2OO1A

Crystal structure of the bromo domain 2 of human bromodomain containing protein 3 (brd3)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 3
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 41
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2oo1A00
4YATA 2YEKA 4NR9A 2WP2A 4YYNA 5BT4A 3K2JA 4YC9A 4AKNA 2RNYA 5LKUA 4PTBA 4YK0A 4A9IA 2MJVB 5ACYA 5DKCA 4CL9A 5CUBA 5CRZA 5ENIA 4NYVA 5A82A 4NR5A 5A5SA 4YAXA 3AADA 4Y03A 4O76A 4TT4A 5F25A 5E74A 3U5MA 1WUMA 4NRBA 4F3IA 4HXSA 5IGNA 5KHMA 3MB3A 3UW9A 5D3RA 3JVJA 4OUFA 4YY4A 4O78A 2DVRA 5F1HA 5A5RA 5D3LA 5EWWA 4HXKA 5EA1A 3U5NA 2WP1A 4XUBA 5LJ0A 5A5NA 4LRGA 5EPBA 5EI4A 4LYWA 4NQMA 3ZYUA 4NS5A 5EK9A 5DYXA 5EICA 3U5OA 1X0JA 3O36A 4YYKA 4ZW1A 2I7KA 4IR3A 5A7CA 5LVRA 4N4GA 4WHWA 2RFJA 4UIVA 5HFRA 4QSPA 4QUUA 5CFWA 3UVXA 3UV5A 3SVHA 4TYLA 4QR5A 3UV4A 3DWYA 5DFDA 4WHUA 3P5OA 4UIWA 4A9OA 5L96A 4UYGA 5FE8A 4YADA 2R0YA 2F6NA 2R0VA 4LZRA 1JM4B 5H1UA 4LDFA 4A9KA 3TLPA 5LKTA 2GRCA 4ZQLA 5E9IA 4GPJA 3AQAA 2RO1A 5EGUA 4Z6IA 2L85A 5DYCA 4YYIA 4CFKA 4A9LA 5LJ1A 4TU6A 5ENCA 4QSUA 5JI8A 4NXJA 5D24A 2LSPB 3O35A 4MR6A 3QZTA 5EWVA 4A9HA 5HCLA 5HRWA 5FE0A 5TB6A 3S92A 2YDWA 2DVQA 4YY6A 2L84A 4N3WA 5D3PA 2FSAA 2R0SA 5EWCA 4BW1A 5LJ2A 5FE1A 4CUUA 4HBVA 4Q0NA 5F63A 4XY9A 5I1QA 5H1VA 5FE4A 4BJXA 5D3TA 5E73A 5I88A 3G0JA 1N72A 3U5PA 4IORA 5ETDA 4YH4A 3GG3A 4IOQA 5KU3A 3D7CA 5COIA 1ZS5A 2YW5A 5DW1A 4UIZA 3QZVA 5ENGA 5HELA 4XYAA 5F3AA 4PCEA 5H1TA 4BHWA 4TT2A 5BT5A 4QSQA 4E96A 4ALGA 4Z1SA 4HXRA 5CU8A 3MQMA 5F1LA 4MEOA 4QC3A 4QB3A 2E7OA 4QEUA 5CQAA 5DY7A 4MEQA 5EWHA 5FG4A 3LQHA 2E7NA 5EVAA 5C7NA 5CTLA 5DLZA 4J1PA 1F68A 4UYFA 4CUPA 5AD3A 2D82A 2YEMA 3LQIA 4KV4A 2G4AA 5TCMA 4TZ2A 5DFBA 5AMFA 5FFVA 5CQ4A 2L5EA 5CPEA 4QSSA 4J3IA 5I80A 4HXNA 5CQ6A 5EPSA 4CFLA 4N4FA 5EU1A 4HBWA 4YYMA 2OSSA 4HXLA 3JVKA 5FH6A 3HMFA 3NXBA 5DX4A 4UIYA 4O7CA 5HENA 5G4SA 3LXJA 5DFCA 5FE7A 5FH7A 4DONA 5FE2A 4X2IA 3P1CA 5FB1A 5HM0A 5JWMA 5L8TA 2I8NA 5II1A 2DVSA 1WUGA 5CUAA 5E0RA 2YYNA 4MENA 4NRCA 5D3HA 4YYJA 2D9EA 5HRVA 5C85A 5I29A 4QSRA 4FLPA 4NYWA 4QYDA 4Z93A 5F61A 4UYHA 4IR4A 5EV9A 5LVQA 4HXPA 3P1FA 4Z1QA 1JSPB 4YBTA 5FG6A 4NR8A 5FE3A 4NUCA 3O37A 5CQ8A 5A85A 4QSXA 5A83A 4BW3A 5CUGA 5CQ7A 4KV1A 5EISA 5CQ5A 5FFYA 5E7DA 3JVMA 4BW2A 2YELA 4QR4A 5CQTA 4UYDA 4QSVA 4O72A 1EQFA 5ENEA 4HBYA 4IOOA 3RCWA 5E3DA 4YBSA 2DWWA 5KO4A 5F36A 5DW2A 5IGKA 4QNSA 4O7FA 2E3KA 4MEPA 5D26A 3UVWA 5CGPA 4MR4A 5C89A 4NQNA 3UV2A 5DLXA 3I3JA 4YYHA 5A81A 4IR6A 4HBXA 4TZ8A 4NR7A 5EM3A 4NUDA 3P1EA 5DYUA 3U5JA 3O34A 5E9KA 5BT3A 5CUDA 3LQJA 4PY6A 4WIVA 4ZC9A 4O71A 4CLBA 4A9JA 4YBMA 2YQDA 4O7EA 5HRXA 2RNXA 4BW4A 4NUEA 3JVLA 3SVFA 5AD2A 4UIUA 5E3GA 4UIXA 5CZGA 4XY8A 5L8UA 5CY9A 5L98A 2KTBB 4N4IA 2RI7A 4OGIA 5HEMA 5L97A 5J0DA 3IU5A 4LZ2A 5FG5A 4LYSA 5IG6A 5K29A 4UYFB 4QEVA 5F62A 4LR6A 2RNWA 5DYAA 3U5KA 5FB0A 5FE5A 5E9VA 4TTEA 5E9MA 5II2A 5ENBA 4O7AA 5DKDA 5CUCA 2OUOA 4LZSA 5FBXA 3MXFA 4IR5A 5E9YA 4QY4A 5D0CA 4NR4A 5D3NA 4A9NA 2OO1A 5CP5A 4UITA 3QZSA 5DBMA 5I86A 4HXOA 4QR3A 4NRAA 4CUQA 4Z6HA 4YYDA 5IBNA 5LKZA 5I40A 4O74A 4QYLA 3S91A 3UVYA 5EQ1A 2DVVA 4N4HA 3HMEA 5IGLA 5IIDA 4C67A 4MR5A 4TU4A 4A9EA 4CUTA 4CURA 5D3JA 5E9LA 5C87A 5FE6A 5HQ5A 5C8GA 5I89A 4QBMA 4RVRA 3Q2EA 4C66A 4O7BA 4QZSA 4MR3A 5D3SA 5F5ZA 4A9MA 5FH8A 5IGMA 4O75A 4A9FA 3MUKA 2NXBA 3Q2FA 4QSWA 5CRMA 5I83A 5D7XA 2DKWA 4NR6A 5KTUA 4YABA 5ETBA 4KCXA 4NYXA 4CUSA 3O33A 5FE9A 5CS8A 2DATA 3HMHA 5KTXA 2H60A 3SVGA 4QSTA 5HQ7A 3UVDA 5FFWA 2R10A 4TQNA 5FDZA 5EP7A 5I7YA 5AMEA 4PS5A 5ENFA 5F2PA 5LKXA 4PKLA 4YYGA 4PCIA 4J0SA 4QEWA 4HXMA 5DKHA 4QC1A 4YH3A 5KTWA 5ENJA 4LYIA 4J0RA 3ONIA 4UYEA 4QUTA 4ALHA 1E6IA 5HJCA 3MULA 3FKMX 5EWDA 4Q0OA 5C4QA 4TT6A 2F6JA 5LUUA 3MB4A 3P1DA 3U5LA 5ENHA 4LC2A 5L99A 2N9GA 5A5QA 4O70A 5A5OA 4XUAA 5A5PA 3DAIA 5H85A 5HFQA 3IU6A 5EPRA 3LJWA 4OGJA 5D25A 5G4RA 4O77A 5HLSA 4TS8A 3G0LA 5F60A 2RS9B 5CUEA 5I7XA 5CQ3A 5HQ6A
chains in the Genus database with same CATH superfamily
4YATA 2YEKA 4NR9A 2WP2A 4YYNA 5BT4A 2EJNA 3K2JA 4YC9A 4AKNA 2RNYA 5LKUA 4PTBA 4YK0A 4A9IA 2MJVB 5ACYA 5DKCA 4CL9A 5CUBA 5CRZA 5ENIA 4NYVA 5A82A 4NR5A 5A5SA 4YAXA 3AADA 4Y03A 4AKHA 4O76A 4TT4A 5F25A 5E74A 3U5MA 1WUMA 4NRBA 4F3IA 4HXSA 5IGNA 5KHMA 3MB3A 3UW9A 5D3RA 3JVJA 4OUFA 4YY4A 4O78A 2DVRA 5F1HA 5A5RA 5D3LA 5EWWA 4HXKA 5EA1A 3U5NA 2WP1A 4XUBA 5LJ0A 5A5NA 4LRGA 5EPBA 5EI4A 4LYWA 4NQMA 3ZYUA 4NS5A 5EK9A 5DYXA 5EICA 3U5OA 1X0JA 3O36A 4YYKA 4ZW1A 2I7KA 4IR3A 5A7CA 5LVRA 4N4GA 4AKIA 4AKGA 4WHWA 2RFJA 4UIVA 5HFRA 4QSPA 4QUUA 5CFWA 3UVXA 3UV5A 3SVHA 4TYLA 4QR5A 3UV4A 3DWYA 5DFDA 4WHUA 3P5OA 4UIWA 4A9OA 5L96A 4UYGA 5FE8A 4YADA 2R0YA 2F6NA 2R0VA 4LZRA 1JM4B 5H1UA 4LDFA 4A9KA 3TLPA 5LKTA 2GRCA 4ZQLA 5E9IA 4GPJA 3AQAA 2RO1A 5EGUA 4Z6IA 2L85A 5DYCA 4YYIA 4CFKA 4A9LA 5LJ1A 4TU6A 5ENCA 4QSUA 5JI8A 4NXJA 5D24A 2LSPB 3O35A 4MR6A 3QZTA 5EWVA 4A9HA 5HCLA 5HRWA 5FE0A 5TB6A 3S92A 2YDWA 2DVQA 4YY6A 2L84A 4N3WA 5D3PA 2FSAA 2R0SA 5EWCA 4BW1A 3VKHA 5LJ2A 5FE1A 4CUUA 4HBVA 4Q0NA 5F63A 4XY9A 5I1QA 5H1VA 5FE4A 4BJXA 5D3TA 5E73A 5I88A 3G0JA 1N72A 3U5PA 4IORA 5ETDA 4YH4A 3GG3A 4IOQA 5KU3A 3D7CA 5COIA 1ZS5A 3VKGA 2YW5A 5DW1A 4UIZA 3QZVA 5ENGA 5HELA 4XYAA 5F3AA 4AI6A 4PCEA 5H1TA 4BHWA 4TT2A 5BT5A 4QSQA 4E96A 4ALGA 4Z1SA 4HXRA 5CU8A 3MQMA 5F1LA 4MEOA 4QC3A 4QB3A 2E7OA 4QEUA 5CQAA 5DY7A 4MEQA 5EWHA 5FG4A 3LQHA 2E7NA 5EVAA 5C7NA 5CTLA 5DLZA 4J1PA 1F68A 4UYFA 4CUPA 5AD3A 2D82A 2YEMA 3LQIA 4KV4A 2G4AA 5TCMA 4TZ2A 5DFBA 5AMFA 5FFVA 5CQ4A 2L5EA 5CPEA 4QSSA 4J3IA 5I80A 3ERRA 4HXNA 5CQ6A 5EPSA 4CFLA 4N4FA 5EU1A 4HBWA 4YYMA 2OSSA 4HXLA 3JVKA 5FH6A 3HMFA 3NXBA 5DX4A 4UIYA 4O7CA 5HENA 5G4SA 3LXJA 5DFCA 5FE7A 5FH7A 4DONA 5FE2A 4X2IA 3P1CA 5FB1A 5HM0A 5JWMA 5L8TA 2I8NA 5II1A 2DVSA 1WUGA 5CUAA 5E0RA 2YYNA 4MENA 4NRCA 5D3HA 4YYJA 2D9EA 5HRVA 5C85A 5I29A 4QSRA 4FLPA 4NYWA 4QYDA 4Z93A 5F61A 4UYHA 4IR4A 5EV9A 5LVQA 4HXPA 3P1FA 4Z1QA 1JSPB 4YBTA 5FG6A 4NR8A 5FE3A 4NUCA 3O37A 5CQ8A 5A85A 4QSXA 5A83A 4BW3A 5CUGA 5CQ7A 4KV1A 5EISA 5CQ5A 5FFYA 5E7DA 3JVMA 4BW2A 2YELA 4QR4A 5CQTA 4UYDA 4QSVA 4O72A 1EQFA 5ENEA 4HBYA 4IOOA 3RCWA 5E3DA 4YBSA 2DWWA 5KO4A 5F36A 5DW2A 5IGKA 4QNSA 4O7FA 2E3KA 4MEPA 5D26A 3UVWA 5CGPA 4MR4A 5C89A 4NQNA 3UV2A 5DLXA 3I3JA 4YYHA 5A81A 4IR6A 4HBXA 4TZ8A 4NR7A 3D1BA 5EM3A 4NUDA 3P1EA 5DYUA 3U5JA 3D1DA 3O34A 5E9KA 5BT3A 5CUDA 3LQJA 4PY6A 4WIVA 4ZC9A 4O71A 4CLBA 4A9JA 4YBMA 2YQDA 4O7EA 5HRXA 2RNXA 4BW4A 4NUEA 3JVLA 3SVFA 5AD2A 4UIUA 5E3GA 4UIXA 5CZGA 4XY8A 5L8UA 5CY9A 5L98A 2KTBB 4N4IA 2RI7A 4OGIA 5HEMA 5L97A 5J0DA 3IU5A 4LZ2A 5FG5A 4LYSA 5IG6A 5K29A 4UYFB 4QEVA 5F62A 4LR6A 2RNWA 5DYAA 3U5KA 5FB0A 5FE5A 5E9VA 4TTEA 5E9MA 5II2A 5ENBA 4O7AA 5DKDA 5CUCA 2OUOA 4LZSA 5FBXA 3MXFA 4IR5A 5E9YA 4QY4A 5D0CA 4NR4A 5D3NA 4A9NA 2OO1A 5CP5A 4UITA 3QZSA 5DBMA 5I86A 4HXOA 4QR3A 4NRAA 4CUQA 4Z6HA 4YYDA 5IBNA 5LKZA 5I40A 4O74A 4QYLA 3S91A 3UVYA 5EQ1A 2DVVA 4N4HA 3HMEA 5IGLA 5IIDA 4C67A 4MR5A 4TU4A 4A9EA 4CUTA 4CURA 5D3JA 5E9LA 5C87A 5FE6A 5HQ5A 5C8GA 5I89A 4QBMA 4RVRA 3Q2EA 4C66A 4O7BA 4QZSA 4MR3A 5D3SA 5F5ZA 4A9MA 5FH8A 5IGMA 4O75A 4A9FA 3MUKA 2NXBA 3Q2FA 4QSWA 5CRMA 5I83A 5D7XA 2DKWA 4NR6A 5KTUA 4YABA 5ETBA 4KCXA 4NYXA 4CUSA 3O33A 5FE9A 5CS8A 2DATA 3HMHA 5KTXA 2H60A 3SVGA 4QSTA 5HQ7A 3UVDA 5FFWA 2R10A 4TQNA 5FDZA 5EP7A 5I7YA 5AMEA 4PS5A 5ENFA 5F2PA 5LKXA 4PKLA 4YYGA 4PCIA 4J0SA 4QEWA 4HXMA 5DKHA 4QC1A 4YH3A 5KTWA 5ENJA 4LYIA 4J0RA 3ONIA 4UYEA 4QUTA 4ALHA 1E6IA 5HJCA 3MULA 3FKMX 5EWDA 4Q0OA 5C4QA 4TT6A 2F6JA 5LUUA 3MB4A 3P1DA 3U5LA 5ENHA 4LC2A 5L99A 1PUOA 2N9GA 5A5QA 4O70A 5A5OA 4XUAA 5A5PA 3DAIA 5H85A 5HFQA 3IU6A 5EPRA 1ZKRA 3LJWA 4OGJA 5D25A 5G4RA 4O77A 5HLSA 4TS8A 3G0LA 5F60A 2RS9B 5CUEA 5I7XA 5CQ3A 5HQ6A
chains in the Genus database with same CATH topology
4YATA 2YEKA 4NR9A 2WP2A 4YYNA 5BT4A 3K2JA 4YC9A 4AKNA 2RNYA 5LKUA 4PTBA 4YK0A 4A9IA 2MJVB 5ACYA 5DKCA 4CL9A 5CUBA 5CRZA 5ENIA 4NYVA 5A82A 4NR5A 5A5SA 4YAXA 3AADA 4Y03A 4O76A 4TT4A 5F25A 5E74A 3U5MA 1WUMA 4NRBA 4F3IA 4HXSA 5IGNA 5KHMA 3MB3A 3UW9A 5D3RA 3JVJA 4OUFA 4YY4A 4O78A 2DVRA 5F1HA 5A5RA 5D3LA 5EWWA 4HXKA 5EA1A 3U5NA 2WP1A 4XUBA 5LJ0A 5A5NA 4LRGA 5EPBA 5EI4A 4LYWA 4NQMA 3ZYUA 4NS5A 5EK9A 5DYXA 5EICA 3U5OA 1X0JA 3O36A 4YYKA 4ZW1A 2I7KA 4IR3A 5A7CA 5LVRA 4N4GA 4WHWA 2RFJA 4UIVA 5HFRA 4QSPA 4QUUA 5CFWA 3UVXA 3UV5A 3SVHA 4TYLA 4QR5A 3UV4A 3DWYA 5DFDA 4WHUA 3P5OA 4UIWA 4A9OA 5L96A 4UYGA 5FE8A 4YADA 2R0YA 2F6NA 2R0VA 4LZRA 1JM4B 5H1UA 4LDFA 4A9KA 3TLPA 5LKTA 2GRCA 4ZQLA 5E9IA 4GPJA 3AQAA 2RO1A 5EGUA 4Z6IA 2L85A 5DYCA 4YYIA 4CFKA 4A9LA 5LJ1A 4TU6A 5ENCA 4QSUA 5JI8A 4NXJA 5D24A 2LSPB 3O35A 4MR6A 3QZTA 5EWVA 4A9HA 5HCLA 5HRWA 5FE0A 5TB6A 3S92A 2YDWA 2DVQA 4YY6A 2L84A 4N3WA 5D3PA 2FSAA 2R0SA 5EWCA 4BW1A 5LJ2A 5FE1A 4CUUA 4HBVA 4Q0NA 5F63A 4XY9A 5I1QA 5H1VA 5FE4A 4BJXA 5D3TA 5E73A 5I88A 3G0JA 1N72A 3U5PA 4IORA 5ETDA 4YH4A 3GG3A 4IOQA 5KU3A 3D7CA 5COIA 1ZS5A 2YW5A 5DW1A 4UIZA 3QZVA 5ENGA 5HELA 4XYAA 5F3AA 4PCEA 5H1TA 4BHWA 4TT2A 5BT5A 4QSQA 4E96A 4ALGA 4Z1SA 4HXRA 5CU8A 3MQMA 5F1LA 4MEOA 4QC3A 4QB3A 2E7OA 4QEUA 5CQAA 5DY7A 4MEQA 5EWHA 5FG4A 3LQHA 2E7NA 5EVAA 5C7NA 5CTLA 5DLZA 4J1PA 1F68A 4UYFA 4CUPA 5AD3A 2D82A 2YEMA 3LQIA 4KV4A 2G4AA 5TCMA 4TZ2A 5DFBA 5AMFA 5FFVA 5CQ4A 2L5EA 5CPEA 4QSSA 4J3IA 5I80A 4HXNA 5CQ6A 5EPSA 4CFLA 4N4FA 5EU1A 4HBWA 4YYMA 2OSSA 4HXLA 3JVKA 5FH6A 3HMFA 3NXBA 5DX4A 4UIYA 4O7CA 5HENA 5G4SA 3LXJA 5DFCA 5FE7A 5FH7A 4DONA 5FE2A 4X2IA 3P1CA 5FB1A 5HM0A 5JWMA 5L8TA 2I8NA 5II1A 2DVSA 1WUGA 5CUAA 5E0RA 2YYNA 4MENA 4NRCA 5D3HA 4YYJA 2D9EA 5HRVA 5C85A 5I29A 4QSRA 4FLPA 4NYWA 4QYDA 4Z93A 5F61A 4UYHA 4IR4A 5EV9A 5LVQA 4HXPA 3P1FA 4Z1QA 1JSPB 4YBTA 5FG6A 4NR8A 5FE3A 4NUCA 3O37A 5CQ8A 5A85A 4QSXA 5A83A 4BW3A 5CUGA 5CQ7A 4KV1A 5EISA 5CQ5A 5FFYA 5E7DA 3JVMA 4BW2A 2YELA 4QR4A 5CQTA 4UYDA 4QSVA 4O72A 1EQFA 5ENEA 4HBYA 4IOOA 3RCWA 5E3DA 4YBSA 2DWWA 5KO4A 5F36A 5DW2A 5IGKA 4QNSA 4O7FA 2E3KA 4MEPA 5D26A 3UVWA 5CGPA 4MR4A 5C89A 4NQNA 3UV2A 5DLXA 3I3JA 4YYHA 5A81A 4IR6A 4HBXA 4TZ8A 4NR7A 5EM3A 4NUDA 3P1EA 5DYUA 3U5JA 3O34A 5E9KA 5BT3A 5CUDA 3LQJA 4PY6A 4WIVA 4ZC9A 4O71A 4CLBA 4A9JA 4YBMA 2YQDA 4O7EA 5HRXA 2RNXA 4BW4A 4NUEA 3JVLA 3SVFA 5AD2A 4UIUA 5E3GA 4UIXA 5CZGA 4XY8A 5L8UA 5CY9A 5L98A 2KTBB 4N4IA 2RI7A 4OGIA 5HEMA 5L97A 5J0DA 3IU5A 4LZ2A 5FG5A 4LYSA 5IG6A 5K29A 4UYFB 4QEVA 5F62A 4LR6A 2RNWA 5DYAA 3U5KA 5FB0A 5FE5A 5E9VA 4TTEA 5E9MA 5II2A 5ENBA 4O7AA 5DKDA 5CUCA 2OUOA 4LZSA 5FBXA 3MXFA 4IR5A 5E9YA 4QY4A 5D0CA 4NR4A 5D3NA 4A9NA 2OO1A 5CP5A 4UITA 3QZSA 5DBMA 5I86A 4HXOA 4QR3A 4NRAA 4CUQA 4Z6HA 4YYDA 5IBNA 5LKZA 5I40A 4O74A 4QYLA 3S91A 3UVYA 5EQ1A 2DVVA 4N4HA 3HMEA 5IGLA 5IIDA 4C67A 4MR5A 4TU4A 4A9EA 4CUTA 4CURA 5D3JA 5E9LA 5C87A 5FE6A 5HQ5A 5C8GA 5I89A 4QBMA 4RVRA 3Q2EA 4C66A 4O7BA 4QZSA 4MR3A 5D3SA 5F5ZA 4A9MA 5FH8A 5IGMA 4O75A 4A9FA 3MUKA 2NXBA 3Q2FA 4QSWA 5CRMA 5I83A 5D7XA 2DKWA 4NR6A 5KTUA 4YABA 5ETBA 4KCXA 4NYXA 4CUSA 3O33A 5FE9A 5CS8A 2DATA 3HMHA 5KTXA 2H60A 3SVGA 4QSTA 5HQ7A 3UVDA 5FFWA 2R10A 4TQNA 5FDZA 5EP7A 5I7YA 5AMEA 4PS5A 5ENFA 5F2PA 5LKXA 4PKLA 4YYGA 4PCIA 4J0SA 4QEWA 4HXMA 5DKHA 4QC1A 4YH3A 5KTWA 5ENJA 4LYIA 4J0RA 3ONIA 4UYEA 4QUTA 4ALHA 1E6IA 5HJCA 3MULA 3FKMX 5EWDA 4Q0OA 5C4QA 4TT6A 2F6JA 5LUUA 3MB4A 3P1DA 3U5LA 5ENHA 4LC2A 5L99A 2N9GA 5A5QA 4O70A 5A5OA 4XUAA 5A5PA 3DAIA 5H85A 5HFQA 3IU6A 5EPRA 3LJWA 4OGJA 5D25A 5G4RA 4O77A 5HLSA 4TS8A 3G0LA 5F60A 2RS9B 5CUEA 5I7XA 5CQ3A 5HQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAT A;  2YEK A;  4NR9 A;  2WP2 A;  4YYN A;  5BT4 A;  3K2J A;  4YC9 A;  4AKN A;  2RNY A;  5LKU A;  4PTB A;  4YK0 A;  4A9I A;  2MJV B;  5ACY A;  5DKC A;  4CL9 A;  5CUB A;  5CRZ A;  5ENI A;  4NYV A;  5A82 A;  4NR5 A;  5A5S A;  4YAX A;  3AAD A;  4Y03 A;  4O76 A;  4TT4 A;  5F25 A;  5E74 A;  3U5M A;  1WUM A;  4NRB A;  4F3I A;  4HXS A;  5IGN A;  5KHM A;  3MB3 A;  3UW9 A;  5D3R A;  3JVJ A;  4OUF A;  4YY4 A;  4O78 A;  2DVR A;  5F1H A;  5A5R A;  5D3L A;  5EWW A;  4HXK A;  5EA1 A;  3U5N A;  2WP1 A;  4XUB A;  5LJ0 A;  5A5N A;  4LRG A;  5EPB A;  5EI4 A;  4LYW A;  4NQM A;  3ZYU A;  4NS5 A;  5EK9 A;  5DYX A;  5EIC A;  3U5O A;  1X0J A;  3O36 A;  4YYK A;  4ZW1 A;  2I7K A;  4IR3 A;  5A7C A;  5LVR A;  4N4G A;  4WHW A;  2RFJ A;  4UIV A;  5HFR A;  4QSP A;  4QUU A;  5CFW A;  3UVX A;  3UV5 A;  3SVH A;  4TYL A;  4QR5 A;  3UV4 A;  3DWY A;  5DFD A;  4WHU A;  3P5O A;  4UIW A;  4A9O A;  5L96 A;  4UYG A;  5FE8 A;  4YAD A;  2R0Y A;  2F6N A;  2R0V A;  4LZR A;  1JM4 B;  5H1U A;  4LDF A;  4A9K A;  3TLP A;  5LKT A;  2GRC A;  4ZQL A;  5E9I A;  4GPJ A;  3AQA A;  2RO1 A;  5EGU A;  4Z6I A;  2L85 A;  5DYC A;  4YYI A;  4CFK A;  4A9L A;  5LJ1 A;  4TU6 A;  5ENC A;  4QSU A;  5JI8 A;  4NXJ A;  5D24 A;  2LSP B;  3O35 A;  4MR6 A;  3QZT A;  5EWV A;  4A9H A;  5HCL A;  5HRW A;  5FE0 A;  5TB6 A;  3S92 A;  2YDW A;  2DVQ A;  4YY6 A;  2L84 A;  4N3W A;  5D3P A;  2FSA A;  2R0S A;  5EWC A;  4BW1 A;  5LJ2 A;  5FE1 A;  4CUU A;  4HBV A;  4Q0N A;  5F63 A;  4XY9 A;  5I1Q A;  5H1V A;  5FE4 A;  4BJX A;  5D3T A;  5E73 A;  5I88 A;  3G0J A;  1N72 A;  3U5P A;  4IOR A;  5ETD A;  4YH4 A;  3GG3 A;  4IOQ A;  5KU3 A;  3D7C A;  5COI A;  1ZS5 A;  2YW5 A;  5DW1 A;  4UIZ A;  3QZV A;  5ENG A;  5HEL A;  4XYA A;  5F3A A;  4PCE A;  5H1T A;  4BHW A;  4TT2 A;  5BT5 A;  4QSQ A;  4E96 A;  4ALG A;  4Z1S A;  4HXR A;  5CU8 A;  3MQM A;  5F1L A;  4MEO A;  4QC3 A;  4QB3 A;  2E7O A;  4QEU A;  5CQA A;  5DY7 A;  4MEQ A;  5EWH A;  5FG4 A;  3LQH A;  2E7N A;  5EVA A;  5C7N A;  5CTL A;  5DLZ A;  4J1P A;  1F68 A;  4UYF A;  4CUP A;  5AD3 A;  2D82 A;  2YEM A;  3LQI A;  4KV4 A;  2G4A A;  5TCM A;  4TZ2 A;  5DFB A;  5AMF A;  5FFV A;  5CQ4 A;  2L5E A;  5CPE A;  4QSS A;  4J3I A;  5I80 A;  4HXN A;  5CQ6 A;  5EPS A;  4CFL A;  4N4F A;  5EU1 A;  4HBW A;  4YYM A;  2OSS A;  4HXL A;  3JVK A;  5FH6 A;  3HMF A;  3NXB A;  5DX4 A;  4UIY A;  4O7C A;  5HEN A;  5G4S A;  3LXJ A;  5DFC A;  5FE7 A;  5FH7 A;  4DON A;  5FE2 A;  4X2I A;  3P1C A;  5FB1 A;  5HM0 A;  5JWM A;  5L8T A;  2I8N A;  5II1 A;  2DVS A;  1WUG A;  5CUA A;  5E0R A;  2YYN A;  4MEN A;  4NRC A;  5D3H A;  4YYJ A;  2D9E A;  5HRV A;  5C85 A;  5I29 A;  4QSR A;  4FLP A;  4NYW A;  4QYD A;  4Z93 A;  5F61 A;  4UYH A;  4IR4 A;  5EV9 A;  5LVQ A;  4HXP A;  3P1F A;  4Z1Q A;  1JSP B;  4YBT A;  5FG6 A;  4NR8 A;  5FE3 A;  4NUC A;  3O37 A;  5CQ8 A;  5A85 A;  4QSX A;  5A83 A;  4BW3 A;  5CUG A;  5CQ7 A;  4KV1 A;  5EIS A;  5CQ5 A;  5FFY A;  5E7D A;  3JVM A;  4BW2 A;  2YEL A;  4QR4 A;  5CQT A;  4UYD A;  4QSV A;  4O72 A;  1EQF A;  5ENE A;  4HBY A;  4IOO A;  3RCW A;  5E3D A;  4YBS A;  2DWW A;  5KO4 A;  5F36 A;  5DW2 A;  5IGK A;  4QNS A;  4O7F A;  2E3K A;  4MEP A;  5D26 A;  3UVW A;  5CGP A;  4MR4 A;  5C89 A;  4NQN A;  3UV2 A;  5DLX A;  3I3J A;  4YYH A;  5A81 A;  4IR6 A;  4HBX A;  4TZ8 A;  4NR7 A;  5EM3 A;  4NUD A;  3P1E A;  5DYU A;  3U5J A;  3O34 A;  5E9K A;  5BT3 A;  5CUD A;  3LQJ A;  4PY6 A;  4WIV A;  4ZC9 A;  4O71 A;  4CLB A;  4A9J A;  4YBM A;  2YQD A;  4O7E A;  5HRX A;  2RNX A;  4BW4 A;  4NUE A;  3JVL A;  3SVF A;  5AD2 A;  4UIU A;  5E3G A;  4UIX A;  5CZG A;  4XY8 A;  5L8U A;  5CY9 A;  5L98 A;  2KTB B;  4N4I A;  2RI7 A;  4OGI A;  5HEM A;  5L97 A;  5J0D A;  3IU5 A;  4LZ2 A;  5FG5 A;  4LYS A;  5IG6 A;  5K29 A;  4UYF B;  4QEV A;  5F62 A;  4LR6 A;  2RNW A;  5DYA A;  3U5K A;  5FB0 A;  5FE5 A;  5E9V A;  4TTE A;  5E9M A;  5II2 A;  5ENB A;  4O7A A;  5DKD A;  5CUC A;  2OUO A;  4LZS A;  5FBX A;  3MXF A;  4IR5 A;  5E9Y A;  4QY4 A;  5D0C A;  4NR4 A;  5D3N A;  4A9N A;  2OO1 A;  5CP5 A;  4UIT A;  3QZS A;  5DBM A;  5I86 A;  4HXO A;  4QR3 A;  4NRA A;  4CUQ A;  4Z6H A;  4YYD A;  5IBN A;  5LKZ A;  5I40 A;  4O74 A;  4QYL A;  3S91 A;  3UVY A;  5EQ1 A;  2DVV A;  4N4H A;  3HME A;  5IGL A;  5IID A;  4C67 A;  4MR5 A;  4TU4 A;  4A9E A;  4CUT A;  4CUR A;  5D3J A;  5E9L A;  5C87 A;  5FE6 A;  5HQ5 A;  5C8G A;  5I89 A;  4QBM A;  4RVR A;  3Q2E A;  4C66 A;  4O7B A;  4QZS A;  4MR3 A;  5D3S A;  5F5Z A;  4A9M A;  5FH8 A;  5IGM A;  4O75 A;  4A9F A;  3MUK A;  2NXB A;  3Q2F A;  4QSW A;  5CRM A;  5I83 A;  5D7X A;  2DKW A;  4NR6 A;  5KTU A;  4YAB A;  5ETB A;  4KCX A;  4NYX A;  4CUS A;  3O33 A;  5FE9 A;  5CS8 A;  2DAT A;  3HMH A;  5KTX A;  2H60 A;  3SVG A;  4QST A;  5HQ7 A;  3UVD A;  5FFW A;  2R10 A;  4TQN A;  5FDZ A;  5EP7 A;  5I7Y A;  5AME A;  4PS5 A;  5ENF A;  5F2P A;  5LKX A;  4PKL A;  4YYG A;  4PCI A;  4J0S A;  4QEW A;  4HXM A;  5DKH A;  4QC1 A;  4YH3 A;  5KTW A;  5ENJ A;  4LYI A;  4J0R A;  3ONI A;  4UYE A;  4QUT A;  4ALH A;  1E6I A;  5HJC A;  3MUL A;  3FKM X;  5EWD A;  4Q0O A;  5C4Q A;  4TT6 A;  2F6J A;  5LUU A;  3MB4 A;  3P1D A;  3U5L A;  5ENH A;  4LC2 A;  5L99 A;  2N9G A;  5A5Q A;  4O70 A;  5A5O A;  4XUA A;  5A5P A;  3DAI A;  5H85 A;  5HFQ A;  3IU6 A;  5EPR A;  3LJW A;  4OGJ A;  5D25 A;  5G4R A;  4O77 A;  5HLS A;  4TS8 A;  3G0L A;  5F60 A;  2RS9 B;  5CUE A;  5I7X A;  5CQ3 A;  5HQ6 A; 
#chains in the Genus database with same CATH topology
 4YAT A;  2YEK A;  4NR9 A;  2WP2 A;  4YYN A;  5BT4 A;  2EJN A;  3K2J A;  4YC9 A;  4AKN A;  2RNY A;  5LKU A;  4PTB A;  4YK0 A;  4A9I A;  2MJV B;  5ACY A;  5DKC A;  4CL9 A;  5CUB A;  5CRZ A;  5ENI A;  4NYV A;  5A82 A;  4NR5 A;  5A5S A;  4YAX A;  3AAD A;  4Y03 A;  4AKH A;  4O76 A;  4TT4 A;  5F25 A;  5E74 A;  3U5M A;  1WUM A;  4NRB A;  4F3I A;  4HXS A;  5IGN A;  5KHM A;  3MB3 A;  3UW9 A;  5D3R A;  3JVJ A;  4OUF A;  4YY4 A;  4O78 A;  2DVR A;  5F1H A;  5A5R A;  5D3L A;  5EWW A;  4HXK A;  5EA1 A;  3U5N A;  2WP1 A;  4XUB A;  5LJ0 A;  5A5N A;  4LRG A;  5EPB A;  5EI4 A;  4LYW A;  4NQM A;  3ZYU A;  4NS5 A;  5EK9 A;  5DYX A;  5EIC A;  3U5O A;  1X0J A;  3O36 A;  4YYK A;  4ZW1 A;  2I7K A;  4IR3 A;  5A7C A;  5LVR A;  4N4G A;  4AKI A;  4AKG A;  4WHW A;  2RFJ A;  4UIV A;  5HFR A;  4QSP A;  4QUU A;  5CFW A;  3UVX A;  3UV5 A;  3SVH A;  4TYL A;  4QR5 A;  3UV4 A;  3DWY A;  5DFD A;  4WHU A;  3P5O A;  4UIW A;  4A9O A;  5L96 A;  4UYG A;  5FE8 A;  4YAD A;  2R0Y A;  2F6N A;  2R0V A;  4LZR A;  1JM4 B;  5H1U A;  4LDF A;  4A9K A;  3TLP A;  5LKT A;  2GRC A;  4ZQL A;  5E9I A;  4GPJ A;  3AQA A;  2RO1 A;  5EGU A;  4Z6I A;  2L85 A;  5DYC A;  4YYI A;  4CFK A;  4A9L A;  5LJ1 A;  4TU6 A;  5ENC A;  4QSU A;  5JI8 A;  4NXJ A;  5D24 A;  2LSP B;  3O35 A;  4MR6 A;  3QZT A;  5EWV A;  4A9H A;  5HCL A;  5HRW A;  5FE0 A;  5TB6 A;  3S92 A;  2YDW A;  2DVQ A;  4YY6 A;  2L84 A;  4N3W A;  5D3P A;  2FSA A;  2R0S A;  5EWC A;  4BW1 A;  3VKH A;  5LJ2 A;  5FE1 A;  4CUU A;  4HBV A;  4Q0N A;  5F63 A;  4XY9 A;  5I1Q A;  5H1V A;  5FE4 A;  4BJX A;  5D3T A;  5E73 A;  5I88 A;  3G0J A;  1N72 A;  3U5P A;  4IOR A;  5ETD A;  4YH4 A;  3GG3 A;  4IOQ A;  5KU3 A;  3D7C A;  5COI A;  1ZS5 A;  3VKG A;  2YW5 A;  5DW1 A;  4UIZ A;  3QZV A;  5ENG A;  5HEL A;  4XYA A;  5F3A A;  4AI6 A;  4PCE A;  5H1T A;  4BHW A;  4TT2 A;  5BT5 A;  4QSQ A;  4E96 A;  4ALG A;  4Z1S A;  4HXR A;  5CU8 A;  3MQM A;  5F1L A;  4MEO A;  4QC3 A;  4QB3 A;  2E7O A;  4QEU A;  5CQA A;  5DY7 A;  4MEQ A;  5EWH A;  5FG4 A;  3LQH A;  2E7N A;  5EVA A;  5C7N A;  5CTL A;  5DLZ A;  4J1P A;  1F68 A;  4UYF A;  4CUP A;  5AD3 A;  2D82 A;  2YEM A;  3LQI A;  4KV4 A;  2G4A A;  5TCM A;  4TZ2 A;  5DFB A;  5AMF A;  5FFV A;  5CQ4 A;  2L5E A;  5CPE A;  4QSS A;  4J3I A;  5I80 A;  3ERR A;  4HXN A;  5CQ6 A;  5EPS A;  4CFL A;  4N4F A;  5EU1 A;  4HBW A;  4YYM A;  2OSS A;  4HXL A;  3JVK A;  5FH6 A;  3HMF A;  3NXB A;  5DX4 A;  4UIY A;  4O7C A;  5HEN A;  5G4S A;  3LXJ A;  5DFC A;  5FE7 A;  5FH7 A;  4DON A;  5FE2 A;  4X2I A;  3P1C A;  5FB1 A;  5HM0 A;  5JWM A;  5L8T A;  2I8N A;  5II1 A;  2DVS A;  1WUG A;  5CUA A;  5E0R A;  2YYN A;  4MEN A;  4NRC A;  5D3H A;  4YYJ A;  2D9E A;  5HRV A;  5C85 A;  5I29 A;  4QSR A;  4FLP A;  4NYW A;  4QYD A;  4Z93 A;  5F61 A;  4UYH A;  4IR4 A;  5EV9 A;  5LVQ A;  4HXP A;  3P1F A;  4Z1Q A;  1JSP B;  4YBT A;  5FG6 A;  4NR8 A;  5FE3 A;  4NUC A;  3O37 A;  5CQ8 A;  5A85 A;  4QSX A;  5A83 A;  4BW3 A;  5CUG A;  5CQ7 A;  4KV1 A;  5EIS A;  5CQ5 A;  5FFY A;  5E7D A;  3JVM A;  4BW2 A;  2YEL A;  4QR4 A;  5CQT A;  4UYD A;  4QSV A;  4O72 A;  1EQF A;  5ENE A;  4HBY A;  4IOO A;  3RCW A;  5E3D A;  4YBS A;  2DWW A;  5KO4 A;  5F36 A;  5DW2 A;  5IGK A;  4QNS A;  4O7F A;  2E3K A;  4MEP A;  5D26 A;  3UVW A;  5CGP A;  4MR4 A;  5C89 A;  4NQN A;  3UV2 A;  5DLX A;  3I3J A;  4YYH A;  5A81 A;  4IR6 A;  4HBX A;  4TZ8 A;  4NR7 A;  3D1B A;  5EM3 A;  4NUD A;  3P1E A;  5DYU A;  3U5J A;  3D1D A;  3O34 A;  5E9K A;  5BT3 A;  5CUD A;  3LQJ A;  4PY6 A;  4WIV A;  4ZC9 A;  4O71 A;  4CLB A;  4A9J A;  4YBM A;  2YQD A;  4O7E A;  5HRX A;  2RNX A;  4BW4 A;  4NUE A;  3JVL A;  3SVF A;  5AD2 A;  4UIU A;  5E3G A;  4UIX A;  5CZG A;  4XY8 A;  5L8U A;  5CY9 A;  5L98 A;  2KTB B;  4N4I A;  2RI7 A;  4OGI A;  5HEM A;  5L97 A;  5J0D A;  3IU5 A;  4LZ2 A;  5FG5 A;  4LYS A;  5IG6 A;  5K29 A;  4UYF B;  4QEV A;  5F62 A;  4LR6 A;  2RNW A;  5DYA A;  3U5K A;  5FB0 A;  5FE5 A;  5E9V A;  4TTE A;  5E9M A;  5II2 A;  5ENB A;  4O7A A;  5DKD A;  5CUC A;  2OUO A;  4LZS A;  5FBX A;  3MXF A;  4IR5 A;  5E9Y A;  4QY4 A;  5D0C A;  4NR4 A;  5D3N A;  4A9N A;  2OO1 A;  5CP5 A;  4UIT A;  3QZS A;  5DBM A;  5I86 A;  4HXO A;  4QR3 A;  4NRA A;  4CUQ A;  4Z6H A;  4YYD A;  5IBN A;  5LKZ A;  5I40 A;  4O74 A;  4QYL A;  3S91 A;  3UVY A;  5EQ1 A;  2DVV A;  4N4H A;  3HME A;  5IGL A;  5IID A;  4C67 A;  4MR5 A;  4TU4 A;  4A9E A;  4CUT A;  4CUR A;  5D3J A;  5E9L A;  5C87 A;  5FE6 A;  5HQ5 A;  5C8G A;  5I89 A;  4QBM A;  4RVR A;  3Q2E A;  4C66 A;  4O7B A;  4QZS A;  4MR3 A;  5D3S A;  5F5Z A;  4A9M A;  5FH8 A;  5IGM A;  4O75 A;  4A9F A;  3MUK A;  2NXB A;  3Q2F A;  4QSW A;  5CRM A;  5I83 A;  5D7X A;  2DKW A;  4NR6 A;  5KTU A;  4YAB A;  5ETB A;  4KCX A;  4NYX A;  4CUS A;  3O33 A;  5FE9 A;  5CS8 A;  2DAT A;  3HMH A;  5KTX A;  2H60 A;  3SVG A;  4QST A;  5HQ7 A;  3UVD A;  5FFW A;  2R10 A;  4TQN A;  5FDZ A;  5EP7 A;  5I7Y A;  5AME A;  4PS5 A;  5ENF A;  5F2P A;  5LKX A;  4PKL A;  4YYG A;  4PCI A;  4J0S A;  4QEW A;  4HXM A;  5DKH A;  4QC1 A;  4YH3 A;  5KTW A;  5ENJ A;  4LYI A;  4J0R A;  3ONI A;  4UYE A;  4QUT A;  4ALH A;  1E6I A;  5HJC A;  3MUL A;  3FKM X;  5EWD A;  4Q0O A;  5C4Q A;  4TT6 A;  2F6J A;  5LUU A;  3MB4 A;  3P1D A;  3U5L A;  5ENH A;  4LC2 A;  5L99 A;  1PUO A;  2N9G A;  5A5Q A;  4O70 A;  5A5O A;  4XUA A;  5A5P A;  3DAI A;  5H85 A;  5HFQ A;  3IU6 A;  5EPR A;  1ZKR A;  3LJW A;  4OGJ A;  5D25 A;  5G4R A;  4O77 A;  5HLS A;  4TS8 A;  3G0L A;  5F60 A;  2RS9 B;  5CUE A;  5I7X A;  5CQ3 A;  5HQ6 A; 
#chains in the Genus database with same CATH homology
 4YAT A;  2YEK A;  4NR9 A;  2WP2 A;  4YYN A;  5BT4 A;  3K2J A;  4YC9 A;  4AKN A;  2RNY A;  5LKU A;  4PTB A;  4YK0 A;  4A9I A;  2MJV B;  5ACY A;  5DKC A;  4CL9 A;  5CUB A;  5CRZ A;  5ENI A;  4NYV A;  5A82 A;  4NR5 A;  5A5S A;  4YAX A;  3AAD A;  4Y03 A;  4O76 A;  4TT4 A;  5F25 A;  5E74 A;  3U5M A;  1WUM A;  4NRB A;  4F3I A;  4HXS A;  5IGN A;  5KHM A;  3MB3 A;  3UW9 A;  5D3R A;  3JVJ A;  4OUF A;  4YY4 A;  4O78 A;  2DVR A;  5F1H A;  5A5R A;  5D3L A;  5EWW A;  4HXK A;  5EA1 A;  3U5N A;  2WP1 A;  4XUB A;  5LJ0 A;  5A5N A;  4LRG A;  5EPB A;  5EI4 A;  4LYW A;  4NQM A;  3ZYU A;  4NS5 A;  5EK9 A;  5DYX A;  5EIC A;  3U5O A;  1X0J A;  3O36 A;  4YYK A;  4ZW1 A;  2I7K A;  4IR3 A;  5A7C A;  5LVR A;  4N4G A;  4WHW A;  2RFJ A;  4UIV A;  5HFR A;  4QSP A;  4QUU A;  5CFW A;  3UVX A;  3UV5 A;  3SVH A;  4TYL A;  4QR5 A;  3UV4 A;  3DWY A;  5DFD A;  4WHU A;  3P5O A;  4UIW A;  4A9O A;  5L96 A;  4UYG A;  5FE8 A;  4YAD A;  2R0Y A;  2F6N A;  2R0V A;  4LZR A;  1JM4 B;  5H1U A;  4LDF A;  4A9K A;  3TLP A;  5LKT A;  2GRC A;  4ZQL A;  5E9I A;  4GPJ A;  3AQA A;  2RO1 A;  5EGU A;  4Z6I A;  2L85 A;  5DYC A;  4YYI A;  4CFK A;  4A9L A;  5LJ1 A;  4TU6 A;  5ENC A;  4QSU A;  5JI8 A;  4NXJ A;  5D24 A;  2LSP B;  3O35 A;  4MR6 A;  3QZT A;  5EWV A;  4A9H A;  5HCL A;  5HRW A;  5FE0 A;  5TB6 A;  3S92 A;  2YDW A;  2DVQ A;  4YY6 A;  2L84 A;  4N3W A;  5D3P A;  2FSA A;  2R0S A;  5EWC A;  4BW1 A;  5LJ2 A;  5FE1 A;  4CUU A;  4HBV A;  4Q0N A;  5F63 A;  4XY9 A;  5I1Q A;  5H1V A;  5FE4 A;  4BJX A;  5D3T A;  5E73 A;  5I88 A;  3G0J A;  1N72 A;  3U5P A;  4IOR A;  5ETD A;  4YH4 A;  3GG3 A;  4IOQ A;  5KU3 A;  3D7C A;  5COI A;  1ZS5 A;  2YW5 A;  5DW1 A;  4UIZ A;  3QZV A;  5ENG A;  5HEL A;  4XYA A;  5F3A A;  4PCE A;  5H1T A;  4BHW A;  4TT2 A;  5BT5 A;  4QSQ A;  4E96 A;  4ALG A;  4Z1S A;  4HXR A;  5CU8 A;  3MQM A;  5F1L A;  4MEO A;  4QC3 A;  4QB3 A;  2E7O A;  4QEU A;  5CQA A;  5DY7 A;  4MEQ A;  5EWH A;  5FG4 A;  3LQH A;  2E7N A;  5EVA A;  5C7N A;  5CTL A;  5DLZ A;  4J1P A;  1F68 A;  4UYF A;  4CUP A;  5AD3 A;  2D82 A;  2YEM A;  3LQI A;  4KV4 A;  2G4A A;  5TCM A;  4TZ2 A;  5DFB A;  5AMF A;  5FFV A;  5CQ4 A;  2L5E A;  5CPE A;  4QSS A;  4J3I A;  5I80 A;  4HXN A;  5CQ6 A;  5EPS A;  4CFL A;  4N4F A;  5EU1 A;  4HBW A;  4YYM A;  2OSS A;  4HXL A;  3JVK A;  5FH6 A;  3HMF A;  3NXB A;  5DX4 A;  4UIY A;  4O7C A;  5HEN A;  5G4S A;  3LXJ A;  5DFC A;  5FE7 A;  5FH7 A;  4DON A;  5FE2 A;  4X2I A;  3P1C A;  5FB1 A;  5HM0 A;  5JWM A;  5L8T A;  2I8N A;  5II1 A;  2DVS A;  1WUG A;  5CUA A;  5E0R A;  2YYN A;  4MEN A;  4NRC A;  5D3H A;  4YYJ A;  2D9E A;  5HRV A;  5C85 A;  5I29 A;  4QSR A;  4FLP A;  4NYW A;  4QYD A;  4Z93 A;  5F61 A;  4UYH A;  4IR4 A;  5EV9 A;  5LVQ A;  4HXP A;  3P1F A;  4Z1Q A;  1JSP B;  4YBT A;  5FG6 A;  4NR8 A;  5FE3 A;  4NUC A;  3O37 A;  5CQ8 A;  5A85 A;  4QSX A;  5A83 A;  4BW3 A;  5CUG A;  5CQ7 A;  4KV1 A;  5EIS A;  5CQ5 A;  5FFY A;  5E7D A;  3JVM A;  4BW2 A;  2YEL A;  4QR4 A;  5CQT A;  4UYD A;  4QSV A;  4O72 A;  1EQF A;  5ENE A;  4HBY A;  4IOO A;  3RCW A;  5E3D A;  4YBS A;  2DWW A;  5KO4 A;  5F36 A;  5DW2 A;  5IGK A;  4QNS A;  4O7F A;  2E3K A;  4MEP A;  5D26 A;  3UVW A;  5CGP A;  4MR4 A;  5C89 A;  4NQN A;  3UV2 A;  5DLX A;  3I3J A;  4YYH A;  5A81 A;  4IR6 A;  4HBX A;  4TZ8 A;  4NR7 A;  5EM3 A;  4NUD A;  3P1E A;  5DYU A;  3U5J A;  3O34 A;  5E9K A;  5BT3 A;  5CUD A;  3LQJ A;  4PY6 A;  4WIV A;  4ZC9 A;  4O71 A;  4CLB A;  4A9J A;  4YBM A;  2YQD A;  4O7E A;  5HRX A;  2RNX A;  4BW4 A;  4NUE A;  3JVL A;  3SVF A;  5AD2 A;  4UIU A;  5E3G A;  4UIX A;  5CZG A;  4XY8 A;  5L8U A;  5CY9 A;  5L98 A;  2KTB B;  4N4I A;  2RI7 A;  4OGI A;  5HEM A;  5L97 A;  5J0D A;  3IU5 A;  4LZ2 A;  5FG5 A;  4LYS A;  5IG6 A;  5K29 A;  4UYF B;  4QEV A;  5F62 A;  4LR6 A;  2RNW A;  5DYA A;  3U5K A;  5FB0 A;  5FE5 A;  5E9V A;  4TTE A;  5E9M A;  5II2 A;  5ENB A;  4O7A A;  5DKD A;  5CUC A;  2OUO A;  4LZS A;  5FBX A;  3MXF A;  4IR5 A;  5E9Y A;  4QY4 A;  5D0C A;  4NR4 A;  5D3N A;  4A9N A;  2OO1 A;  5CP5 A;  4UIT A;  3QZS A;  5DBM A;  5I86 A;  4HXO A;  4QR3 A;  4NRA A;  4CUQ A;  4Z6H A;  4YYD A;  5IBN A;  5LKZ A;  5I40 A;  4O74 A;  4QYL A;  3S91 A;  3UVY A;  5EQ1 A;  2DVV A;  4N4H A;  3HME A;  5IGL A;  5IID A;  4C67 A;  4MR5 A;  4TU4 A;  4A9E A;  4CUT A;  4CUR A;  5D3J A;  5E9L A;  5C87 A;  5FE6 A;  5HQ5 A;  5C8G A;  5I89 A;  4QBM A;  4RVR A;  3Q2E A;  4C66 A;  4O7B A;  4QZS A;  4MR3 A;  5D3S A;  5F5Z A;  4A9M A;  5FH8 A;  5IGM A;  4O75 A;  4A9F A;  3MUK A;  2NXB A;  3Q2F A;  4QSW A;  5CRM A;  5I83 A;  5D7X A;  2DKW A;  4NR6 A;  5KTU A;  4YAB A;  5ETB A;  4KCX A;  4NYX A;  4CUS A;  3O33 A;  5FE9 A;  5CS8 A;  2DAT A;  3HMH A;  5KTX A;  2H60 A;  3SVG A;  4QST A;  5HQ7 A;  3UVD A;  5FFW A;  2R10 A;  4TQN A;  5FDZ A;  5EP7 A;  5I7Y A;  5AME A;  4PS5 A;  5ENF A;  5F2P A;  5LKX A;  4PKL A;  4YYG A;  4PCI A;  4J0S A;  4QEW A;  4HXM A;  5DKH A;  4QC1 A;  4YH3 A;  5KTW A;  5ENJ A;  4LYI A;  4J0R A;  3ONI A;  4UYE A;  4QUT A;  4ALH A;  1E6I A;  5HJC A;  3MUL A;  3FKM X;  5EWD A;  4Q0O A;  5C4Q A;  4TT6 A;  2F6J A;  5LUU A;  3MB4 A;  3P1D A;  3U5L A;  5ENH A;  4LC2 A;  5L99 A;  2N9G A;  5A5Q A;  4O70 A;  5A5O A;  4XUA A;  5A5P A;  3DAI A;  5H85 A;  5HFQ A;  3IU6 A;  5EPR A;  3LJW A;  4OGJ A;  5D25 A;  5G4R A;  4O77 A;  5HLS A;  4TS8 A;  3G0L A;  5F60 A;  2RS9 B;  5CUE A;  5I7X A;  5CQ3 A;  5HQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...