4QUUA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) complexed with histone h4-k(ac)5
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords ATPase family AAA domain-containing protein 2
publication title Atad2 is a generalist facilitator of chromatin dynamics in embryonic stem cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4quuA00
5E73A 5EWCA 5E3DA 4LZSA 4X2IA 5L97A 4UIVA 4QC1A 2DVQA 2D9EA 5E9IA 4MEPA 4OGJA 5I29A 4ZC9A 4CURA 4NR8A 5AMFA 5EPBA 5EP7A 4YYKA 5IGLA 4UIXA 2E3KA 2RI7A 3JVMA 4QR3A 5FE0A 4LRGA 4QYDA 4A9FA 3RCWA 5F63A 4Z93A 4O74A 5L8TA 4HXOA 5A5OA 2L84A 4YBSA 4A9HA 2OUOA 5FG5A 4NR7A 4YBTA 4TU6A 4HXMA 5KTWA 5CPEA 4BHWA 4J0SA 4C66A 5ENCA 5CUAA 5F2PA 5L98A 2N9GA 4YAXA 4LYWA 4C67A 4BJXA 5IG6A 3O36A 5D3HA 5DYXA 4ALHA 2NXBA 3UW9A 4J3IA 4UYFA 5C87A 4UYHA 3HMFA 2DATA 4NR6A 5CUEA 5G4RA 4RVRA 5FDZA 5FB0A 2WP2A 4XY9A 4HXNA 3G0JA 5H1UA 3SVFA 4PKLA 5DX4A 4N4IA 4TZ2A 5DLZA 5F1LA 3JVLA 2YEKA 5I40A 3U5PA 5KO4A 4A9EA 4HXLA 5H85A 4QY4A 3MQMA 4QZSA 4NUDA 3UVDA 4HBVA 2WP1A 2DVVA 5EQ1A 4CFKA 5TB6A 4NR5A 4A9IA 4J0RA 5FFWA 3QZTA 4XUBA 4UIYA 1ZS5A 5BT4A 5K29A 5LJ0A 4KV4A 2G4AA 5IBNA 4QSQA 3Q2EA 4UITA 4FLPA 4O7FA 4WIVA 2DKWA 4YYDA 4CUQA 5FH6A 5D7XA 5FE8A 5FE1A 4UYGA 5C8GA 5IGKA 2R0YA 4XY8A 4O78A 5D3SA 5E74A 4NYVA 4UYEA 5E9VA 4QC3A 3K2JA 5DKHA 4CLBA 3QZVA 4IR4A 5CUCA 5CQTA 2RO1A 2YW5A 5DFCA 4CUTA 5CTLA 4YH4A 5IIDA 3S91A 5DBMA 5ENGA 5CFWA 5EPRA 4QSWA 3U5JA 5F3AA 4QEVA 3UVWA 4LC2A 4HBWA 5D3PA 4O71A 3UVYA 4CUSA 5AD3A 5A5PA 1F68A 5D3NA 4YY4A 4LZRA 5C89A 4QR5A 4O7AA 5ETBA 3MULA 4ZW1A 5FG4A 4O7CA 4LYIA 2RNXA 4MR3A 4QSTA 4QUUA 5L99A 1JM4B 4YY6A 4YBMA 5A85A 4NUCA 4BW1A 3SVHA 4Y03A 4TT4A 5FE2A 4O77A 4QB3A 3QZSA 5F25A 3Q2FA 3ONIA 5CGPA 4QUTA 4MEOA 5D25A 5DFBA 4TT2A 5LKUA 2I8NA 5F1HA 5E9KA 3LQHA 4Z6IA 4F3IA 4Q0NA 4NRBA 5A5SA 3HMHA 5AMEA 4Q0OA 4CFLA 4MR6A 4ZQLA 2E7OA 5I89A 5HRXA 4ALGA 3UV5A 4QEUA 5DFDA 5HRVA 5ENBA 5G4SA 2YQDA 2F6JA 4MR5A 5A5RA 5DYUA 4TS8A 3MUKA 4IR6A 4N4FA 5D3RA 5HRWA 4LR6A 3LQJA 4QNSA 5H1TA 5LVRA 4BW2A 3MXFA 5F62A 4A9KA 3AQAA 5L8UA 5CRMA 4YC9A 5J0DA 5FE4A 5H1VA 1N72A 5EM3A 5EA1A 5A83A 5D3JA 4BW4A 5CRZA 3IU6A 5CUGA 4J1PA 3JVKA 5CQ4A 5A82A 4NQNA 3UVXA 4PCEA 4HXSA 4TT6A 4PCIA 5CUBA 4UIUA 3FKMX 3SVGA 5EISA 5CY9A 5DW1A 3LXJA 4WHWA 4WHUA 4YYJA 5I7XA 5HELA 4Z6HA 5FG6A 4LYSA 2OSSA 5HQ7A 5HFQA 4YYNA 4UIWA 3U5OA 5EWDA 2FSAA 2YYNA 2YDWA 2LSPB 3O35A 5A5QA 4MEQA 5CQ3A 5ENFA 4YH3A 5FFYA 4QEWA 3UV2A 3MB4A 4QYLA 1WUMA 3HMEA 5CP5A 4KCXA 2RNWA 5HLSA 2RFJA 4N3WA 5HQ6A 4QSUA 5EICA 4QSPA 4A9JA 5CUDA 5ENIA 4TTEA 4HBXA 2I7KA 4AKNA 5FH8A 5D3LA 5D3TA 4OGIA 2E7NA 5F36A 2RS9B 3DAIA 5E9MA 5I7YA 4HXRA 3P5OA 4UYDA 4TZ8A 4O7EA 4YYHA 5FB1A 2KTBB 3O33A 4HBYA 4TQNA 4UIZA 5F61A 4YABA 4NRCA 4N4HA 5FBXA 3GG3A 4IOQA 4A9NA 2OO1A 4PTBA 3I3JA 3AADA 5EGUA 5ETDA 5F60A 3U5LA 5KTXA 4O7BA 4QBMA 3P1FA 5E7DA 4LDFA 5KU3A 5EWVA 3P1DA 5BT3A 4MENA 5TCMA 4CUPA 3LJWA 5DKCA 5EK9A 5CQ7A 4A9MA 5BT5A 3U5MA 2H60A 5E9YA 5HCLA 5FE5A 5CZGA 5HQ5A 5FE3A 4NQMA 5D0CA 2R10A 3P1CA 3O37A 5DYAA 5LKXA 5EPSA 2YELA 5E3GA 5JI8A 4O76A 5CU8A 4QSSA 5LJ1A 4QSVA 3TLPA 5EV9A 3P1EA 4TYLA 4N4GA 5DY7A 5LUUA 3JVJA 5II2A 5FH7A 5FFVA 5A81A 4NS5A 5CQ8A 5DLXA 2DVRA 4YATA 4PY6A 5IGMA 5EI4A 3UV4A 4YK0A 2D82A 5ENEA 5I1QA 4LZ2A 3DWYA 3LQIA 3O34A 5CQAA 2R0SA 4O70A 5CQ6A 2MJVB 4PS5A 5CQ5A 1X0JA 5HJCA 1WUGA 5F5ZA 5A7CA 5KTUA 4IR3A 5LVQA 4YYGA 5I88A 5EWWA 4NYXA 5DW2A 2GRCA 5IGNA 4TU4A 2RNYA 5I80A 5FE7A 4UYFB 4A9LA 5HENA 5ACYA 5C4QA 5E0RA 3S92A 4E96A 5KHMA 4NRAA 5HFRA 2L85A 5LKZA 1JSPB 4O72A 2DWWA 4NR4A 4YYIA 5EWHA 4OUFA 4NXJA 5C7NA 5DYCA 4BW3A 3IU5A 5COIA 5C85A 5HM0A 5FE9A 5A5NA 5I86A 3MB3A 4HXPA 4DONA 4CL9A 2YEMA 4IORA 4NUEA 5JWMA 4Z1QA 4NYWA 5D26A 5CS8A 5EU1A 5AD2A 4XYAA 4XUAA 5I83A 4QR4A 4IOOA 4QSRA 4YADA 3NXBA 3D7CA 3U5NA 4HXKA 4GPJA 2R0VA 2L5EA 4YYMA 4O75A 5EVAA 5LJ2A 5LKTA 1E6IA 2DVSA 5FE6A 4Z1SA 2F6NA 4QSXA 5D24A 5E9LA 4MR4A 4KV1A 1EQFA 3G0LA 5DKDA 5L96A 5ENHA 5HEMA 4NR9A 5ENJA 5II1A 3U5KA 3ZYUA 4CUUA 4IR5A 4A9OA
chains in the Genus database with same CATH superfamily
5E73A 5EWCA 5E3DA 4LZSA 4X2IA 5L97A 4UIVA 4QC1A 2DVQA 2D9EA 5E9IA 4MEPA 4OGJA 5I29A 4ZC9A 4CURA 4NR8A 5AMFA 5EPBA 5EP7A 4YYKA 5IGLA 4UIXA 2E3KA 2RI7A 3JVMA 4QR3A 5FE0A 4LRGA 4QYDA 4A9FA 3RCWA 5F63A 4Z93A 4O74A 5L8TA 4HXOA 5A5OA 2L84A 4YBSA 4A9HA 2OUOA 5FG5A 4NR7A 4YBTA 4TU6A 4HXMA 5KTWA 5CPEA 4BHWA 4J0SA 4C66A 5ENCA 5CUAA 5F2PA 5L98A 2N9GA 4YAXA 4LYWA 4C67A 4BJXA 5IG6A 3O36A 2EJNA 5D3HA 5DYXA 4ALHA 2NXBA 3UW9A 4J3IA 4UYFA 5C87A 4UYHA 3HMFA 2DATA 4NR6A 5CUEA 5G4RA 4RVRA 5FDZA 5FB0A 2WP2A 4XY9A 4HXNA 3G0JA 5H1UA 3SVFA 4PKLA 5DX4A 4N4IA 4TZ2A 5DLZA 3D1BA 3JVLA 5F1LA 2YEKA 5I40A 3U5PA 5KO4A 4A9EA 4HXLA 5H85A 4QY4A 3MQMA 4QZSA 4NUDA 3UVDA 4HBVA 2WP1A 2DVVA 5EQ1A 4CFKA 5TB6A 4NR5A 4A9IA 4J0RA 5FFWA 3QZTA 4XUBA 4UIYA 1ZS5A 5BT4A 5K29A 5LJ0A 4KV4A 2G4AA 5IBNA 4QSQA 3Q2EA 4UITA 4FLPA 4O7FA 4WIVA 2DKWA 4YYDA 4CUQA 5FH6A 5D7XA 5FE8A 5FE1A 4UYGA 5C8GA 5IGKA 2R0YA 4XY8A 4O78A 5D3SA 5E74A 4NYVA 4UYEA 5E9VA 4QC3A 3K2JA 5DKHA 4CLBA 3VKGA 3QZVA 4IR4A 5CUCA 5CQTA 2RO1A 2YW5A 5DFCA 4CUTA 5CTLA 4YH4A 5IIDA 3S91A 5DBMA 5ENGA 5CFWA 5EPRA 4QSWA 3U5JA 5F3AA 4QEVA 3UVWA 4LC2A 4HBWA 5D3PA 4O71A 3UVYA 4CUSA 5AD3A 5A5PA 1F68A 1PUOA 5D3NA 4YY4A 4LZRA 5C89A 4QR5A 4O7AA 5ETBA 3MULA 4ZW1A 5FG4A 4O7CA 4LYIA 2RNXA 4MR3A 4QSTA 4QUUA 5L99A 1JM4B 4YY6A 4YBMA 5A85A 4NUCA 4BW1A 3SVHA 4Y03A 4TT4A 5FE2A 4O77A 4QB3A 3QZSA 5F25A 3Q2FA 3ONIA 5CGPA 4QUTA 4MEOA 5D25A 5DFBA 4TT2A 5LKUA 2I8NA 5F1HA 4AKIA 5E9KA 3LQHA 4Z6IA 4F3IA 4Q0NA 4NRBA 5A5SA 3HMHA 5AMEA 4Q0OA 4CFLA 4MR6A 4ZQLA 2E7OA 5I89A 5HRXA 4ALGA 3UV5A 4AI6A 4QEUA 5DFDA 5HRVA 5ENBA 5G4SA 3VKHA 2YQDA 2F6JA 4MR5A 5A5RA 5DYUA 4TS8A 3MUKA 4IR6A 4N4FA 5D3RA 5HRWA 4LR6A 3LQJA 4QNSA 5H1TA 5LVRA 4BW2A 3MXFA 5F62A 4A9KA 3AQAA 5L8UA 5CRMA 4YC9A 5J0DA 5FE4A 5H1VA 1N72A 5EM3A 5EA1A 5A83A 5D3JA 4BW4A 5CRZA 3IU6A 5CUGA 4J1PA 3JVKA 5CQ4A 5A82A 4NQNA 3UVXA 4PCEA 4HXSA 4TT6A 4PCIA 5CUBA 4UIUA 3FKMX 3SVGA 5EISA 5CY9A 5DW1A 3LXJA 4WHWA 4WHUA 4YYJA 5I7XA 5HELA 4Z6HA 5FG6A 4LYSA 2OSSA 5HQ7A 5HFQA 4YYNA 4UIWA 3U5OA 5EWDA 2FSAA 2YYNA 2YDWA 4AKGA 2LSPB 3O35A 5A5QA 4MEQA 5CQ3A 5ENFA 4YH3A 5FFYA 4AKHA 4QEWA 3UV2A 3MB4A 3ERRA 4QYLA 1WUMA 3HMEA 5CP5A 4KCXA 2RNWA 5HLSA 2RFJA 4N3WA 5HQ6A 4QSUA 5EICA 4QSPA 4A9JA 5CUDA 5ENIA 4TTEA 4HBXA 2I7KA 4AKNA 5FH8A 5D3LA 5D3TA 4OGIA 2E7NA 5F36A 2RS9B 3DAIA 5E9MA 5I7YA 4HXRA 3P5OA 4UYDA 4TZ8A 4O7EA 4YYHA 5FB1A 2KTBB 3O33A 4HBYA 4TQNA 4UIZA 5F61A 4YABA 4NRCA 4N4HA 5FBXA 3GG3A 4IOQA 4A9NA 2OO1A 4PTBA 3I3JA 3AADA 5EGUA 5ETDA 5F60A 3U5LA 5KTXA 4O7BA 4QBMA 3P1FA 5E7DA 4LDFA 5KU3A 5EWVA 3P1DA 5BT3A 4MENA 5TCMA 4CUPA 3LJWA 5DKCA 5EK9A 5CQ7A 4A9MA 5BT5A 3U5MA 2H60A 5E9YA 5HCLA 5FE5A 5CZGA 5HQ5A 5FE3A 4NQMA 5D0CA 2R10A 3P1CA 3O37A 5DYAA 5LKXA 5EPSA 2YELA 5E3GA 5JI8A 4O76A 5CU8A 4QSSA 5LJ1A 4QSVA 3TLPA 5EV9A 3P1EA 4TYLA 4N4GA 5DY7A 5LUUA 3JVJA 5II2A 5FH7A 5FFVA 5A81A 4NS5A 5CQ8A 5DLXA 2DVRA 4YATA 4PY6A 5IGMA 5EI4A 3UV4A 4YK0A 2D82A 5ENEA 5I1QA 4LZ2A 3DWYA 3LQIA 3O34A 5CQAA 2R0SA 4O70A 5CQ6A 2MJVB 4PS5A 5CQ5A 1X0JA 5HJCA 1WUGA 5F5ZA 5A7CA 5KTUA 4IR3A 3D1DA 5LVQA 4YYGA 5I88A 5EWWA 4NYXA 5DW2A 2GRCA 5IGNA 4TU4A 2RNYA 5I80A 5FE7A 4UYFB 4A9LA 5HENA 5ACYA 5C4QA 5E0RA 3S92A 4E96A 5KHMA 1ZKRA 4NRAA 5HFRA 2L85A 5LKZA 1JSPB 4O72A 2DWWA 4NR4A 4YYIA 5EWHA 4OUFA 4NXJA 5C7NA 5DYCA 4BW3A 3IU5A 5COIA 5C85A 5HM0A 5FE9A 5A5NA 5I86A 3MB3A 4HXPA 4DONA 4CL9A 2YEMA 4IORA 4NUEA 5JWMA 4Z1QA 4NYWA 5D26A 5CS8A 5EU1A 5AD2A 4XYAA 4XUAA 5I83A 4QR4A 4IOOA 4QSRA 4YADA 3NXBA 3D7CA 3U5NA 4HXKA 4GPJA 2R0VA 2L5EA 4YYMA 4O75A 5EVAA 5LJ2A 5LKTA 1E6IA 2DVSA 5FE6A 4Z1SA 2F6NA 4QSXA 5D24A 5E9LA 4MR4A 4KV1A 1EQFA 3G0LA 5DKDA 5L96A 5ENHA 5HEMA 4NR9A 5ENJA 5II1A 3U5KA 3ZYUA 4CUUA 4IR5A 4A9OA
chains in the Genus database with same CATH topology
5E73A 5EWCA 5E3DA 4LZSA 4X2IA 5L97A 4UIVA 4QC1A 2DVQA 2D9EA 5E9IA 4MEPA 4OGJA 5I29A 4ZC9A 4CURA 4NR8A 5AMFA 5EPBA 5EP7A 4YYKA 5IGLA 4UIXA 2E3KA 2RI7A 3JVMA 4QR3A 5FE0A 4LRGA 4QYDA 4A9FA 3RCWA 5F63A 4Z93A 4O74A 5L8TA 4HXOA 5A5OA 2L84A 4YBSA 4A9HA 2OUOA 5FG5A 4NR7A 4YBTA 4TU6A 4HXMA 5KTWA 5CPEA 4BHWA 4J0SA 4C66A 5ENCA 5CUAA 5F2PA 5L98A 2N9GA 4YAXA 4LYWA 4C67A 4BJXA 5IG6A 3O36A 5D3HA 5DYXA 4ALHA 2NXBA 3UW9A 4J3IA 4UYFA 5C87A 4UYHA 3HMFA 2DATA 4NR6A 5CUEA 5G4RA 4RVRA 5FDZA 5FB0A 2WP2A 4XY9A 4HXNA 3G0JA 5H1UA 3SVFA 4PKLA 5DX4A 4N4IA 4TZ2A 5DLZA 5F1LA 3JVLA 2YEKA 5I40A 3U5PA 5KO4A 4A9EA 4HXLA 5H85A 4QY4A 3MQMA 4QZSA 4NUDA 3UVDA 4HBVA 2WP1A 2DVVA 5EQ1A 4CFKA 5TB6A 4NR5A 4A9IA 4J0RA 5FFWA 3QZTA 4XUBA 4UIYA 1ZS5A 5BT4A 5K29A 5LJ0A 4KV4A 2G4AA 5IBNA 4QSQA 3Q2EA 4UITA 4FLPA 4O7FA 4WIVA 2DKWA 4YYDA 4CUQA 5FH6A 5D7XA 5FE8A 5FE1A 4UYGA 5C8GA 5IGKA 2R0YA 4XY8A 4O78A 5D3SA 5E74A 4NYVA 4UYEA 5E9VA 4QC3A 3K2JA 5DKHA 4CLBA 3QZVA 4IR4A 5CUCA 5CQTA 2RO1A 2YW5A 5DFCA 4CUTA 5CTLA 4YH4A 5IIDA 3S91A 5DBMA 5ENGA 5CFWA 5EPRA 4QSWA 3U5JA 5F3AA 4QEVA 3UVWA 4LC2A 4HBWA 5D3PA 4O71A 3UVYA 4CUSA 5AD3A 5A5PA 1F68A 5D3NA 4YY4A 4LZRA 5C89A 4QR5A 4O7AA 5ETBA 3MULA 4ZW1A 5FG4A 4O7CA 4LYIA 2RNXA 4MR3A 4QSTA 4QUUA 5L99A 1JM4B 4YY6A 4YBMA 5A85A 4NUCA 4BW1A 3SVHA 4Y03A 4TT4A 5FE2A 4O77A 4QB3A 3QZSA 5F25A 3Q2FA 3ONIA 5CGPA 4QUTA 4MEOA 5D25A 5DFBA 4TT2A 5LKUA 2I8NA 5F1HA 5E9KA 3LQHA 4Z6IA 4F3IA 4Q0NA 4NRBA 5A5SA 3HMHA 5AMEA 4Q0OA 4CFLA 4MR6A 4ZQLA 2E7OA 5I89A 5HRXA 4ALGA 3UV5A 4QEUA 5DFDA 5HRVA 5ENBA 5G4SA 2YQDA 2F6JA 4MR5A 5A5RA 5DYUA 4TS8A 3MUKA 4IR6A 4N4FA 5D3RA 5HRWA 4LR6A 3LQJA 4QNSA 5H1TA 5LVRA 4BW2A 3MXFA 5F62A 4A9KA 3AQAA 5L8UA 5CRMA 4YC9A 5J0DA 5FE4A 5H1VA 1N72A 5EM3A 5EA1A 5A83A 5D3JA 4BW4A 5CRZA 3IU6A 5CUGA 4J1PA 3JVKA 5CQ4A 5A82A 4NQNA 3UVXA 4PCEA 4HXSA 4TT6A 4PCIA 5CUBA 4UIUA 3FKMX 3SVGA 5EISA 5CY9A 5DW1A 3LXJA 4WHWA 4WHUA 4YYJA 5I7XA 5HELA 4Z6HA 5FG6A 4LYSA 2OSSA 5HQ7A 5HFQA 4YYNA 4UIWA 3U5OA 5EWDA 2FSAA 2YYNA 2YDWA 2LSPB 3O35A 5A5QA 4MEQA 5CQ3A 5ENFA 4YH3A 5FFYA 4QEWA 3UV2A 3MB4A 4QYLA 1WUMA 3HMEA 5CP5A 4KCXA 2RNWA 5HLSA 2RFJA 4N3WA 5HQ6A 4QSUA 5EICA 4QSPA 4A9JA 5CUDA 5ENIA 4TTEA 4HBXA 2I7KA 4AKNA 5FH8A 5D3LA 5D3TA 4OGIA 2E7NA 5F36A 2RS9B 3DAIA 5E9MA 5I7YA 4HXRA 3P5OA 4UYDA 4TZ8A 4O7EA 4YYHA 5FB1A 2KTBB 3O33A 4HBYA 4TQNA 4UIZA 5F61A 4YABA 4NRCA 4N4HA 5FBXA 3GG3A 4IOQA 4A9NA 2OO1A 4PTBA 3I3JA 3AADA 5EGUA 5ETDA 5F60A 3U5LA 5KTXA 4O7BA 4QBMA 3P1FA 5E7DA 4LDFA 5KU3A 5EWVA 3P1DA 5BT3A 4MENA 5TCMA 4CUPA 3LJWA 5DKCA 5EK9A 5CQ7A 4A9MA 5BT5A 3U5MA 2H60A 5E9YA 5HCLA 5FE5A 5CZGA 5HQ5A 5FE3A 4NQMA 5D0CA 2R10A 3P1CA 3O37A 5DYAA 5LKXA 5EPSA 2YELA 5E3GA 5JI8A 4O76A 5CU8A 4QSSA 5LJ1A 4QSVA 3TLPA 5EV9A 3P1EA 4TYLA 4N4GA 5DY7A 5LUUA 3JVJA 5II2A 5FH7A 5FFVA 5A81A 4NS5A 5CQ8A 5DLXA 2DVRA 4YATA 4PY6A 5IGMA 5EI4A 3UV4A 4YK0A 2D82A 5ENEA 5I1QA 4LZ2A 3DWYA 3LQIA 3O34A 5CQAA 2R0SA 4O70A 5CQ6A 2MJVB 4PS5A 5CQ5A 1X0JA 5HJCA 1WUGA 5F5ZA 5A7CA 5KTUA 4IR3A 5LVQA 4YYGA 5I88A 5EWWA 4NYXA 5DW2A 2GRCA 5IGNA 4TU4A 2RNYA 5I80A 5FE7A 4UYFB 4A9LA 5HENA 5ACYA 5C4QA 5E0RA 3S92A 4E96A 5KHMA 4NRAA 5HFRA 2L85A 5LKZA 1JSPB 4O72A 2DWWA 4NR4A 4YYIA 5EWHA 4OUFA 4NXJA 5C7NA 5DYCA 4BW3A 3IU5A 5COIA 5C85A 5HM0A 5FE9A 5A5NA 5I86A 3MB3A 4HXPA 4DONA 4CL9A 2YEMA 4IORA 4NUEA 5JWMA 4Z1QA 4NYWA 5D26A 5CS8A 5EU1A 5AD2A 4XYAA 4XUAA 5I83A 4QR4A 4IOOA 4QSRA 4YADA 3NXBA 3D7CA 3U5NA 4HXKA 4GPJA 2R0VA 2L5EA 4YYMA 4O75A 5EVAA 5LJ2A 5LKTA 1E6IA 2DVSA 5FE6A 4Z1SA 2F6NA 4QSXA 5D24A 5E9LA 4MR4A 4KV1A 1EQFA 3G0LA 5DKDA 5L96A 5ENHA 5HEMA 4NR9A 5ENJA 5II1A 3U5KA 3ZYUA 4CUUA 4IR5A 4A9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E73 A;  5EWC A;  5E3D A;  4LZS A;  4X2I A;  5L97 A;  4UIV A;  4QC1 A;  2DVQ A;  2D9E A;  5E9I A;  4MEP A;  4OGJ A;  5I29 A;  4ZC9 A;  4CUR A;  4NR8 A;  5AMF A;  5EPB A;  5EP7 A;  4YYK A;  5IGL A;  4UIX A;  2E3K A;  2RI7 A;  3JVM A;  4QR3 A;  5FE0 A;  4LRG A;  4QYD A;  4A9F A;  3RCW A;  5F63 A;  4Z93 A;  4O74 A;  5L8T A;  4HXO A;  5A5O A;  2L84 A;  4YBS A;  4A9H A;  2OUO A;  5FG5 A;  4NR7 A;  4YBT A;  4TU6 A;  4HXM A;  5KTW A;  5CPE A;  4BHW A;  4J0S A;  4C66 A;  5ENC A;  5CUA A;  5F2P A;  5L98 A;  2N9G A;  4YAX A;  4LYW A;  4C67 A;  4BJX A;  5IG6 A;  3O36 A;  5D3H A;  5DYX A;  4ALH A;  2NXB A;  3UW9 A;  4J3I A;  4UYF A;  5C87 A;  4UYH A;  3HMF A;  2DAT A;  4NR6 A;  5CUE A;  5G4R A;  4RVR A;  5FDZ A;  5FB0 A;  2WP2 A;  4XY9 A;  4HXN A;  3G0J A;  5H1U A;  3SVF A;  4PKL A;  5DX4 A;  4N4I A;  4TZ2 A;  5DLZ A;  5F1L A;  3JVL A;  2YEK A;  5I40 A;  3U5P A;  5KO4 A;  4A9E A;  4HXL A;  5H85 A;  4QY4 A;  3MQM A;  4QZS A;  4NUD A;  3UVD A;  4HBV A;  2WP1 A;  2DVV A;  5EQ1 A;  4CFK A;  5TB6 A;  4NR5 A;  4A9I A;  4J0R A;  5FFW A;  3QZT A;  4XUB A;  4UIY A;  1ZS5 A;  5BT4 A;  5K29 A;  5LJ0 A;  4KV4 A;  2G4A A;  5IBN A;  4QSQ A;  3Q2E A;  4UIT A;  4FLP A;  4O7F A;  4WIV A;  2DKW A;  4YYD A;  4CUQ A;  5FH6 A;  5D7X A;  5FE8 A;  5FE1 A;  4UYG A;  5C8G A;  5IGK A;  2R0Y A;  4XY8 A;  4O78 A;  5D3S A;  5E74 A;  4NYV A;  4UYE A;  5E9V A;  4QC3 A;  3K2J A;  5DKH A;  4CLB A;  3QZV A;  4IR4 A;  5CUC A;  5CQT A;  2RO1 A;  2YW5 A;  5DFC A;  4CUT A;  5CTL A;  4YH4 A;  5IID A;  3S91 A;  5DBM A;  5ENG A;  5CFW A;  5EPR A;  4QSW A;  3U5J A;  5F3A A;  4QEV A;  3UVW A;  4LC2 A;  4HBW A;  5D3P A;  4O71 A;  3UVY A;  4CUS A;  5AD3 A;  5A5P A;  1F68 A;  5D3N A;  4YY4 A;  4LZR A;  5C89 A;  4QR5 A;  4O7A A;  5ETB A;  3MUL A;  4ZW1 A;  5FG4 A;  4O7C A;  4LYI A;  2RNX A;  4MR3 A;  4QST A;  4QUU A;  5L99 A;  1JM4 B;  4YY6 A;  4YBM A;  5A85 A;  4NUC A;  4BW1 A;  3SVH A;  4Y03 A;  4TT4 A;  5FE2 A;  4O77 A;  4QB3 A;  3QZS A;  5F25 A;  3Q2F A;  3ONI A;  5CGP A;  4QUT A;  4MEO A;  5D25 A;  5DFB A;  4TT2 A;  5LKU A;  2I8N A;  5F1H A;  5E9K A;  3LQH A;  4Z6I A;  4F3I A;  4Q0N A;  4NRB A;  5A5S A;  3HMH A;  5AME A;  4Q0O A;  4CFL A;  4MR6 A;  4ZQL A;  2E7O A;  5I89 A;  5HRX A;  4ALG A;  3UV5 A;  4QEU A;  5DFD A;  5HRV A;  5ENB A;  5G4S A;  2YQD A;  2F6J A;  4MR5 A;  5A5R A;  5DYU A;  4TS8 A;  3MUK A;  4IR6 A;  4N4F A;  5D3R A;  5HRW A;  4LR6 A;  3LQJ A;  4QNS A;  5H1T A;  5LVR A;  4BW2 A;  3MXF A;  5F62 A;  4A9K A;  3AQA A;  5L8U A;  5CRM A;  4YC9 A;  5J0D A;  5FE4 A;  5H1V A;  1N72 A;  5EM3 A;  5EA1 A;  5A83 A;  5D3J A;  4BW4 A;  5CRZ A;  3IU6 A;  5CUG A;  4J1P A;  3JVK A;  5CQ4 A;  5A82 A;  4NQN A;  3UVX A;  4PCE A;  4HXS A;  4TT6 A;  4PCI A;  5CUB A;  4UIU A;  3FKM X;  3SVG A;  5EIS A;  5CY9 A;  5DW1 A;  3LXJ A;  4WHW A;  4WHU A;  4YYJ A;  5I7X A;  5HEL A;  4Z6H A;  5FG6 A;  4LYS A;  2OSS A;  5HQ7 A;  5HFQ A;  4YYN A;  4UIW A;  3U5O A;  5EWD A;  2FSA A;  2YYN A;  2YDW A;  2LSP B;  3O35 A;  5A5Q A;  4MEQ A;  5CQ3 A;  5ENF A;  4YH3 A;  5FFY A;  4QEW A;  3UV2 A;  3MB4 A;  4QYL A;  1WUM A;  3HME A;  5CP5 A;  4KCX A;  2RNW A;  5HLS A;  2RFJ A;  4N3W A;  5HQ6 A;  4QSU A;  5EIC A;  4QSP A;  4A9J A;  5CUD A;  5ENI A;  4TTE A;  4HBX A;  2I7K A;  4AKN A;  5FH8 A;  5D3L A;  5D3T A;  4OGI A;  2E7N A;  5F36 A;  2RS9 B;  3DAI A;  5E9M A;  5I7Y A;  4HXR A;  3P5O A;  4UYD A;  4TZ8 A;  4O7E A;  4YYH A;  5FB1 A;  2KTB B;  3O33 A;  4HBY A;  4TQN A;  4UIZ A;  5F61 A;  4YAB A;  4NRC A;  4N4H A;  5FBX A;  3GG3 A;  4IOQ A;  4A9N A;  2OO1 A;  4PTB A;  3I3J A;  3AAD A;  5EGU A;  5ETD A;  5F60 A;  3U5L A;  5KTX A;  4O7B A;  4QBM A;  3P1F A;  5E7D A;  4LDF A;  5KU3 A;  5EWV A;  3P1D A;  5BT3 A;  4MEN A;  5TCM A;  4CUP A;  3LJW A;  5DKC A;  5EK9 A;  5CQ7 A;  4A9M A;  5BT5 A;  3U5M A;  2H60 A;  5E9Y A;  5HCL A;  5FE5 A;  5CZG A;  5HQ5 A;  5FE3 A;  4NQM A;  5D0C A;  2R10 A;  3P1C A;  3O37 A;  5DYA A;  5LKX A;  5EPS A;  2YEL A;  5E3G A;  5JI8 A;  4O76 A;  5CU8 A;  4QSS A;  5LJ1 A;  4QSV A;  3TLP A;  5EV9 A;  3P1E A;  4TYL A;  4N4G A;  5DY7 A;  5LUU A;  3JVJ A;  5II2 A;  5FH7 A;  5FFV A;  5A81 A;  4NS5 A;  5CQ8 A;  5DLX A;  2DVR A;  4YAT A;  4PY6 A;  5IGM A;  5EI4 A;  3UV4 A;  4YK0 A;  2D82 A;  5ENE A;  5I1Q A;  4LZ2 A;  3DWY A;  3LQI A;  3O34 A;  5CQA A;  2R0S A;  4O70 A;  5CQ6 A;  2MJV B;  4PS5 A;  5CQ5 A;  1X0J A;  5HJC A;  1WUG A;  5F5Z A;  5A7C A;  5KTU A;  4IR3 A;  5LVQ A;  4YYG A;  5I88 A;  5EWW A;  4NYX A;  5DW2 A;  2GRC A;  5IGN A;  4TU4 A;  2RNY A;  5I80 A;  5FE7 A;  4UYF B;  4A9L A;  5HEN A;  5ACY A;  5C4Q A;  5E0R A;  3S92 A;  4E96 A;  5KHM A;  4NRA A;  5HFR A;  2L85 A;  5LKZ A;  1JSP B;  4O72 A;  2DWW A;  4NR4 A;  4YYI A;  5EWH A;  4OUF A;  4NXJ A;  5C7N A;  5DYC A;  4BW3 A;  3IU5 A;  5COI A;  5C85 A;  5HM0 A;  5FE9 A;  5A5N A;  5I86 A;  3MB3 A;  4HXP A;  4DON A;  4CL9 A;  2YEM A;  4IOR A;  4NUE A;  5JWM A;  4Z1Q A;  4NYW A;  5D26 A;  5CS8 A;  5EU1 A;  5AD2 A;  4XYA A;  4XUA A;  5I83 A;  4QR4 A;  4IOO A;  4QSR A;  4YAD A;  3NXB A;  3D7C A;  3U5N A;  4HXK A;  4GPJ A;  2R0V A;  2L5E A;  4YYM A;  4O75 A;  5EVA A;  5LJ2 A;  5LKT A;  1E6I A;  2DVS A;  5FE6 A;  4Z1S A;  2F6N A;  4QSX A;  5D24 A;  5E9L A;  4MR4 A;  4KV1 A;  1EQF A;  3G0L A;  5DKD A;  5L96 A;  5ENH A;  5HEM A;  4NR9 A;  5ENJ A;  5II1 A;  3U5K A;  3ZYU A;  4CUU A;  4IR5 A;  4A9O A; 
#chains in the Genus database with same CATH topology
 5E73 A;  5EWC A;  5E3D A;  4LZS A;  4X2I A;  5L97 A;  4UIV A;  4QC1 A;  2DVQ A;  2D9E A;  5E9I A;  4MEP A;  4OGJ A;  5I29 A;  4ZC9 A;  4CUR A;  4NR8 A;  5AMF A;  5EPB A;  5EP7 A;  4YYK A;  5IGL A;  4UIX A;  2E3K A;  2RI7 A;  3JVM A;  4QR3 A;  5FE0 A;  4LRG A;  4QYD A;  4A9F A;  3RCW A;  5F63 A;  4Z93 A;  4O74 A;  5L8T A;  4HXO A;  5A5O A;  2L84 A;  4YBS A;  4A9H A;  2OUO A;  5FG5 A;  4NR7 A;  4YBT A;  4TU6 A;  4HXM A;  5KTW A;  5CPE A;  4BHW A;  4J0S A;  4C66 A;  5ENC A;  5CUA A;  5F2P A;  5L98 A;  2N9G A;  4YAX A;  4LYW A;  4C67 A;  4BJX A;  5IG6 A;  3O36 A;  2EJN A;  5D3H A;  5DYX A;  4ALH A;  2NXB A;  3UW9 A;  4J3I A;  4UYF A;  5C87 A;  4UYH A;  3HMF A;  2DAT A;  4NR6 A;  5CUE A;  5G4R A;  4RVR A;  5FDZ A;  5FB0 A;  2WP2 A;  4XY9 A;  4HXN A;  3G0J A;  5H1U A;  3SVF A;  4PKL A;  5DX4 A;  4N4I A;  4TZ2 A;  5DLZ A;  3D1B A;  3JVL A;  5F1L A;  2YEK A;  5I40 A;  3U5P A;  5KO4 A;  4A9E A;  4HXL A;  5H85 A;  4QY4 A;  3MQM A;  4QZS A;  4NUD A;  3UVD A;  4HBV A;  2WP1 A;  2DVV A;  5EQ1 A;  4CFK A;  5TB6 A;  4NR5 A;  4A9I A;  4J0R A;  5FFW A;  3QZT A;  4XUB A;  4UIY A;  1ZS5 A;  5BT4 A;  5K29 A;  5LJ0 A;  4KV4 A;  2G4A A;  5IBN A;  4QSQ A;  3Q2E A;  4UIT A;  4FLP A;  4O7F A;  4WIV A;  2DKW A;  4YYD A;  4CUQ A;  5FH6 A;  5D7X A;  5FE8 A;  5FE1 A;  4UYG A;  5C8G A;  5IGK A;  2R0Y A;  4XY8 A;  4O78 A;  5D3S A;  5E74 A;  4NYV A;  4UYE A;  5E9V A;  4QC3 A;  3K2J A;  5DKH A;  4CLB A;  3VKG A;  3QZV A;  4IR4 A;  5CUC A;  5CQT A;  2RO1 A;  2YW5 A;  5DFC A;  4CUT A;  5CTL A;  4YH4 A;  5IID A;  3S91 A;  5DBM A;  5ENG A;  5CFW A;  5EPR A;  4QSW A;  3U5J A;  5F3A A;  4QEV A;  3UVW A;  4LC2 A;  4HBW A;  5D3P A;  4O71 A;  3UVY A;  4CUS A;  5AD3 A;  5A5P A;  1F68 A;  1PUO A;  5D3N A;  4YY4 A;  4LZR A;  5C89 A;  4QR5 A;  4O7A A;  5ETB A;  3MUL A;  4ZW1 A;  5FG4 A;  4O7C A;  4LYI A;  2RNX A;  4MR3 A;  4QST A;  4QUU A;  5L99 A;  1JM4 B;  4YY6 A;  4YBM A;  5A85 A;  4NUC A;  4BW1 A;  3SVH A;  4Y03 A;  4TT4 A;  5FE2 A;  4O77 A;  4QB3 A;  3QZS A;  5F25 A;  3Q2F A;  3ONI A;  5CGP A;  4QUT A;  4MEO A;  5D25 A;  5DFB A;  4TT2 A;  5LKU A;  2I8N A;  5F1H A;  4AKI A;  5E9K A;  3LQH A;  4Z6I A;  4F3I A;  4Q0N A;  4NRB A;  5A5S A;  3HMH A;  5AME A;  4Q0O A;  4CFL A;  4MR6 A;  4ZQL A;  2E7O A;  5I89 A;  5HRX A;  4ALG A;  3UV5 A;  4AI6 A;  4QEU A;  5DFD A;  5HRV A;  5ENB A;  5G4S A;  3VKH A;  2YQD A;  2F6J A;  4MR5 A;  5A5R A;  5DYU A;  4TS8 A;  3MUK A;  4IR6 A;  4N4F A;  5D3R A;  5HRW A;  4LR6 A;  3LQJ A;  4QNS A;  5H1T A;  5LVR A;  4BW2 A;  3MXF A;  5F62 A;  4A9K A;  3AQA A;  5L8U A;  5CRM A;  4YC9 A;  5J0D A;  5FE4 A;  5H1V A;  1N72 A;  5EM3 A;  5EA1 A;  5A83 A;  5D3J A;  4BW4 A;  5CRZ A;  3IU6 A;  5CUG A;  4J1P A;  3JVK A;  5CQ4 A;  5A82 A;  4NQN A;  3UVX A;  4PCE A;  4HXS A;  4TT6 A;  4PCI A;  5CUB A;  4UIU A;  3FKM X;  3SVG A;  5EIS A;  5CY9 A;  5DW1 A;  3LXJ A;  4WHW A;  4WHU A;  4YYJ A;  5I7X A;  5HEL A;  4Z6H A;  5FG6 A;  4LYS A;  2OSS A;  5HQ7 A;  5HFQ A;  4YYN A;  4UIW A;  3U5O A;  5EWD A;  2FSA A;  2YYN A;  2YDW A;  4AKG A;  2LSP B;  3O35 A;  5A5Q A;  4MEQ A;  5CQ3 A;  5ENF A;  4YH3 A;  5FFY A;  4AKH A;  4QEW A;  3UV2 A;  3MB4 A;  3ERR A;  4QYL A;  1WUM A;  3HME A;  5CP5 A;  4KCX A;  2RNW A;  5HLS A;  2RFJ A;  4N3W A;  5HQ6 A;  4QSU A;  5EIC A;  4QSP A;  4A9J A;  5CUD A;  5ENI A;  4TTE A;  4HBX A;  2I7K A;  4AKN A;  5FH8 A;  5D3L A;  5D3T A;  4OGI A;  2E7N A;  5F36 A;  2RS9 B;  3DAI A;  5E9M A;  5I7Y A;  4HXR A;  3P5O A;  4UYD A;  4TZ8 A;  4O7E A;  4YYH A;  5FB1 A;  2KTB B;  3O33 A;  4HBY A;  4TQN A;  4UIZ A;  5F61 A;  4YAB A;  4NRC A;  4N4H A;  5FBX A;  3GG3 A;  4IOQ A;  4A9N A;  2OO1 A;  4PTB A;  3I3J A;  3AAD A;  5EGU A;  5ETD A;  5F60 A;  3U5L A;  5KTX A;  4O7B A;  4QBM A;  3P1F A;  5E7D A;  4LDF A;  5KU3 A;  5EWV A;  3P1D A;  5BT3 A;  4MEN A;  5TCM A;  4CUP A;  3LJW A;  5DKC A;  5EK9 A;  5CQ7 A;  4A9M A;  5BT5 A;  3U5M A;  2H60 A;  5E9Y A;  5HCL A;  5FE5 A;  5CZG A;  5HQ5 A;  5FE3 A;  4NQM A;  5D0C A;  2R10 A;  3P1C A;  3O37 A;  5DYA A;  5LKX A;  5EPS A;  2YEL A;  5E3G A;  5JI8 A;  4O76 A;  5CU8 A;  4QSS A;  5LJ1 A;  4QSV A;  3TLP A;  5EV9 A;  3P1E A;  4TYL A;  4N4G A;  5DY7 A;  5LUU A;  3JVJ A;  5II2 A;  5FH7 A;  5FFV A;  5A81 A;  4NS5 A;  5CQ8 A;  5DLX A;  2DVR A;  4YAT A;  4PY6 A;  5IGM A;  5EI4 A;  3UV4 A;  4YK0 A;  2D82 A;  5ENE A;  5I1Q A;  4LZ2 A;  3DWY A;  3LQI A;  3O34 A;  5CQA A;  2R0S A;  4O70 A;  5CQ6 A;  2MJV B;  4PS5 A;  5CQ5 A;  1X0J A;  5HJC A;  1WUG A;  5F5Z A;  5A7C A;  5KTU A;  4IR3 A;  3D1D A;  5LVQ A;  4YYG A;  5I88 A;  5EWW A;  4NYX A;  5DW2 A;  2GRC A;  5IGN A;  4TU4 A;  2RNY A;  5I80 A;  5FE7 A;  4UYF B;  4A9L A;  5HEN A;  5ACY A;  5C4Q A;  5E0R A;  3S92 A;  4E96 A;  5KHM A;  1ZKR A;  4NRA A;  5HFR A;  2L85 A;  5LKZ A;  1JSP B;  4O72 A;  2DWW A;  4NR4 A;  4YYI A;  5EWH A;  4OUF A;  4NXJ A;  5C7N A;  5DYC A;  4BW3 A;  3IU5 A;  5COI A;  5C85 A;  5HM0 A;  5FE9 A;  5A5N A;  5I86 A;  3MB3 A;  4HXP A;  4DON A;  4CL9 A;  2YEM A;  4IOR A;  4NUE A;  5JWM A;  4Z1Q A;  4NYW A;  5D26 A;  5CS8 A;  5EU1 A;  5AD2 A;  4XYA A;  4XUA A;  5I83 A;  4QR4 A;  4IOO A;  4QSR A;  4YAD A;  3NXB A;  3D7C A;  3U5N A;  4HXK A;  4GPJ A;  2R0V A;  2L5E A;  4YYM A;  4O75 A;  5EVA A;  5LJ2 A;  5LKT A;  1E6I A;  2DVS A;  5FE6 A;  4Z1S A;  2F6N A;  4QSX A;  5D24 A;  5E9L A;  4MR4 A;  4KV1 A;  1EQF A;  3G0L A;  5DKD A;  5L96 A;  5ENH A;  5HEM A;  4NR9 A;  5ENJ A;  5II1 A;  3U5K A;  3ZYU A;  4CUU A;  4IR5 A;  4A9O A; 
#chains in the Genus database with same CATH homology
 5E73 A;  5EWC A;  5E3D A;  4LZS A;  4X2I A;  5L97 A;  4UIV A;  4QC1 A;  2DVQ A;  2D9E A;  5E9I A;  4MEP A;  4OGJ A;  5I29 A;  4ZC9 A;  4CUR A;  4NR8 A;  5AMF A;  5EPB A;  5EP7 A;  4YYK A;  5IGL A;  4UIX A;  2E3K A;  2RI7 A;  3JVM A;  4QR3 A;  5FE0 A;  4LRG A;  4QYD A;  4A9F A;  3RCW A;  5F63 A;  4Z93 A;  4O74 A;  5L8T A;  4HXO A;  5A5O A;  2L84 A;  4YBS A;  4A9H A;  2OUO A;  5FG5 A;  4NR7 A;  4YBT A;  4TU6 A;  4HXM A;  5KTW A;  5CPE A;  4BHW A;  4J0S A;  4C66 A;  5ENC A;  5CUA A;  5F2P A;  5L98 A;  2N9G A;  4YAX A;  4LYW A;  4C67 A;  4BJX A;  5IG6 A;  3O36 A;  5D3H A;  5DYX A;  4ALH A;  2NXB A;  3UW9 A;  4J3I A;  4UYF A;  5C87 A;  4UYH A;  3HMF A;  2DAT A;  4NR6 A;  5CUE A;  5G4R A;  4RVR A;  5FDZ A;  5FB0 A;  2WP2 A;  4XY9 A;  4HXN A;  3G0J A;  5H1U A;  3SVF A;  4PKL A;  5DX4 A;  4N4I A;  4TZ2 A;  5DLZ A;  5F1L A;  3JVL A;  2YEK A;  5I40 A;  3U5P A;  5KO4 A;  4A9E A;  4HXL A;  5H85 A;  4QY4 A;  3MQM A;  4QZS A;  4NUD A;  3UVD A;  4HBV A;  2WP1 A;  2DVV A;  5EQ1 A;  4CFK A;  5TB6 A;  4NR5 A;  4A9I A;  4J0R A;  5FFW A;  3QZT A;  4XUB A;  4UIY A;  1ZS5 A;  5BT4 A;  5K29 A;  5LJ0 A;  4KV4 A;  2G4A A;  5IBN A;  4QSQ A;  3Q2E A;  4UIT A;  4FLP A;  4O7F A;  4WIV A;  2DKW A;  4YYD A;  4CUQ A;  5FH6 A;  5D7X A;  5FE8 A;  5FE1 A;  4UYG A;  5C8G A;  5IGK A;  2R0Y A;  4XY8 A;  4O78 A;  5D3S A;  5E74 A;  4NYV A;  4UYE A;  5E9V A;  4QC3 A;  3K2J A;  5DKH A;  4CLB A;  3QZV A;  4IR4 A;  5CUC A;  5CQT A;  2RO1 A;  2YW5 A;  5DFC A;  4CUT A;  5CTL A;  4YH4 A;  5IID A;  3S91 A;  5DBM A;  5ENG A;  5CFW A;  5EPR A;  4QSW A;  3U5J A;  5F3A A;  4QEV A;  3UVW A;  4LC2 A;  4HBW A;  5D3P A;  4O71 A;  3UVY A;  4CUS A;  5AD3 A;  5A5P A;  1F68 A;  5D3N A;  4YY4 A;  4LZR A;  5C89 A;  4QR5 A;  4O7A A;  5ETB A;  3MUL A;  4ZW1 A;  5FG4 A;  4O7C A;  4LYI A;  2RNX A;  4MR3 A;  4QST A;  4QUU A;  5L99 A;  1JM4 B;  4YY6 A;  4YBM A;  5A85 A;  4NUC A;  4BW1 A;  3SVH A;  4Y03 A;  4TT4 A;  5FE2 A;  4O77 A;  4QB3 A;  3QZS A;  5F25 A;  3Q2F A;  3ONI A;  5CGP A;  4QUT A;  4MEO A;  5D25 A;  5DFB A;  4TT2 A;  5LKU A;  2I8N A;  5F1H A;  5E9K A;  3LQH A;  4Z6I A;  4F3I A;  4Q0N A;  4NRB A;  5A5S A;  3HMH A;  5AME A;  4Q0O A;  4CFL A;  4MR6 A;  4ZQL A;  2E7O A;  5I89 A;  5HRX A;  4ALG A;  3UV5 A;  4QEU A;  5DFD A;  5HRV A;  5ENB A;  5G4S A;  2YQD A;  2F6J A;  4MR5 A;  5A5R A;  5DYU A;  4TS8 A;  3MUK A;  4IR6 A;  4N4F A;  5D3R A;  5HRW A;  4LR6 A;  3LQJ A;  4QNS A;  5H1T A;  5LVR A;  4BW2 A;  3MXF A;  5F62 A;  4A9K A;  3AQA A;  5L8U A;  5CRM A;  4YC9 A;  5J0D A;  5FE4 A;  5H1V A;  1N72 A;  5EM3 A;  5EA1 A;  5A83 A;  5D3J A;  4BW4 A;  5CRZ A;  3IU6 A;  5CUG A;  4J1P A;  3JVK A;  5CQ4 A;  5A82 A;  4NQN A;  3UVX A;  4PCE A;  4HXS A;  4TT6 A;  4PCI A;  5CUB A;  4UIU A;  3FKM X;  3SVG A;  5EIS A;  5CY9 A;  5DW1 A;  3LXJ A;  4WHW A;  4WHU A;  4YYJ A;  5I7X A;  5HEL A;  4Z6H A;  5FG6 A;  4LYS A;  2OSS A;  5HQ7 A;  5HFQ A;  4YYN A;  4UIW A;  3U5O A;  5EWD A;  2FSA A;  2YYN A;  2YDW A;  2LSP B;  3O35 A;  5A5Q A;  4MEQ A;  5CQ3 A;  5ENF A;  4YH3 A;  5FFY A;  4QEW A;  3UV2 A;  3MB4 A;  4QYL A;  1WUM A;  3HME A;  5CP5 A;  4KCX A;  2RNW A;  5HLS A;  2RFJ A;  4N3W A;  5HQ6 A;  4QSU A;  5EIC A;  4QSP A;  4A9J A;  5CUD A;  5ENI A;  4TTE A;  4HBX A;  2I7K A;  4AKN A;  5FH8 A;  5D3L A;  5D3T A;  4OGI A;  2E7N A;  5F36 A;  2RS9 B;  3DAI A;  5E9M A;  5I7Y A;  4HXR A;  3P5O A;  4UYD A;  4TZ8 A;  4O7E A;  4YYH A;  5FB1 A;  2KTB B;  3O33 A;  4HBY A;  4TQN A;  4UIZ A;  5F61 A;  4YAB A;  4NRC A;  4N4H A;  5FBX A;  3GG3 A;  4IOQ A;  4A9N A;  2OO1 A;  4PTB A;  3I3J A;  3AAD A;  5EGU A;  5ETD A;  5F60 A;  3U5L A;  5KTX A;  4O7B A;  4QBM A;  3P1F A;  5E7D A;  4LDF A;  5KU3 A;  5EWV A;  3P1D A;  5BT3 A;  4MEN A;  5TCM A;  4CUP A;  3LJW A;  5DKC A;  5EK9 A;  5CQ7 A;  4A9M A;  5BT5 A;  3U5M A;  2H60 A;  5E9Y A;  5HCL A;  5FE5 A;  5CZG A;  5HQ5 A;  5FE3 A;  4NQM A;  5D0C A;  2R10 A;  3P1C A;  3O37 A;  5DYA A;  5LKX A;  5EPS A;  2YEL A;  5E3G A;  5JI8 A;  4O76 A;  5CU8 A;  4QSS A;  5LJ1 A;  4QSV A;  3TLP A;  5EV9 A;  3P1E A;  4TYL A;  4N4G A;  5DY7 A;  5LUU A;  3JVJ A;  5II2 A;  5FH7 A;  5FFV A;  5A81 A;  4NS5 A;  5CQ8 A;  5DLX A;  2DVR A;  4YAT A;  4PY6 A;  5IGM A;  5EI4 A;  3UV4 A;  4YK0 A;  2D82 A;  5ENE A;  5I1Q A;  4LZ2 A;  3DWY A;  3LQI A;  3O34 A;  5CQA A;  2R0S A;  4O70 A;  5CQ6 A;  2MJV B;  4PS5 A;  5CQ5 A;  1X0J A;  5HJC A;  1WUG A;  5F5Z A;  5A7C A;  5KTU A;  4IR3 A;  5LVQ A;  4YYG A;  5I88 A;  5EWW A;  4NYX A;  5DW2 A;  2GRC A;  5IGN A;  4TU4 A;  2RNY A;  5I80 A;  5FE7 A;  4UYF B;  4A9L A;  5HEN A;  5ACY A;  5C4Q A;  5E0R A;  3S92 A;  4E96 A;  5KHM A;  4NRA A;  5HFR A;  2L85 A;  5LKZ A;  1JSP B;  4O72 A;  2DWW A;  4NR4 A;  4YYI A;  5EWH A;  4OUF A;  4NXJ A;  5C7N A;  5DYC A;  4BW3 A;  3IU5 A;  5COI A;  5C85 A;  5HM0 A;  5FE9 A;  5A5N A;  5I86 A;  3MB3 A;  4HXP A;  4DON A;  4CL9 A;  2YEM A;  4IOR A;  4NUE A;  5JWM A;  4Z1Q A;  4NYW A;  5D26 A;  5CS8 A;  5EU1 A;  5AD2 A;  4XYA A;  4XUA A;  5I83 A;  4QR4 A;  4IOO A;  4QSR A;  4YAD A;  3NXB A;  3D7C A;  3U5N A;  4HXK A;  4GPJ A;  2R0V A;  2L5E A;  4YYM A;  4O75 A;  5EVA A;  5LJ2 A;  5LKT A;  1E6I A;  2DVS A;  5FE6 A;  4Z1S A;  2F6N A;  4QSX A;  5D24 A;  5E9L A;  4MR4 A;  4KV1 A;  1EQF A;  3G0L A;  5DKD A;  5L96 A;  5ENH A;  5HEM A;  4NR9 A;  5ENJ A;  5II1 A;  3U5K A;  3ZYU A;  4CUU A;  4IR5 A;  4A9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...