97A 4KV4A 4A9JA 4TTEA 4OGJA 2G4AA 4A9MA 2RFJA 5C7NA 4CFKA 4YBTA 5LKUA 2DWWA 5A82A 4NRAA 4DONA 3UV2A 5FE0A 4HXSA 4YADA 4Z93A 4BW4A 5FBXA 5I89A 4WIVA 4IR4A 2FSAA 5H85A 5E74A 5E3DA 5E0RA 1N72A 3SVHA 5ENCA 3K2JA 2YW5A 5A85A 4WHUA 4QC1A 5D3PA 5FFWA 4TT6A 4A9HA 5BT3A 5EQ1A 5HEMA 2E7NA 2GRCA 5HRVA 4KCXA 2WP1A 5I80A 5FG4A 4ZW1A 2DATA 4YBMA 4YY4A 5CPEA 4NR8A 4Y03A 5KTWA 4MENA 5F63A 4ALGA 4PTBA 5EWVA 4QNSA 4QSQA 5A81A 5IGNA 4NQMA 3MQMA 3FKMX 5D24A 3AADA 3I3JA 4HBVA 5CU8A 4J0SA 3S92A 1E6IA 4Z6HA 3U5OA 2DVVA 4MR5A 5EI4A 3UV5A 4RVRA 2I7KA 5FH6A 5AD2A 5AMFA 5EWDA 5EWHA 2E7OA 4YABA 4NR9A 3U5JA 4O74A 5F1LA 4YH4A 4NRCA 3U5MA 4N4IA 5DBMA 4HXNA 2L84A 3G0LA 4O77A 4NUCA 4MR4A 2OUOA 4YC9A 3IU5A 5EWWA 5EGUA 4LZRA 5FG6A
chains in the Genus database with same CATH superfamily
4O7EA 4C66A 5HRWA 5F2PA 4NR6A 4LZ2A 5KTUA 5D3NA 5CZGA 4IOQA 4YY6A 4QY4A 5I7YA 3LQJA 5JI8A 4N4HA 5H1UA 4IOOA 4QEVA 5J0DA 5CQAA 3QZTA 2D82A 5I83A 4QYDA 5IGKA 5LJ0A 4IR5A 4TZ8A 2R0YA 5F62A 4AKNA 4YBSA 2DVQA 5FE3A 5FFYA 4UIVA 5FE2A 5CUGA 4NR7A 5L99A 5E3GA 5EISA 5C85A 5C8GA 4ZQLA 2RNXA 4QSSA 5D3LA 4O72A 3NXBA 4QYLA 5D3HA 4NS5A 1WUGA 3P1CA 5HELA 2F6JA 4CUSA 4UYFB 4YYJA 4LYWA 4IR6A 5LKZA 5HRXA 4Q0OA 5DKHA 5BT5A 2YYNA 2YELA 4QEWA 5TCMA 4ALHA 4Z1QA 5DLZA 2EJNA 3LXJA 4MEQA 5ENEA 4NYWA 5CRZA 4QZSA 5F25A 4C67A 3O36A 5LJ1A 4A9FA 5CTLA 4XYAA 4UYGA 5ENJA 4QSWA 2N9GA 4AI6A 5FB1A 2KTBB 5CUCA 3LQHA 5ETBA 5DFDA 5FE1A 4O75A 5HJCA 2I8NA 4QBMA 5A7CA 4QSTA 5CQ3A 4YAXA 5E9MA 4QSVA 4CUUA 3P1EA 4TQNA 4UIUA 5ETDA 5II1A 5LJ2A 4O7FA 5EK9A 5KHMA 2MJVB 5G4RA 5AMEA 4N4GA 1F68A 4XY8A 2RS9B 3S91A 4TU4A 5A5SA 4QR4A 3G0JA 4O70A 5A5RA 2R0SA 5E9YA 4BW1A 5I7XA 5II2A 5DW1A 5C87A 3ZYUA 2WP2A 4YYDA 3MUKA 4PCEA 3O35A 2F6NA 4N3WA 4HXRA 4YK0A 2E3KA 2OSSA 5CUDA 5DW2A 5EWCA 3JVMA 5DFCA 4CLBA 4CUTA 4QB3A 2DKWA 4CUQA 4IR3A 4NUDA 2H60A 4NR4A 4TZ2A 2YQDA 3JVKA 1ZS5A 5H1VA 4LZSA 4O76A 4CL9A 4MEPA 4XY9A 1PUOA 5HFRA 5DY7A 5F5ZA 4KV1A 5FFVA 5HENA 3O33A 4QUTA 5TB6A 5DKDA 5EVAA 3MB3A 5HLSA 3O37A 2L5EA 4UIWA 4MR6A 5D3JA 1X0JA 2RNYA 5FB0A 5I40A 3UVDA 5E9IA 5DLXA 2DVRA 5CQ8A 5F1HA 4A9IA 4Q0NA 4O7BA 5CGPA 4Z1SA 5F61A 5F3AA 4LDFA 5FE5A 5ENIA 5HQ6A 5I1QA 3HMFA 5A5PA 5LKXA 5LVRA 4QSXA 5IGMA 5KO4A 5COIA 3P1DA 3JVJA 2R10A 3SVGA 5IIDA 3UW9A 4BHWA 5ENFA 5CQ6A 5CRMA 4PS5A 3UV4A 5L98A 4WHWA 4LYIA 4NRBA 5FE4A 4IORA 1EQFA 4YYMA 4NYXA 5DYAA 5C4QA 5D7XA 4F3IA 3D7CA 3DAIA 5CUEA 3UVXA 1JSPB 5IGLA 4A9EA 4HXOA 5IBNA 5D26A 4O78A 5EPRA 4TU6A 4NUEA 4GPJA 4UYHA 5A5OA 5E9LA 3AQAA 4QSRA 2OO1A 4NXJA 4E96A 4NQNA 4QEUA 3UVYA 4Z6IA 2DVSA 4UYEA 3LJWA 4LC2A 4J1PA 5EP7A 4HBYA 3U5KA 5L8TA 4YH3A 3U5LA 5L8UA 4QSUA 4UIZA 4O7AA 5FH7A 4YATA 3DWYA 4UIXA 4CURA 1ZKRA 5E9VA 4QSPA 5DX4A 5E73A 5DFBA 4OUFA 4J0RA 4A9OA 5G4SA 5KTXA 3TLPA 4TS8A 4PCIA 5AD3A 3MXFA 5DKCA 5DYCA 4YYGA 4BW2A 5FE7A 4BJXA 4CUPA 5FE8A 5A83A 5EA1A 4HXPA 5L96A 4PKLA 5CQ4A 3QZSA 4QC3A 5ACYA 4A9NA 4J3IA 2LSPB 3LQIA 5KU3A 4YYIA 5FDZA 4UYFA 3IU6A 5FE6A 2RO1A 5IG6A 4YYHA 5HM0A 3U5PA 4FLPA 4OGIA 5I88A 4AKGA 4MR3A 5JWMA 5HFQA 5CS8A 5ENGA 3HMHA 1WUMA 2YEKA 5I86A 3QZVA 3D1DA 5CQ5A 5HQ7A 4HBWA 4LYSA 5A5NA 5LKTA 4HXKA 5K29A 3ONIA 2RI7A 5EV9A 4MEOA 4UYDA 5CUBA 5CY9A 5EICA 5DYUA 4TYLA 5I29A 4YYNA 5E9KA 5CQTA 3JVLA 4O71A 5FH8A 5D3TA 3Q2EA 2R0VA 3Q2FA 5F60A 4NR5A 5C89A 5FE9A 1JM4B 5EM3A 4QR5A 2NXBA 4PY6A 2YDWA 5H1TA 5EU1A 5BT4A 3P1FA 4NYVA 4UITA 4UIYA 5DYXA 4CFLA 3O34A 5D25A 5EPSA 4A9LA 2L85A 4ZC9A 4HBXA 5E7DA 3RCWA 4XUAA 4N4FA 2D9EA 2YEMA 4LRGA 3ERRA 4HXMA 4YYKA 3VKHA 3U5NA 4TT4A 3MB4A 5ENBA 5LVQA 4XUBA 2RNWA 5FG5A 5CP5A 3MULA 5D3RA 5D3SA 5EPBA 5HCLA 4O7CA 5LUUA 4BW3A 4QUUA 3GG3A 5F36A 4QR3A 4A9KA 5CFWA 5A5QA 5CQ7A 4AKIA 5D0CA 3HMEA 5CUAA 3UVWA 3VKGA 5HQ5A 4HXLA 4TT2A 4X2IA 3D1BA 4LR6A 3P5OA 3SVFA 5ENHA 5L97A 4KV4A 4A9JA 4TTEA 4OGJA 2G4AA 4A9MA 2RFJA 5C7NA 4CFKA 4YBTA 5LKUA 2DWWA 5A82A 4NRAA 4DONA 3UV2A 5FE0A 4AKHA 4HXSA 4YADA 4Z93A 4BW4A 5FBXA 5I89A 4WIVA 4IR4A 2FSAA 5H85A 5E74A 5E3DA 5E0RA 1N72A 3SVHA 5ENCA 3K2JA 2YW5A 5A85A 4WHUA 4QC1A 5D3PA 5FFWA 4TT6A 4A9HA 5BT3A 5EQ1A 5HEMA 2E7NA 2GRCA 5HRVA 4KCXA 2WP1A 5I80A 5FG4A 4ZW1A 2DATA 4YBMA 4YY4A 5CPEA 4NR8A 4Y03A 5KTWA 4MENA 5F63A 4ALGA 4PTBA 5EWVA 4QNSA 4QSQA 5A81A 5IGNA 4NQMA 3MQMA 3FKMX 5D24A 3AADA 3I3JA 4HBVA 5CU8A 4J0SA 3S92A 1E6IA 4Z6HA 3U5OA 2DVVA 4MR5A 5EI4A 3UV5A 4RVRA 2I7KA 5FH6A 5AD2A 5AMFA 5EWDA 5EWHA 2E7OA 4YABA 4NR9A 3U5JA 4O74A 5F1LA 4YH4A 4NRCA 3U5MA 4N4IA 5DBMA 4HXNA 2L84A 3G0LA 4O77A 4NUCA 4MR4A 2OUOA 4YC9A 3IU5A 5EWWA 5EGUA 4LZRA 5FG6A
chains in the Genus database with same CATH topology
4O7EA 4C66A 5HRWA 5F2PA 4NR6A 4LZ2A 5KTUA 5D3NA 5CZGA 4IOQA 4YY6A 4QY4A 5I7YA 3LQJA 5JI8A 4N4HA 5H1UA 4IOOA 4QEVA 5J0DA 5CQAA 3QZTA 2D82A 5I83A 4QYDA 5IGKA 5LJ0A 4IR5A 4TZ8A 2R0YA 5F62A 4AKNA 4YBSA 2DVQA 5FE3A 5FFYA 4UIVA 5FE2A 5CUGA 4NR7A 5L99A 5E3GA 5EISA 5C85A 5C8GA 4ZQLA 2RNXA 4QSSA 5D3LA 4O72A 3NXBA 4QYLA 5D3HA 4NS5A 1WUGA 3P1CA 5HELA 2F6JA 4CUSA 4UYFB 4YYJA 4LYWA 4IR6A 5LKZA 5HRXA 4Q0OA 5DKHA 5BT5A 2YYNA 2YELA 4QEWA 5TCMA 4ALHA 4Z1QA 5DLZA 3LXJA 4MEQA 5ENEA 4NYWA 5CRZA 4QZSA 5F25A 4C67A 3O36A 5LJ1A 4A9FA 5CTLA 4XYAA 4UYGA 5ENJA 4QSWA 2N9GA 5FB1A 2KTBB 5CUCA 3LQHA 5ETBA 5DFDA 5FE1A 4O75A 5HJCA 2I8NA 4QBMA 5A7CA 4QSTA 5CQ3A 4YAXA 5E9MA 4QSVA 4CUUA 3P1EA 4TQNA 4UIUA 5ETDA 5II1A 5LJ2A 4O7FA 5EK9A 5KHMA 2MJVB 5G4RA 5AMEA 4N4GA 1F68A 4XY8A 2RS9B 3S91A 4TU4A 5A5SA 4QR4A 3G0JA 4O70A 5A5RA 2R0SA 5E9YA 4BW1A 5I7XA 5II2A 5DW1A 5C87A 3ZYUA 2WP2A 4YYDA 3MUKA 4PCEA 3O35A 2F6NA 4N3WA 4HXRA 4YK0A 2E3KA 2OSSA 5CUDA 5DW2A 5EWCA 3JVMA 5DFCA 4CLBA 4CUTA 4QB3A 2DKWA 4CUQA 4IR3A 4NUDA 2H60A 4NR4A 4TZ2A 2YQDA 3JVKA 1ZS5A 5H1VA 4LZSA 4O76A 4CL9A 4MEPA 4XY9A 5HFRA 5DY7A 5F5ZA 4KV1A 5FFVA 5HENA 3O33A 4QUTA 5TB6A 5DKDA 5EVAA 3MB3A 5HLSA 3O37A 2L5EA 4UIWA 4MR6A 5D3JA 1X0JA 2RNYA 5FB0A 5I40A 3UVDA 5E9IA 5DLXA 2DVRA 5CQ8A 5F1HA 4A9IA 4Q0NA 4O7BA 5CGPA 4Z1SA 5F61A 5F3AA 4LDFA 5FE5A 5ENIA 5HQ6A 5I1QA 3HMFA 5A5PA 5LKXA 5LVRA 4QSXA 5IGMA 5KO4A 5COIA 3P1DA 3JVJA 2R10A 3SVGA 5IIDA 3UW9A 4BHWA 5ENFA 5CQ6A 5CRMA 4PS5A 3UV4A 5L98A 4WHWA 4LYIA 4NRBA 5FE4A 4IORA 1EQFA 4YYMA 4NYXA 5DYAA 5C4QA 5D7XA 4F3IA 3D7CA 3DAIA 5CUEA 3UVXA 1JSPB 5IGLA 4A9EA 4HXOA 5IBNA 5D26A 4O78A 5EPRA 4TU6A 4NUEA 4GPJA 4UYHA 5A5OA 5E9LA 3AQAA 2OO1A 4QSRA 4NXJA 4E96A 4NQNA 4QEUA 3UVYA 4Z6IA 2DVSA 4UYEA 3LJWA 4LC2A 4J1PA 5EP7A 4HBYA 3U5KA 5L8TA 4YH3A 3U5LA 5L8UA 4QSUA 4UIZA 4O7AA 5FH7A 4YATA 3DWYA 4UIXA 4CURA 5E9VA 4QSPA 5DX4A 5E73A 5DFBA 4OUFA 4J0RA 4A9OA 5G4SA 5KTXA 3TLPA 4TS8A 4PCIA 5AD3A 3MXFA 5DKCA 5DYCA 4YYGA 4BW2A 5FE7A 4BJXA 4CUPA 5FE8A 5A83A 5EA1A 4HXPA 5L96A 4PKLA 5CQ4A 3QZSA 4QC3A 5ACYA 4A9NA 4J3IA 2LSPB 3LQIA 5KU3A 4YYIA 5FDZA 4UYFA 3IU6A 5FE6A 2RO1A 5IG6A 4YYHA 5HM0A 3U5PA 4FLPA 4OGIA 5I88A 4MR3A 5JWMA 5HFQA 5CS8A 5ENGA 3HMHA 1WUMA 2YEKA 5I86A 3QZVA 5CQ5A 5HQ7A 4HBWA 4LYSA 5A5NA 5LKTA 4HXKA 5K29A 3ONIA 2RI7A 5EV9A 4MEOA 4UYDA 5CUBA 5CY9A 5EICA 5DYUA 4TYLA 5I29A 4YYNA 5E9KA 5CQTA 3JVLA 4O71A 5FH8A 5D3TA 3Q2EA 2R0VA 3Q2FA 5F60A 4NR5A 5C89A 5FE9A 1JM4B 5EM3A 4QR5A 2NXBA 4PY6A 2YDWA 5H1TA 5EU1A 5BT4A 3P1FA 4NYVA 4UITA 4UIYA 5DYXA 4CFLA 3O34A 5D25A 5EPSA 4A9LA 2L85A 4ZC9A 4HBXA 5E7DA 3RCWA 4XUAA 4N4FA 2D9EA 2YEMA 4LRGA 4HXMA 4YYKA 3U5NA 4TT4A 3MB4A 5ENBA 5LVQA 4XUBA 2RNWA 5FG5A 5CP5A 3MULA 5D3RA 5D3SA 5EPBA 5HCLA 4O7CA 5LUUA 4BW3A 4QUUA 3GG3A 5F36A 4QR3A 4A9KA 5CFWA 5A5QA 5CQ7A 5D0CA 3HMEA 5CUAA 3UVWA 5HQ5A 4HXLA 4TT2A 4X2IA 4LR6A 3P5OA 3SVFA 5ENHA 5L97A 4KV4A 4A9JA 4TTEA 4OGJA 2G4AA 4A9MA 2RFJA 5C7NA 4CFKA 4YBTA 5LKUA 2DWWA 5A82A 4NRAA 4DONA 3UV2A 5FE0A 4HXSA 4YADA 4Z93A 4BW4A 5FBXA 5I89A 4WIVA 4IR4A 2FSAA 5H85A 5E74A 5E3DA 5E0RA 1N72A 3SVHA 5ENCA 3K2JA 2YW5A 5A85A 4WHUA 4QC1A 5D3PA 5FFWA 4TT6A 4A9HA 5BT3A 5EQ1A 5HEMA 2E7NA 2GRCA 5HRVA 4KCXA 2WP1A 5I80A 5FG4A 4ZW1A 2DATA 4YBMA 4YY4A 5CPEA 4NR8A 4Y03A 5KTWA 4MENA 5F63A 4ALGA 4PTBA 5EWVA 4QNSA 4QSQA 5A81A 5IGNA 4NQMA 3MQMA 3FKMX 5D24A 3AADA 3I3JA 4HBVA 5CU8A 4J0SA 3S92A 1E6IA 4Z6HA 3U5OA 2DVVA 4MR5A 5EI4A 3UV5A 4RVRA 2I7KA 5FH6A 5AD2A 5AMFA 5EWDA 5EWHA 2E7OA 4YABA 4NR9A 3U5JA 4O74A 5F1LA 4YH4A 4NRCA 3U5MA 4N4IA 5DBMA 4HXNA 2L84A 3G0LA 4O77A 4NUCA 4MR4A 2OUOA 4YC9A 3IU5A 5EWWA 5EGUA 4LZRA 5FG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7E A;  4C66 A;  5HRW A;  5F2P A;  4NR6 A;  4LZ2 A;  5KTU A;  5D3N A;  5CZG A;  4IOQ A;  4YY6 A;  4QY4 A;  5I7Y A;  3LQJ A;  5JI8 A;  4N4H A;  5H1U A;  4IOO A;  4QEV A;  5J0D A;  5CQA A;  3QZT A;  2D82 A;  5I83 A;  4QYD A;  5IGK A;  5LJ0 A;  4IR5 A;  4TZ8 A;  2R0Y A;  5F62 A;  4AKN A;  4YBS A;  2DVQ A;  5FE3 A;  5FFY A;  4UIV A;  5FE2 A;  5CUG A;  4NR7 A;  5L99 A;  5E3G A;  5EIS A;  5C85 A;  5C8G A;  4ZQL A;  2RNX A;  4QSS A;  5D3L A;  4O72 A;  3NXB A;  4QYL A;  5D3H A;  4NS5 A;  1WUG A;  3P1C A;  5HEL A;  2F6J A;  4CUS A;  4UYF B;  4YYJ A;  4LYW A;  4IR6 A;  5LKZ A;  5HRX A;  4Q0O A;  5DKH A;  5BT5 A;  2YYN A;  2YEL A;  4QEW A;  5TCM A;  4ALH A;  4Z1Q A;  5DLZ A;  3LXJ A;  4MEQ A;  5ENE A;  4NYW A;  5CRZ A;  4QZS A;  5F25 A;  4C67 A;  3O36 A;  5LJ1 A;  4A9F A;  5CTL A;  4XYA A;  4UYG A;  5ENJ A;  4QSW A;  2N9G A;  5FB1 A;  2KTB B;  5CUC A;  3LQH A;  5ETB A;  5DFD A;  5FE1 A;  4O75 A;  5HJC A;  2I8N A;  4QBM A;  5A7C A;  4QST A;  5CQ3 A;  4YAX A;  5E9M A;  4QSV A;  4CUU A;  3P1E A;  4TQN A;  4UIU A;  5ETD A;  5II1 A;  5LJ2 A;  4O7F A;  5EK9 A;  5KHM A;  2MJV B;  5G4R A;  5AME A;  4N4G A;  1F68 A;  4XY8 A;  2RS9 B;  3S91 A;  4TU4 A;  5A5S A;  4QR4 A;  3G0J A;  4O70 A;  5A5R A;  2R0S A;  5E9Y A;  4BW1 A;  5I7X A;  5II2 A;  5DW1 A;  5C87 A;  3ZYU A;  2WP2 A;  4YYD A;  3MUK A;  4PCE A;  3O35 A;  2F6N A;  4N3W A;  4HXR A;  4YK0 A;  2E3K A;  2OSS A;  5CUD A;  5DW2 A;  5EWC A;  3JVM A;  5DFC A;  4CLB A;  4CUT A;  4QB3 A;  2DKW A;  4CUQ A;  4IR3 A;  4NUD A;  2H60 A;  4NR4 A;  4TZ2 A;  2YQD A;  3JVK A;  1ZS5 A;  5H1V A;  4LZS A;  4O76 A;  4CL9 A;  4MEP A;  4XY9 A;  5HFR A;  5DY7 A;  5F5Z A;  4KV1 A;  5FFV A;  5HEN A;  3O33 A;  4QUT A;  5TB6 A;  5DKD A;  5EVA A;  3MB3 A;  5HLS A;  3O37 A;  2L5E A;  4UIW A;  4MR6 A;  5D3J A;  1X0J A;  2RNY A;  5FB0 A;  5I40 A;  3UVD A;  5E9I A;  5DLX A;  2DVR A;  5CQ8 A;  5F1H A;  4A9I A;  4Q0N A;  4O7B A;  5CGP A;  4Z1S A;  5F61 A;  5F3A A;  4LDF A;  5FE5 A;  5ENI A;  5HQ6 A;  5I1Q A;  3HMF A;  5A5P A;  5LKX A;  5LVR A;  4QSX A;  5IGM A;  5KO4 A;  5COI A;  3P1D A;  3JVJ A;  2R10 A;  3SVG A;  5IID A;  3UW9 A;  4BHW A;  5ENF A;  5CQ6 A;  5CRM A;  4PS5 A;  3UV4 A;  5L98 A;  4WHW A;  4LYI A;  4NRB A;  5FE4 A;  4IOR A;  1EQF A;  4YYM A;  4NYX A;  5DYA A;  5C4Q A;  5D7X A;  4F3I A;  3D7C A;  3DAI A;  5CUE A;  3UVX A;  1JSP B;  5IGL A;  4A9E A;  4HXO A;  5IBN A;  5D26 A;  4O78 A;  5EPR A;  4TU6 A;  4NUE A;  4GPJ A;  4UYH A;  5A5O A;  5E9L A;  3AQA A;  2OO1 A;  4QSR A;  4NXJ A;  4E96 A;  4NQN A;  4QEU A;  3UVY A;  4Z6I A;  2DVS A;  4UYE A;  3LJW A;  4LC2 A;  4J1P A;  5EP7 A;  4HBY A;  3U5K A;  5L8T A;  4YH3 A;  3U5L A;  5L8U A;  4QSU A;  4UIZ A;  4O7A A;  5FH7 A;  4YAT A;  3DWY A;  4UIX A;  4CUR A;  5E9V A;  4QSP A;  5DX4 A;  5E73 A;  5DFB A;  4OUF A;  4J0R A;  4A9O A;  5G4S A;  5KTX A;  3TLP A;  4TS8 A;  4PCI A;  5AD3 A;  3MXF A;  5DKC A;  5DYC A;  4YYG A;  4BW2 A;  5FE7 A;  4BJX A;  4CUP A;  5FE8 A;  5A83 A;  5EA1 A;  4HXP A;  5L96 A;  4PKL A;  5CQ4 A;  3QZS A;  4QC3 A;  5ACY A;  4A9N A;  4J3I A;  2LSP B;  3LQI A;  5KU3 A;  4YYI A;  5FDZ A;  4UYF A;  3IU6 A;  5FE6 A;  2RO1 A;  5IG6 A;  4YYH A;  5HM0 A;  3U5P A;  4FLP A;  4OGI A;  5I88 A;  4MR3 A;  5JWM A;  5HFQ A;  5CS8 A;  5ENG A;  3HMH A;  1WUM A;  2YEK A;  5I86 A;  3QZV A;  5CQ5 A;  5HQ7 A;  4HBW A;  4LYS A;  5A5N A;  5LKT A;  4HXK A;  5K29 A;  3ONI A;  2RI7 A;  5EV9 A;  4MEO A;  4UYD A;  5CUB A;  5CY9 A;  5EIC A;  5DYU A;  4TYL A;  5I29 A;  4YYN A;  5E9K A;  5CQT A;  3JVL A;  4O71 A;  5FH8 A;  5D3T A;  3Q2E A;  2R0V A;  3Q2F A;  5F60 A;  4NR5 A;  5C89 A;  5FE9 A;  1JM4 B;  5EM3 A;  4QR5 A;  2NXB A;  4PY6 A;  2YDW A;  5H1T A;  5EU1 A;  5BT4 A;  3P1F A;  4NYV A;  4UIT A;  4UIY A;  5DYX A;  4CFL A;  3O34 A;  5D25 A;  5EPS A;  4A9L A;  2L85 A;  4ZC9 A;  4HBX A;  5E7D A;  3RCW A;  4XUA A;  4N4F A;  2D9E A;  2YEM A;  4LRG A;  4HXM A;  4YYK A;  3U5N A;  4TT4 A;  3MB4 A;  5ENB A;  5LVQ A;  4XUB A;  2RNW A;  5FG5 A;  5CP5 A;  3MUL A;  5D3R A;  5D3S A;  5EPB A;  5HCL A;  4O7C A;  5LUU A;  4BW3 A;  4QUU A;  3GG3 A;  5F36 A;  4QR3 A;  4A9K A;  5CFW A;  5A5Q A;  5CQ7 A;  5D0C A;  3HME A;  5CUA A;  3UVW A;  5HQ5 A;  4HXL A;  4TT2 A;  4X2I A;  4LR6 A;  3P5O A;  3SVF A;  5ENH A;  5L97 A;  4KV4 A;  4A9J A;  4TTE A;  4OGJ A;  2G4A A;  4A9M A;  2RFJ A;  5C7N A;  4CFK A;  4YBT A;  5LKU A;  2DWW A;  5A82 A;  4NRA A;  4DON A;  3UV2 A;  5FE0 A;  4HXS A;  4YAD A;  4Z93 A;  4BW4 A;  5FBX A;  5I89 A;  4WIV A;  4IR4 A;  2FSA A;  5H85 A;  5E74 A;  5E3D A;  5E0R A;  1N72 A;  3SVH A;  5ENC A;  3K2J A;  2YW5 A;  5A85 A;  4WHU A;  4QC1 A;  5D3P A;  5FFW A;  4TT6 A;  4A9H A;  5BT3 A;  5EQ1 A;  5HEM A;  2E7N A;  2GRC A;  5HRV A;  4KCX A;  2WP1 A;  5I80 A;  5FG4 A;  4ZW1 A;  2DAT A;  4YBM A;  4YY4 A;  5CPE A;  4NR8 A;  4Y03 A;  5KTW A;  4MEN A;  5F63 A;  4ALG A;  4PTB A;  5EWV A;  4QNS A;  4QSQ A;  5A81 A;  5IGN A;  4NQM A;  3MQM A;  3FKM X;  5D24 A;  3AAD A;  3I3J A;  4HBV A;  5CU8 A;  4J0S A;  3S92 A;  1E6I A;  4Z6H A;  3U5O A;  2DVV A;  4MR5 A;  5EI4 A;  3UV5 A;  4RVR A;  2I7K A;  5FH6 A;  5AD2 A;  5AMF A;  5EWD A;  5EWH A;  2E7O A;  4YAB A;  4NR9 A;  3U5J A;  4O74 A;  5F1L A;  4YH4 A;  4NRC A;  3U5M A;  4N4I A;  5DBM A;  4HXN A;  2L84 A;  3G0L A;  4O77 A;  4NUC A;  4MR4 A;  2OUO A;  4YC9 A;  3IU5 A;  5EWW A;  5EGU A;  4LZR A;  5FG6 A; 
#chains in the Genus database with same CATH topology
 4O7E A;  4C66 A;  5HRW A;  5F2P A;  4NR6 A;  4LZ2 A;  5KTU A;  5D3N A;  5CZG A;  4IOQ A;  4YY6 A;  4QY4 A;  5I7Y A;  3LQJ A;  5JI8 A;  4N4H A;  5H1U A;  4IOO A;  4QEV A;  5J0D A;  5CQA A;  3QZT A;  2D82 A;  5I83 A;  4QYD A;  5IGK A;  5LJ0 A;  4IR5 A;  4TZ8 A;  2R0Y A;  5F62 A;  4AKN A;  4YBS A;  2DVQ A;  5FE3 A;  5FFY A;  4UIV A;  5FE2 A;  5CUG A;  4NR7 A;  5L99 A;  5E3G A;  5EIS A;  5C85 A;  5C8G A;  4ZQL A;  2RNX A;  4QSS A;  5D3L A;  4O72 A;  3NXB A;  4QYL A;  5D3H A;  4NS5 A;  1WUG A;  3P1C A;  5HEL A;  2F6J A;  4CUS A;  4UYF B;  4YYJ A;  4LYW A;  4IR6 A;  5LKZ A;  5HRX A;  4Q0O A;  5DKH A;  5BT5 A;  2YYN A;  2YEL A;  4QEW A;  5TCM A;  4ALH A;  4Z1Q A;  5DLZ A;  2EJN A;  3LXJ A;  4MEQ A;  5ENE A;  4NYW A;  5CRZ A;  4QZS A;  5F25 A;  4C67 A;  3O36 A;  5LJ1 A;  4A9F A;  5CTL A;  4XYA A;  4UYG A;  5ENJ A;  4QSW A;  2N9G A;  4AI6 A;  5FB1 A;  2KTB B;  5CUC A;  3LQH A;  5ETB A;  5DFD A;  5FE1 A;  4O75 A;  5HJC A;  2I8N A;  4QBM A;  5A7C A;  4QST A;  5CQ3 A;  4YAX A;  5E9M A;  4QSV A;  4CUU A;  3P1E A;  4TQN A;  4UIU A;  5ETD A;  5II1 A;  5LJ2 A;  4O7F A;  5EK9 A;  5KHM A;  2MJV B;  5G4R A;  5AME A;  4N4G A;  1F68 A;  4XY8 A;  2RS9 B;  3S91 A;  4TU4 A;  5A5S A;  4QR4 A;  3G0J A;  4O70 A;  5A5R A;  2R0S A;  5E9Y A;  4BW1 A;  5I7X A;  5II2 A;  5DW1 A;  5C87 A;  3ZYU A;  2WP2 A;  4YYD A;  3MUK A;  4PCE A;  3O35 A;  2F6N A;  4N3W A;  4HXR A;  4YK0 A;  2E3K A;  2OSS A;  5CUD A;  5DW2 A;  5EWC A;  3JVM A;  5DFC A;  4CLB A;  4CUT A;  4QB3 A;  2DKW A;  4CUQ A;  4IR3 A;  4NUD A;  2H60 A;  4NR4 A;  4TZ2 A;  2YQD A;  3JVK A;  1ZS5 A;  5H1V A;  4LZS A;  4O76 A;  4CL9 A;  4MEP A;  4XY9 A;  1PUO A;  5HFR A;  5DY7 A;  5F5Z A;  4KV1 A;  5FFV A;  5HEN A;  3O33 A;  4QUT A;  5TB6 A;  5DKD A;  5EVA A;  3MB3 A;  5HLS A;  3O37 A;  2L5E A;  4UIW A;  4MR6 A;  5D3J A;  1X0J A;  2RNY A;  5FB0 A;  5I40 A;  3UVD A;  5E9I A;  5DLX A;  2DVR A;  5CQ8 A;  5F1H A;  4A9I A;  4Q0N A;  4O7B A;  5CGP A;  4Z1S A;  5F61 A;  5F3A A;  4LDF A;  5FE5 A;  5ENI A;  5HQ6 A;  5I1Q A;  3HMF A;  5A5P A;  5LKX A;  5LVR A;  4QSX A;  5IGM A;  5KO4 A;  5COI A;  3P1D A;  3JVJ A;  2R10 A;  3SVG A;  5IID A;  3UW9 A;  4BHW A;  5ENF A;  5CQ6 A;  5CRM A;  4PS5 A;  3UV4 A;  5L98 A;  4WHW A;  4LYI A;  4NRB A;  5FE4 A;  4IOR A;  1EQF A;  4YYM A;  4NYX A;  5DYA A;  5C4Q A;  5D7X A;  4F3I A;  3D7C A;  3DAI A;  5CUE A;  3UVX A;  1JSP B;  5IGL A;  4A9E A;  4HXO A;  5IBN A;  5D26 A;  4O78 A;  5EPR A;  4TU6 A;  4NUE A;  4GPJ A;  4UYH A;  5A5O A;  5E9L A;  3AQA A;  4QSR A;  2OO1 A;  4NXJ A;  4E96 A;  4NQN A;  4QEU A;  3UVY A;  4Z6I A;  2DVS A;  4UYE A;  3LJW A;  4LC2 A;  4J1P A;  5EP7 A;  4HBY A;  3U5K A;  5L8T A;  4YH3 A;  3U5L A;  5L8U A;  4QSU A;  4UIZ A;  4O7A A;  5FH7 A;  4YAT A;  3DWY A;  4UIX A;  4CUR A;  1ZKR A;  5E9V A;  4QSP A;  5DX4 A;  5E73 A;  5DFB A;  4OUF A;  4J0R A;  4A9O A;  5G4S A;  5KTX A;  3TLP A;  4TS8 A;  4PCI A;  5AD3 A;  3MXF A;  5DKC A;  5DYC A;  4YYG A;  4BW2 A;  5FE7 A;  4BJX A;  4CUP A;  5FE8 A;  5A83 A;  5EA1 A;  4HXP A;  5L96 A;  4PKL A;  5CQ4 A;  3QZS A;  4QC3 A;  5ACY A;  4A9N A;  4J3I A;  2LSP B;  3LQI A;  5KU3 A;  4YYI A;  5FDZ A;  4UYF A;  3IU6 A;  5FE6 A;  2RO1 A;  5IG6 A;  4YYH A;  5HM0 A;  3U5P A;  4FLP A;  4OGI A;  5I88 A;  4AKG A;  4MR3 A;  5JWM A;  5HFQ A;  5CS8 A;  5ENG A;  3HMH A;  1WUM A;  2YEK A;  5I86 A;  3QZV A;  3D1D A;  5CQ5 A;  5HQ7 A;  4HBW A;  4LYS A;  5A5N A;  5LKT A;  4HXK A;  5K29 A;  3ONI A;  2RI7 A;  5EV9 A;  4MEO A;  4UYD A;  5CUB A;  5CY9 A;  5EIC A;  5DYU A;  4TYL A;  5I29 A;  4YYN A;  5E9K A;  5CQT A;  3JVL A;  4O71 A;  5FH8 A;  5D3T A;  3Q2E A;  2R0V A;  3Q2F A;  5F60 A;  4NR5 A;  5C89 A;  5FE9 A;  1JM4 B;  5EM3 A;  4QR5 A;  2NXB A;  4PY6 A;  2YDW A;  5H1T A;  5EU1 A;  5BT4 A;  3P1F A;  4NYV A;  4UIT A;  4UIY A;  5DYX A;  4CFL A;  3O34 A;  5D25 A;  5EPS A;  4A9L A;  2L85 A;  4ZC9 A;  4HBX A;  5E7D A;  3RCW A;  4XUA A;  4N4F A;  2D9E A;  2YEM A;  4LRG A;  3ERR A;  4HXM A;  4YYK A;  3VKH A;  3U5N A;  4TT4 A;  3MB4 A;  5ENB A;  5LVQ A;  4XUB A;  2RNW A;  5FG5 A;  5CP5 A;  3MUL A;  5D3R A;  5D3S A;  5EPB A;  5HCL A;  4O7C A;  5LUU A;  4BW3 A;  4QUU A;  3GG3 A;  5F36 A;  4QR3 A;  4A9K A;  5CFW A;  5A5Q A;  5CQ7 A;  4AKI A;  5D0C A;  3HME A;  5CUA A;  3UVW A;  3VKG A;  5HQ5 A;  4HXL A;  4TT2 A;  4X2I A;  3D1B A;  4LR6 A;  3P5O A;  3SVF A;  5ENH A;  5L97 A;  4KV4 A;  4A9J A;  4TTE A;  4OGJ A;  2G4A A;  4A9M A;  2RFJ A;  5C7N A;  4CFK A;  4YBT A;  5LKU A;  2DWW A;  5A82 A;  4NRA A;  4DON A;  3UV2 A;  5FE0 A;  4AKH A;  4HXS A;  4YAD A;  4Z93 A;  4BW4 A;  5FBX A;  5I89 A;  4WIV A;  4IR4 A;  2FSA A;  5H85 A;  5E74 A;  5E3D A;  5E0R A;  1N72 A;  3SVH A;  5ENC A;  3K2J A;  2YW5 A;  5A85 A;  4WHU A;  4QC1 A;  5D3P A;  5FFW A;  4TT6 A;  4A9H A;  5BT3 A;  5EQ1 A;  5HEM A;  2E7N A;  2GRC A;  5HRV A;  4KCX A;  2WP1 A;  5I80 A;  5FG4 A;  4ZW1 A;  2DAT A;  4YBM A;  4YY4 A;  5CPE A;  4NR8 A;  4Y03 A;  5KTW A;  4MEN A;  5F63 A;  4ALG A;  4PTB A;  5EWV A;  4QNS A;  4QSQ A;  5A81 A;  5IGN A;  4NQM A;  3MQM A;  3FKM X;  5D24 A;  3AAD A;  3I3J A;  4HBV A;  5CU8 A;  4J0S A;  3S92 A;  1E6I A;  4Z6H A;  3U5O A;  2DVV A;  4MR5 A;  5EI4 A;  3UV5 A;  4RVR A;  2I7K A;  5FH6 A;  5AD2 A;  5AMF A;  5EWD A;  5EWH A;  2E7O A;  4YAB A;  4NR9 A;  3U5J A;  4O74 A;  5F1L A;  4YH4 A;  4NRC A;  3U5M A;  4N4I A;  5DBM A;  4HXN A;  2L84 A;  3G0L A;  4O77 A;  4NUC A;  4MR4 A;  2OUO A;  4YC9 A;  3IU5 A;  5EWW A;  5EGU A;  4LZR A;  5FG6 A; 
#chains in the Genus database with same CATH homology
 4O7E A;  4C66 A;  5HRW A;  5F2P A;  4NR6 A;  4LZ2 A;  5KTU A;  5D3N A;  5CZG A;  4IOQ A;  4YY6 A;  4QY4 A;  5I7Y A;  3LQJ A;  5JI8 A;  4N4H A;  5H1U A;  4IOO A;  4QEV A;  5J0D A;  5CQA A;  3QZT A;  2D82 A;  5I83 A;  4QYD A;  5IGK A;  5LJ0 A;  4IR5 A;  4TZ8 A;  2R0Y A;  5F62 A;  4AKN A;  4YBS A;  2DVQ A;  5FE3 A;  5FFY A;  4UIV A;  5FE2 A;  5CUG A;  4NR7 A;  5L99 A;  5E3G A;  5EIS A;  5C85 A;  5C8G A;  4ZQL A;  2RNX A;  4QSS A;  5D3L A;  4O72 A;  3NXB A;  4QYL A;  5D3H A;  4NS5 A;  1WUG A;  3P1C A;  5HEL A;  2F6J A;  4CUS A;  4UYF B;  4YYJ A;  4LYW A;  4IR6 A;  5LKZ A;  5HRX A;  4Q0O A;  5DKH A;  5BT5 A;  2YYN A;  2YEL A;  4QEW A;  5TCM A;  4ALH A;  4Z1Q A;  5DLZ A;  3LXJ A;  4MEQ A;  5ENE A;  4NYW A;  5CRZ A;  4QZS A;  5F25 A;  4C67 A;  3O36 A;  5LJ1 A;  4A9F A;  5CTL A;  4XYA A;  4UYG A;  5ENJ A;  4QSW A;  2N9G A;  5FB1 A;  2KTB B;  5CUC A;  3LQH A;  5ETB A;  5DFD A;  5FE1 A;  4O75 A;  5HJC A;  2I8N A;  4QBM A;  5A7C A;  4QST A;  5CQ3 A;  4YAX A;  5E9M A;  4QSV A;  4CUU A;  3P1E A;  4TQN A;  4UIU A;  5ETD A;  5II1 A;  5LJ2 A;  4O7F A;  5EK9 A;  5KHM A;  2MJV B;  5G4R A;  5AME A;  4N4G A;  1F68 A;  4XY8 A;  2RS9 B;  3S91 A;  4TU4 A;  5A5S A;  4QR4 A;  3G0J A;  4O70 A;  5A5R A;  2R0S A;  5E9Y A;  4BW1 A;  5I7X A;  5II2 A;  5DW1 A;  5C87 A;  3ZYU A;  2WP2 A;  4YYD A;  3MUK A;  4PCE A;  3O35 A;  2F6N A;  4N3W A;  4HXR A;  4YK0 A;  2E3K A;  2OSS A;  5CUD A;  5DW2 A;  5EWC A;  3JVM A;  5DFC A;  4CLB A;  4CUT A;  4QB3 A;  2DKW A;  4CUQ A;  4IR3 A;  4NUD A;  2H60 A;  4NR4 A;  4TZ2 A;  2YQD A;  3JVK A;  1ZS5 A;  5H1V A;  4LZS A;  4O76 A;  4CL9 A;  4MEP A;  4XY9 A;  5HFR A;  5DY7 A;  5F5Z A;  4KV1 A;  5FFV A;  5HEN A;  3O33 A;  4QUT A;  5TB6 A;  5DKD A;  5EVA A;  3MB3 A;  5HLS A;  3O37 A;  2L5E A;  4UIW A;  4MR6 A;  5D3J A;  1X0J A;  2RNY A;  5FB0 A;  5I40 A;  3UVD A;  5E9I A;  5DLX A;  2DVR A;  5CQ8 A;  5F1H A;  4A9I A;  4Q0N A;  4O7B A;  5CGP A;  4Z1S A;  5F61 A;  5F3A A;  4LDF A;  5FE5 A;  5ENI A;  5HQ6 A;  5I1Q A;  3HMF A;  5A5P A;  5LKX A;  5LVR A;  4QSX A;  5IGM A;  5KO4 A;  5COI A;  3P1D A;  3JVJ A;  2R10 A;  3SVG A;  5IID A;  3UW9 A;  4BHW A;  5ENF A;  5CQ6 A;  5CRM A;  4PS5 A;  3UV4 A;  5L98 A;  4WHW A;  4LYI A;  4NRB A;  5FE4 A;  4IOR A;  1EQF A;  4YYM A;  4NYX A;  5DYA A;  5C4Q A;  5D7X A;  4F3I A;  3D7C A;  3DAI A;  5CUE A;  3UVX A;  1JSP B;  5IGL A;  4A9E A;  4HXO A;  5IBN A;  5D26 A;  4O78 A;  5EPR A;  4TU6 A;  4NUE A;  4GPJ A;  4UYH A;  5A5O A;  5E9L A;  3AQA A;  2OO1 A;  4QSR A;  4NXJ A;  4E96 A;  4NQN A;  4QEU A;  3UVY A;  4Z6I A;  2DVS A;  4UYE A;  3LJW A;  4LC2 A;  4J1P A;  5EP7 A;  4HBY A;  3U5K A;  5L8T A;  4YH3 A;  3U5L A;  5L8U A;  4QSU A;  4UIZ A;  4O7A A;  5FH7 A;  4YAT A;  3DWY A;  4UIX A;  4CUR A;  5E9V A;  4QSP A;  5DX4 A;  5E73 A;  5DFB A;  4OUF A;  4J0R A;  4A9O A;  5G4S A;  5KTX A;  3TLP A;  4TS8 A;  4PCI A;  5AD3 A;  3MXF A;  5DKC A;  5DYC A;  4YYG A;  4BW2 A;  5FE7 A;  4BJX A;  4CUP A;  5FE8 A;  5A83 A;  5EA1 A;  4HXP A;  5L96 A;  4PKL A;  5CQ4 A;  3QZS A;  4QC3 A;  5ACY A;  4A9N A;  4J3I A;  2LSP B;  3LQI A;  5KU3 A;  4YYI A;  5FDZ A;  4UYF A;  3IU6 A;  5FE6 A;  2RO1 A;  5IG6 A;  4YYH A;  5HM0 A;  3U5P A;  4FLP A;  4OGI A;  5I88 A;  4MR3 A;  5JWM A;  5HFQ A;  5CS8 A;  5ENG A;  3HMH A;  1WUM A;  2YEK A;  5I86 A;  3QZV A;  5CQ5 A;  5HQ7 A;  4HBW A;  4LYS A;  5A5N A;  5LKT A;  4HXK A;  5K29 A;  3ONI A;  2RI7 A;  5EV9 A;  4MEO A;  4UYD A;  5CUB A;  5CY9 A;  5EIC A;  5DYU A;  4TYL A;  5I29 A;  4YYN A;  5E9K A;  5CQT A;  3JVL A;  4O71 A;  5FH8 A;  5D3T A;  3Q2E A;  2R0V A;  3Q2F A;  5F60 A;  4NR5 A;  5C89 A;  5FE9 A;  1JM4 B;  5EM3 A;  4QR5 A;  2NXB A;  4PY6 A;  2YDW A;  5H1T A;  5EU1 A;  5BT4 A;  3P1F A;  4NYV A;  4UIT A;  4UIY A;  5DYX A;  4CFL A;  3O34 A;  5D25 A;  5EPS A;  4A9L A;  2L85 A;  4ZC9 A;  4HBX A;  5E7D A;  3RCW A;  4XUA A;  4N4F A;  2D9E A;  2YEM A;  4LRG A;  4HXM A;  4YYK A;  3U5N A;  4TT4 A;  3MB4 A;  5ENB A;  5LVQ A;  4XUB A;  2RNW A;  5FG5 A;  5CP5 A;  3MUL A;  5D3R A;  5D3S A;  5EPB A;  5HCL A;  4O7C A;  5LUU A;  4BW3 A;  4QUU A;  3GG3 A;  5F36 A;  4QR3 A;  4A9K A;  5CFW A;  5A5Q A;  5CQ7 A;  5D0C A;  3HME A;  5CUA A;  3UVW A;  5HQ5 A;  4HXL A;  4TT2 A;  4X2I A;  4LR6 A;  3P5O A;  3SVF A;  5ENH A;  5L97 A;  4KV4 A;  4A9J A;  4TTE A;  4OGJ A;  2G4A A;  4A9M A;  2RFJ A;  5C7N A;  4CFK A;  4YBT A;  5LKU A;  2DWW A;  5A82 A;  4NRA A;  4DON A;  3UV2 A;  5FE0 A;  4HXS A;  4YAD A;  4Z93 A;  4BW4 A;  5FBX A;  5I89 A;  4WIV A;  4IR4 A;  2FSA A;  5H85 A;  5E74 A;  5E3D A;  5E0R A;  1N72 A;  3SVH A;  5ENC A;  3K2J A;  2YW5 A;  5A85 A;  4WHU A;  4QC1 A;  5D3P A;  5FFW A;  4TT6 A;  4A9H A;  5BT3 A;  5EQ1 A;  5HEM A;  2E7N A;  2GRC A;  5HRV A;  4KCX A;  2WP1 A;  5I80 A;  5FG4 A;  4ZW1 A;  2DAT A;  4YBM A;  4YY4 A;  5CPE A;  4NR8 A;  4Y03 A;  5KTW A;  4MEN A;  5F63 A;  4ALG A;  4PTB A;  5EWV A;  4QNS A;  4QSQ A;  5A81 A;  5IGN A;  4NQM A;  3MQM A;  3FKM X;  5D24 A;  3AAD A;  3I3J A;  4HBV A;  5CU8 A;  4J0S A;  3S92 A;  1E6I A;  4Z6H A;  3U5O A;  2DVV A;  4MR5 A;  5EI4 A;  3UV5 A;  4RVR A;  2I7K A;  5FH6 A;  5AD2 A;  5AMF A;  5EWD A;  5EWH A;  2E7O A;  4YAB A;  4NR9 A;  3U5J A;  4O74 A;  5F1L A;  4YH4 A;  4NRC A;  3U5M A;  4N4I A;  5DBM A;  4HXN A;  2L84 A;  3G0L A;  4O77 A;  4NUC A;  4MR4 A;  2OUO A;  4YC9 A;  3IU5 A;  5EWW A;  5EGU A;  4LZR A;  5FG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...