2OO1A

Crystal structure of the bromo domain 2 of human bromodomain containing protein 3 (brd3)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 3
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2oo1A00
5L8TA 5HQ6A 4O7FA 5EPBA 5F61A 2R0YA 4J1PA 4N4GA 4A9OA 4HBYA 2DWWA 5L98A 5F62A 5KO4A 4QNSA 5EGUA 4NR9A 3G0JA 5EWWA 4N4FA 5D3SA 5D3LA 5CQ5A 4QEWA 2I8NA 4QB3A 5CUBA 4YYJA 5CUGA 5EPRA 4NUEA 4NR8A 4TS8A 2GRCA 5FE0A 5CUEA 5FH6A 5E9IA 4HBVA 4WHWA 5L97A 5I1QA 4QSUA 5HELA 4CUUA 5E3GA 5ENCA 5FFWA 3ONIA 3U5JA 5E9MA 2OUOA 5ETBA 4NUDA 5HFQA 5HJCA 4O7CA 3Q2EA 4CFKA 4CFLA 2D82A 5FE7A 5H85A 3AQAA 4YYHA 3DWYA 4Z93A 5LUUA 5DLZA 5HLSA 4F3IA 5IIDA 1EQFA 4HXKA 4O7BA 4UYEA 5CY9A 1JSPB 4NYXA 5CS8A 4BW3A 5ENEA 4QR4A 4TTEA 4ZQLA 5EPSA 5KU3A 4QY4A 4UYFB 4QBMA 4YAXA 5A7CA 4LYWA 5CQ7A 4IR6A 5AMFA 5LJ2A 4YYKA 5FFYA 2D9EA 3UVDA 5EI4A 5E9YA 5H1TA 5HCLA 5DW2A 4BHWA 5DKCA 5I7XA 5ETDA 3MXFA 4RVRA 5I88A 4QC3A 5TB6A 5FE2A 3G0LA 5A5NA 5IGLA 2KTBB 4YY4A 5BT5A 4LYSA 2L84A 2YEKA 2YEMA 2E3KA 4O74A 3UVXA 5I83A 3MB3A 4Q0OA 5DX4A 4MEPA 5D3TA 4AKNA 1N72A 5CUCA 4A9NA 5E3DA 4A9HA 3MB4A 3HMHA 3UV2A 4ZW1A 5ACYA 2H60A 5CP5A 5HM0A 4HXNA 5EWDA 1ZS5A 2MJVB 5CPEA 4J3IA 4OGIA 4O78A 4QSSA 2I7KA 3JVMA 4QUTA 5D26A 3O35A 4QSXA 5II2A 3QZVA 3HMEA 4YBMA 4LR6A 5DLXA 4WIVA 5FBXA 5C4QA 2OO1A 5L99A 3LXJA 4UIWA 5CFWA 2RS9B 4HXOA 4NRCA 3U5PA 4ALHA 5A83A 5KTWA 5F25A 4QSWA 2E7NA 4IOOA 5E0RA 1WUGA 2WP2A 4O77A 4CURA 4NXJA 4YH4A 4YYMA 4Z1SA 5HFRA 5LVQA 4PS5A 4UYDA 4HXSA 5E9VA 2DATA 5IGKA 5FE4A 4LDFA 2FSAA 4NQNA 4CLBA 5I7YA 4QUUA 4GPJA 4CL9A 5C89A 4IORA 4LRGA 5IGMA 5FE1A 5DYCA 4CUTA 5D3JA 4O70A 4FLPA 4YC9A 5E7DA 5ENIA 5COIA 5D24A 4QC1A 1F68A 4MR5A 4KCXA 4XY9A 5C85A 5LVRA 2RO1A 4C66A 4UIYA 5A85A 5FG4A 4N4IA 3QZSA 4YY6A 4A9IA 5ENJA 5FE9A 4O72A 5CGPA 5D7XA 4Z1QA 3JVKA 4QSQA 5A5OA 5E73A 5FH7A 4YYDA 4Z6IA 3AADA 5D0CA 4Y03A 3P1CA 2YYNA 3TLPA 4O7EA 5CQTA 4CUQA 3DAIA 5KHMA 3O37A 2R0SA 5CU8A 3UV5A 5DW1A 5F1HA 5EISA 3U5NA 4IR5A 5DFBA 3NXBA 3S92A 4E96A 4HXPA 1WUMA 5EM3A 4A9JA 5CQAA 4TZ8A 2RNYA 5ENHA 5FH8A 3HMFA 4PY6A 5IBNA 3Q2FA 2RNXA 4NRBA 4Z6HA 5G4SA 3UW9A 5C8GA 5LJ0A 4MENA 5CQ4A 4YABA 4XY8A 3FKMX 4OUFA 4A9LA 3LQJA 4ZC9A 5D3NA 2WP1A 3U5OA 5BT3A 5EK9A 5KTXA 4UIXA 4UYFA 5EU1A 5H1VA 4BW1A 5CUAA 5BT4A 4LZRA 4O7AA 5F2PA 4A9FA 3IU6A 5LKUA 4YADA 5FE8A 3QZTA 5EQ1A 2DVQA 5LKTA 5ENBA 5FB1A 5I86A 4BW4A 4NR5A 2RNWA 2DVSA 5AD2A 5G4RA 3LJWA 4PCIA 5FG5A 5C7NA 4NR6A 4A9MA 5FB0A 5L96A 4UIZA 4UITA 5FE6A 4QEVA 2YQDA 5J0DA 3UVWA 4PCEA 2L85A 3O36A 5DYUA 5F63A 4QSVA 4QSRA 4UYGA 5F5ZA 2NXBA 4NYWA 5EICA 4NR4A 5JI8A 3GG3A 4QEUA 4TT2A 4TT4A 2YELA 4BJXA 5CTLA 5EP7A 4YYNA 4HBWA 4LC2A 5FFVA 5JWMA 3P1EA 5FDZA 5A5PA 3O34A 5I29A 4QYLA 4KV4A 4MEOA 3UVYA 4CUPA 3U5LA 4NRAA 4TU6A 4WHUA 3U5KA 4UYHA 5E74A 3P1FA 5FE3A 4YBSA 4O75A 4A9KA 3P5OA 5A81A 5L8UA 5CUDA 4BW2A 5HRWA 4UIUA 4DONA 3LQHA 5DYXA 5CQ6A 4LZSA 4MR4A 4LZ2A 3I3JA 4HBXA 4TQNA 5DFDA 4TT6A 5A82A 3MULA 5ENGA 4MEQA 2L5EA 4CUSA 4YYGA 5K29A 3K2JA 4UIVA 5F36A 4QSTA 4HXLA 4YK0A 2R0VA 4O71A 5HENA 2DKWA 5DY7A 3O33A 5TCMA 3UV4A 4YATA 4QZSA 4ALGA 4QYDA 5H1UA 3JVJA 4TZ2A 5CQ3A 4N4HA 2G4AA 5F3AA 4A9EA 3SVHA 4YH3A 4IR4A 1X0JA 2DVVA 5A5QA 5EA1A 4QR3A 4HXMA 5DYAA 4N3WA 2OSSA 5A5SA 5EWHA 4QSPA 5LJ1A 4NYVA 4YBTA 5LKZA 4IOQA 4TYLA 4X2IA 3U5MA 4MR6A 4KV1A 4MR3A 5ENFA 5KTUA 1E6IA 5D25A 4YYIA 5EWCA 5D3PA 3SVFA 5HRVA 2LSPB 3JVLA 5FG6A 5HRXA 5E9LA 4XUBA 5CRMA 5EVAA 5F1LA 5IGNA 5CRZA 5E9KA 2N9GA 5A5RA 2RI7A 4PKLA 5DKDA 4J0SA 4NUCA 5I89A 4IR3A 3S91A 5HEMA 5D3RA 4NQMA 4OGJA 3SVGA 4NS5A 2F6JA 2R10A 2DVRA 5IG6A 2RFJA 5F60A 4LYIA 2YDWA 5II1A 1JM4B 3MQMA 5CQ8A 3ZYUA 2E7OA 5AMEA 3IU5A 4Q0NA 5LKXA 5EWVA 4C67A 3P1DA 4XUAA 5I80A 2F6NA 3RCWA 5DKHA 5EV9A 5AD3A 2YW5A 4TU4A 3MUKA 4HXRA 4QR5A 5DFCA 3LQIA 5DBMA 4PTBA 4O76A 5HQ5A 4J0RA 4XYAA 3D7CA 5D3HA 5HQ7A 5I40A 5CZGA 5FE5A 5C87A 4NR7A
chains in the Genus database with same CATH superfamily
5L8TA 5HQ6A 4O7FA 5EPBA 5F61A 2R0YA 4J1PA 4N4GA 4A9OA 4HBYA 2DWWA 5L98A 5F62A 5KO4A 4QNSA 5EGUA 4NR9A 3G0JA 5EWWA 4N4FA 5D3SA 5D3LA 5CQ5A 4QEWA 2I8NA 4QB3A 5CUBA 4YYJA 5CUGA 5EPRA 4NUEA 4NR8A 4TS8A 2GRCA 5FE0A 5CUEA 5FH6A 5E9IA 4HBVA 4WHWA 5L97A 5I1QA 4QSUA 5HELA 4CUUA 5E3GA 5ENCA 5FFWA 3ONIA 3U5JA 5E9MA 2OUOA 5ETBA 4NUDA 5HFQA 5HJCA 4O7CA 3Q2EA 4CFKA 4CFLA 2D82A 5FE7A 5H85A 3AQAA 4YYHA 3DWYA 4Z93A 5LUUA 5DLZA 5HLSA 4F3IA 5IIDA 1EQFA 4HXKA 4O7BA 4UYEA 5CY9A 1JSPB 4NYXA 5CS8A 4BW3A 5ENEA 4QR4A 3ERRA 4AKHA 4TTEA 4ZQLA 5EPSA 5KU3A 4QY4A 4UYFB 4QBMA 4YAXA 5A7CA 4LYWA 5CQ7A 4IR6A 5AMFA 5LJ2A 4YYKA 5FFYA 2D9EA 3UVDA 5EI4A 5E9YA 5H1TA 5HCLA 5DW2A 4BHWA 5DKCA 5I7XA 3VKGA 5ETDA 3MXFA 4RVRA 5I88A 4QC3A 5TB6A 5FE2A 3G0LA 5A5NA 5IGLA 2KTBB 4YY4A 5BT5A 4LYSA 2L84A 2YEKA 2YEMA 2E3KA 4O74A 3UVXA 5I83A 3MB3A 4Q0OA 5DX4A 4MEPA 5D3TA 4AKNA 1N72A 5CUCA 4A9NA 5E3DA 4A9HA 3MB4A 3HMHA 3UV2A 4ZW1A 5ACYA 2H60A 5CP5A 5HM0A 4HXNA 5EWDA 1ZS5A 2MJVB 5CPEA 4J3IA 4OGIA 4O78A 4QSSA 2I7KA 3JVMA 4QUTA 5D26A 3O35A 4QSXA 5II2A 3QZVA 3HMEA 4YBMA 4LR6A 5DLXA 4WIVA 5FBXA 5C4QA 2OO1A 5L99A 3LXJA 4UIWA 5CFWA 2RS9B 4HXOA 4NRCA 3U5PA 4ALHA 5A83A 5KTWA 5F25A 3D1DA 4QSWA 2E7NA 4IOOA 5E0RA 1WUGA 2WP2A 4O77A 4CURA 4NXJA 4YH4A 4YYMA 4Z1SA 5HFRA 5LVQA 4PS5A 4UYDA 4HXSA 5E9VA 2DATA 5IGKA 5FE4A 4LDFA 2FSAA 4NQNA 4CLBA 5I7YA 4QUUA 4GPJA 4CL9A 5C89A 4IORA 4LRGA 5IGMA 5FE1A 5DYCA 4CUTA 5D3JA 4O70A 4FLPA 4YC9A 5E7DA 5ENIA 5COIA 5D24A 4QC1A 1F68A 4MR5A 4KCXA 4XY9A 5C85A 5LVRA 2RO1A 4C66A 4UIYA 5A85A 5FG4A 4N4IA 3QZSA 4YY6A 4A9IA 5ENJA 5FE9A 4O72A 5CGPA 5D7XA 4Z1QA 3JVKA 4QSQA 5A5OA 5E73A 5FH7A 4YYDA 4Z6IA 3AADA 5D0CA 4Y03A 3P1CA 2YYNA 3TLPA 4O7EA 5CQTA 4CUQA 3DAIA 5KHMA 3O37A 2R0SA 5CU8A 3UV5A 5DW1A 5F1HA 5EISA 3U5NA 4IR5A 5DFBA 3NXBA 3S92A 4E96A 4HXPA 1WUMA 5EM3A 4A9JA 5CQAA 4TZ8A 2RNYA 5ENHA 5FH8A 3HMFA 3D1BA 4PY6A 5IBNA 3Q2FA 2RNXA 4NRBA 4Z6HA 5G4SA 4AKIA 3UW9A 5C8GA 5LJ0A 4MENA 5CQ4A 4YABA 4XY8A 3FKMX 4OUFA 4A9LA 3LQJA 4ZC9A 5D3NA 2WP1A 3U5OA 5BT3A 5EK9A 5KTXA 4UIXA 4UYFA 5EU1A 5H1VA 4BW1A 5CUAA 5BT4A 4LZRA 4O7AA 5F2PA 4A9FA 3IU6A 5LKUA 4YADA 5FE8A 3QZTA 5EQ1A 2DVQA 5LKTA 5ENBA 5FB1A 5I86A 4BW4A 4NR5A 2RNWA 2DVSA 5AD2A 5G4RA 3LJWA 4PCIA 5FG5A 5C7NA 4NR6A 4A9MA 5FB0A 5L96A 4UIZA 4AKGA 4UITA 5FE6A 4QEVA 2YQDA 5J0DA 3UVWA 4PCEA 2L85A 3O36A 5DYUA 5F63A 4QSVA 4QSRA 4UYGA 5F5ZA 2NXBA 4NYWA 5EICA 4NR4A 5JI8A 3GG3A 4QEUA 4TT2A 4TT4A 2YELA 4BJXA 5CTLA 5EP7A 4YYNA 4HBWA 4LC2A 5FFVA 5JWMA 3P1EA 5FDZA 5A5PA 3O34A 5I29A 4QYLA 4KV4A 4MEOA 3UVYA 4CUPA 3U5LA 4NRAA 4TU6A 4WHUA 3U5KA 4UYHA 5E74A 3P1FA 5FE3A 4YBSA 4O75A 4A9KA 3P5OA 5A81A 5L8UA 5CUDA 4BW2A 5HRWA 4UIUA 4DONA 3LQHA 5DYXA 5CQ6A 4AI6A 4LZSA 4MR4A 4LZ2A 3I3JA 4HBXA 4TQNA 5DFDA 4TT6A 5A82A 3MULA 5ENGA 4MEQA 2L5EA 4CUSA 4YYGA 5K29A 3K2JA 4UIVA 5F36A 4QSTA 4HXLA 4YK0A 2R0VA 4O71A 5HENA 2DKWA 5DY7A 3O33A 5TCMA 3UV4A 4YATA 4QZSA 4ALGA 4QYDA 5H1UA 3JVJA 4TZ2A 3VKHA 5CQ3A 4N4HA 2G4AA 5F3AA 4A9EA 3SVHA 4YH3A 4IR4A 1X0JA 2DVVA 5A5QA 5EA1A 4QR3A 4HXMA 5DYAA 4N3WA 2OSSA 5A5SA 5EWHA 4QSPA 5LJ1A 4NYVA 4YBTA 5LKZA 4IOQA 4TYLA 4X2IA 3U5MA 4MR6A 4KV1A 2EJNA 4MR3A 5ENFA 5KTUA 1E6IA 5D25A 4YYIA 5EWCA 5D3PA 3SVFA 5HRVA 2LSPB 3JVLA 5FG6A 5HRXA 5E9LA 4XUBA 5CRMA 5EVAA 5F1LA 5IGNA 5CRZA 5E9KA 2N9GA 5A5RA 2RI7A 4PKLA 5DKDA 4J0SA 4NUCA 5I89A 4IR3A 3S91A 5HEMA 5D3RA 4NQMA 4OGJA 3SVGA 4NS5A 1PUOA 2F6JA 2R10A 2DVRA 5IG6A 2RFJA 5F60A 1ZKRA 4LYIA 2YDWA 5II1A 1JM4B 3MQMA 5CQ8A 3ZYUA 2E7OA 5AMEA 3IU5A 4Q0NA 5LKXA 5EWVA 4C67A 3P1DA 4XUAA 5I80A 2F6NA 3RCWA 5DKHA 5EV9A 5AD3A 2YW5A 4TU4A 3MUKA 4HXRA 4QR5A 5DFCA 3LQIA 5DBMA 4PTBA 4O76A 5HQ5A 4J0RA 4XYAA 3D7CA 5D3HA 5HQ7A 5I40A 5CZGA 5FE5A 5C87A 4NR7A
chains in the Genus database with same CATH topology
5L8TA 5HQ6A 4O7FA 5EPBA 5F61A 2R0YA 4J1PA 4N4GA 4A9OA 4HBYA 2DWWA 5L98A 5F62A 5KO4A 4QNSA 5EGUA 4NR9A 3G0JA 5EWWA 4N4FA 5D3SA 5D3LA 5CQ5A 4QEWA 2I8NA 4QB3A 5CUBA 4YYJA 5CUGA 5EPRA 4NUEA 4NR8A 4TS8A 2GRCA 5FE0A 5CUEA 5FH6A 5E9IA 4HBVA 4WHWA 5L97A 5I1QA 4QSUA 5HELA 4CUUA 5E3GA 5ENCA 5FFWA 3ONIA 3U5JA 5E9MA 2OUOA 5ETBA 4NUDA 5HFQA 5HJCA 4O7CA 3Q2EA 4CFKA 4CFLA 2D82A 5FE7A 5H85A 3AQAA 4YYHA 3DWYA 4Z93A 5LUUA 5DLZA 5HLSA 4F3IA 5IIDA 1EQFA 4HXKA 4O7BA 4UYEA 5CY9A 1JSPB 4NYXA 5CS8A 4BW3A 5ENEA 4QR4A 4TTEA 4ZQLA 5EPSA 5KU3A 4QY4A 4UYFB 4QBMA 4YAXA 5A7CA 4LYWA 5CQ7A 4IR6A 5AMFA 5LJ2A 4YYKA 5FFYA 2D9EA 3UVDA 5EI4A 5E9YA 5H1TA 5HCLA 5DW2A 4BHWA 5DKCA 5I7XA 5ETDA 3MXFA 4RVRA 5I88A 4QC3A 5TB6A 5FE2A 3G0LA 5A5NA 5IGLA 2KTBB 4YY4A 5BT5A 4LYSA 2L84A 2YEKA 2YEMA 2E3KA 4O74A 3UVXA 5I83A 3MB3A 4Q0OA 5DX4A 4MEPA 5D3TA 4AKNA 1N72A 5CUCA 4A9NA 5E3DA 4A9HA 3MB4A 3HMHA 3UV2A 4ZW1A 5ACYA 2H60A 5CP5A 5HM0A 4HXNA 5EWDA 1ZS5A 2MJVB 5CPEA 4J3IA 4OGIA 4O78A 4QSSA 2I7KA 3JVMA 4QUTA 5D26A 3O35A 4QSXA 5II2A 3QZVA 3HMEA 4YBMA 4LR6A 5DLXA 4WIVA 5FBXA 5C4QA 2OO1A 5L99A 3LXJA 4UIWA 5CFWA 2RS9B 4HXOA 4NRCA 3U5PA 4ALHA 5A83A 5KTWA 5F25A 4QSWA 2E7NA 4IOOA 5E0RA 1WUGA 2WP2A 4O77A 4CURA 4NXJA 4YH4A 4YYMA 4Z1SA 5HFRA 5LVQA 4PS5A 4UYDA 4HXSA 5E9VA 2DATA 5IGKA 5FE4A 4LDFA 2FSAA 4NQNA 4CLBA 5I7YA 4QUUA 4GPJA 4CL9A 5C89A 4IORA 4LRGA 5IGMA 5FE1A 5DYCA 4CUTA 5D3JA 4O70A 4FLPA 4YC9A 5E7DA 5ENIA 5COIA 5D24A 4QC1A 1F68A 4MR5A 4KCXA 4XY9A 5C85A 5LVRA 2RO1A 4C66A 4UIYA 5A85A 5FG4A 4N4IA 3QZSA 4YY6A 4A9IA 5ENJA 5FE9A 4O72A 5CGPA 5D7XA 4Z1QA 3JVKA 4QSQA 5A5OA 5E73A 5FH7A 4YYDA 4Z6IA 3AADA 5D0CA 4Y03A 3P1CA 2YYNA 3TLPA 4O7EA 5CQTA 4CUQA 3DAIA 5KHMA 3O37A 2R0SA 5CU8A 3UV5A 5DW1A 5F1HA 5EISA 3U5NA 4IR5A 5DFBA 3NXBA 3S92A 4E96A 4HXPA 1WUMA 5EM3A 4A9JA 5CQAA 4TZ8A 2RNYA 5ENHA 5FH8A 3HMFA 4PY6A 5IBNA 3Q2FA 2RNXA 4NRBA 4Z6HA 5G4SA 3UW9A 5C8GA 5LJ0A 4MENA 5CQ4A 4YABA 4XY8A 3FKMX 4OUFA 4A9LA 3LQJA 4ZC9A 5D3NA 2WP1A 3U5OA 5BT3A 5EK9A 5KTXA 4UIXA 4UYFA 5EU1A 5H1VA 4BW1A 5CUAA 5BT4A 4LZRA 4O7AA 5F2PA 4A9FA 3IU6A 5LKUA 4YADA 5FE8A 3QZTA 5EQ1A 2DVQA 5LKTA 5ENBA 5FB1A 5I86A 4BW4A 4NR5A 2RNWA 2DVSA 5AD2A 5G4RA 3LJWA 4PCIA 5FG5A 5C7NA 4NR6A 4A9MA 5FB0A 5L96A 4UIZA 4UITA 5FE6A 4QEVA 2YQDA 5J0DA 3UVWA 4PCEA 2L85A 3O36A 5DYUA 5F63A 4QSVA 4QSRA 4UYGA 5F5ZA 2NXBA 4NYWA 5EICA 4NR4A 5JI8A 3GG3A 4QEUA 4TT2A 4TT4A 2YELA 4BJXA 5CTLA 5EP7A 4YYNA 4HBWA 4LC2A 5FFVA 5JWMA 3P1EA 5FDZA 5A5PA 3O34A 5I29A 4QYLA 4KV4A 4MEOA 3UVYA 4CUPA 3U5LA 4NRAA 4TU6A 4WHUA 3U5KA 4UYHA 5E74A 3P1FA 5FE3A 4YBSA 4O75A 4A9KA 3P5OA 5A81A 5L8UA 5CUDA 4BW2A 5HRWA 4UIUA 4DONA 3LQHA 5DYXA 5CQ6A 4LZSA 4MR4A 4LZ2A 3I3JA 4HBXA 4TQNA 5DFDA 4TT6A 5A82A 3MULA 5ENGA 4MEQA 2L5EA 4CUSA 4YYGA 5K29A 3K2JA 4UIVA 5F36A 4QSTA 4HXLA 4YK0A 2R0VA 4O71A 5HENA 2DKWA 5DY7A 3O33A 5TCMA 3UV4A 4YATA 4QZSA 4ALGA 4QYDA 5H1UA 3JVJA 4TZ2A 5CQ3A 4N4HA 2G4AA 5F3AA 4A9EA 3SVHA 4YH3A 4IR4A 1X0JA 2DVVA 5A5QA 5EA1A 4QR3A 4HXMA 5DYAA 4N3WA 2OSSA 5A5SA 5EWHA 4QSPA 5LJ1A 4NYVA 4YBTA 5LKZA 4IOQA 4TYLA 4X2IA 3U5MA 4MR6A 4KV1A 4MR3A 5ENFA 5KTUA 1E6IA 5D25A 4YYIA 5EWCA 5D3PA 3SVFA 5HRVA 2LSPB 3JVLA 5FG6A 5HRXA 5E9LA 4XUBA 5CRMA 5EVAA 5F1LA 5IGNA 5CRZA 5E9KA 2N9GA 5A5RA 2RI7A 4PKLA 5DKDA 4J0SA 4NUCA 5I89A 4IR3A 3S91A 5HEMA 5D3RA 4NQMA 4OGJA 3SVGA 4NS5A 2F6JA 2R10A 2DVRA 5IG6A 2RFJA 5F60A 4LYIA 2YDWA 5II1A 1JM4B 3MQMA 5CQ8A 3ZYUA 2E7OA 5AMEA 3IU5A 4Q0NA 5LKXA 5EWVA 4C67A 3P1DA 4XUAA 5I80A 2F6NA 3RCWA 5DKHA 5EV9A 5AD3A 2YW5A 4TU4A 3MUKA 4HXRA 4QR5A 5DFCA 3LQIA 5DBMA 4PTBA 4O76A 5HQ5A 4J0RA 4XYAA 3D7CA 5D3HA 5HQ7A 5I40A 5CZGA 5FE5A 5C87A 4NR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8T A;  5HQ6 A;  4O7F A;  5EPB A;  5F61 A;  2R0Y A;  4J1P A;  4N4G A;  4A9O A;  4HBY A;  2DWW A;  5L98 A;  5F62 A;  5KO4 A;  4QNS A;  5EGU A;  4NR9 A;  3G0J A;  5EWW A;  4N4F A;  5D3S A;  5D3L A;  5CQ5 A;  4QEW A;  2I8N A;  4QB3 A;  5CUB A;  4YYJ A;  5CUG A;  5EPR A;  4NUE A;  4NR8 A;  4TS8 A;  2GRC A;  5FE0 A;  5CUE A;  5FH6 A;  5E9I A;  4HBV A;  4WHW A;  5L97 A;  5I1Q A;  4QSU A;  5HEL A;  4CUU A;  5E3G A;  5ENC A;  5FFW A;  3ONI A;  3U5J A;  5E9M A;  2OUO A;  5ETB A;  4NUD A;  5HFQ A;  5HJC A;  4O7C A;  3Q2E A;  4CFK A;  4CFL A;  2D82 A;  5FE7 A;  5H85 A;  3AQA A;  4YYH A;  3DWY A;  4Z93 A;  5LUU A;  5DLZ A;  5HLS A;  4F3I A;  5IID A;  1EQF A;  4HXK A;  4O7B A;  4UYE A;  5CY9 A;  1JSP B;  4NYX A;  5CS8 A;  4BW3 A;  5ENE A;  4QR4 A;  4TTE A;  4ZQL A;  5EPS A;  5KU3 A;  4QY4 A;  4UYF B;  4QBM A;  4YAX A;  5A7C A;  4LYW A;  5CQ7 A;  4IR6 A;  5AMF A;  5LJ2 A;  4YYK A;  5FFY A;  2D9E A;  3UVD A;  5EI4 A;  5E9Y A;  5H1T A;  5HCL A;  5DW2 A;  4BHW A;  5DKC A;  5I7X A;  5ETD A;  3MXF A;  4RVR A;  5I88 A;  4QC3 A;  5TB6 A;  5FE2 A;  3G0L A;  5A5N A;  5IGL A;  2KTB B;  4YY4 A;  5BT5 A;  4LYS A;  2L84 A;  2YEK A;  2YEM A;  2E3K A;  4O74 A;  3UVX A;  5I83 A;  3MB3 A;  4Q0O A;  5DX4 A;  4MEP A;  5D3T A;  4AKN A;  1N72 A;  5CUC A;  4A9N A;  5E3D A;  4A9H A;  3MB4 A;  3HMH A;  3UV2 A;  4ZW1 A;  5ACY A;  2H60 A;  5CP5 A;  5HM0 A;  4HXN A;  5EWD A;  1ZS5 A;  2MJV B;  5CPE A;  4J3I A;  4OGI A;  4O78 A;  4QSS A;  2I7K A;  3JVM A;  4QUT A;  5D26 A;  3O35 A;  4QSX A;  5II2 A;  3QZV A;  3HME A;  4YBM A;  4LR6 A;  5DLX A;  4WIV A;  5FBX A;  5C4Q A;  2OO1 A;  5L99 A;  3LXJ A;  4UIW A;  5CFW A;  2RS9 B;  4HXO A;  4NRC A;  3U5P A;  4ALH A;  5A83 A;  5KTW A;  5F25 A;  4QSW A;  2E7N A;  4IOO A;  5E0R A;  1WUG A;  2WP2 A;  4O77 A;  4CUR A;  4NXJ A;  4YH4 A;  4YYM A;  4Z1S A;  5HFR A;  5LVQ A;  4PS5 A;  4UYD A;  4HXS A;  5E9V A;  2DAT A;  5IGK A;  5FE4 A;  4LDF A;  2FSA A;  4NQN A;  4CLB A;  5I7Y A;  4QUU A;  4GPJ A;  4CL9 A;  5C89 A;  4IOR A;  4LRG A;  5IGM A;  5FE1 A;  5DYC A;  4CUT A;  5D3J A;  4O70 A;  4FLP A;  4YC9 A;  5E7D A;  5ENI A;  5COI A;  5D24 A;  4QC1 A;  1F68 A;  4MR5 A;  4KCX A;  4XY9 A;  5C85 A;  5LVR A;  2RO1 A;  4C66 A;  4UIY A;  5A85 A;  5FG4 A;  4N4I A;  3QZS A;  4YY6 A;  4A9I A;  5ENJ A;  5FE9 A;  4O72 A;  5CGP A;  5D7X A;  4Z1Q A;  3JVK A;  4QSQ A;  5A5O A;  5E73 A;  5FH7 A;  4YYD A;  4Z6I A;  3AAD A;  5D0C A;  4Y03 A;  3P1C A;  2YYN A;  3TLP A;  4O7E A;  5CQT A;  4CUQ A;  3DAI A;  5KHM A;  3O37 A;  2R0S A;  5CU8 A;  3UV5 A;  5DW1 A;  5F1H A;  5EIS A;  3U5N A;  4IR5 A;  5DFB A;  3NXB A;  3S92 A;  4E96 A;  4HXP A;  1WUM A;  5EM3 A;  4A9J A;  5CQA A;  4TZ8 A;  2RNY A;  5ENH A;  5FH8 A;  3HMF A;  4PY6 A;  5IBN A;  3Q2F A;  2RNX A;  4NRB A;  4Z6H A;  5G4S A;  3UW9 A;  5C8G A;  5LJ0 A;  4MEN A;  5CQ4 A;  4YAB A;  4XY8 A;  3FKM X;  4OUF A;  4A9L A;  3LQJ A;  4ZC9 A;  5D3N A;  2WP1 A;  3U5O A;  5BT3 A;  5EK9 A;  5KTX A;  4UIX A;  4UYF A;  5EU1 A;  5H1V A;  4BW1 A;  5CUA A;  5BT4 A;  4LZR A;  4O7A A;  5F2P A;  4A9F A;  3IU6 A;  5LKU A;  4YAD A;  5FE8 A;  3QZT A;  5EQ1 A;  2DVQ A;  5LKT A;  5ENB A;  5FB1 A;  5I86 A;  4BW4 A;  4NR5 A;  2RNW A;  2DVS A;  5AD2 A;  5G4R A;  3LJW A;  4PCI A;  5FG5 A;  5C7N A;  4NR6 A;  4A9M A;  5FB0 A;  5L96 A;  4UIZ A;  4UIT A;  5FE6 A;  4QEV A;  2YQD A;  5J0D A;  3UVW A;  4PCE A;  2L85 A;  3O36 A;  5DYU A;  5F63 A;  4QSV A;  4QSR A;  4UYG A;  5F5Z A;  2NXB A;  4NYW A;  5EIC A;  4NR4 A;  5JI8 A;  3GG3 A;  4QEU A;  4TT2 A;  4TT4 A;  2YEL A;  4BJX A;  5CTL A;  5EP7 A;  4YYN A;  4HBW A;  4LC2 A;  5FFV A;  5JWM A;  3P1E A;  5FDZ A;  5A5P A;  3O34 A;  5I29 A;  4QYL A;  4KV4 A;  4MEO A;  3UVY A;  4CUP A;  3U5L A;  4NRA A;  4TU6 A;  4WHU A;  3U5K A;  4UYH A;  5E74 A;  3P1F A;  5FE3 A;  4YBS A;  4O75 A;  4A9K A;  3P5O A;  5A81 A;  5L8U A;  5CUD A;  4BW2 A;  5HRW A;  4UIU A;  4DON A;  3LQH A;  5DYX A;  5CQ6 A;  4LZS A;  4MR4 A;  4LZ2 A;  3I3J A;  4HBX A;  4TQN A;  5DFD A;  4TT6 A;  5A82 A;  3MUL A;  5ENG A;  4MEQ A;  2L5E A;  4CUS A;  4YYG A;  5K29 A;  3K2J A;  4UIV A;  5F36 A;  4QST A;  4HXL A;  4YK0 A;  2R0V A;  4O71 A;  5HEN A;  2DKW A;  5DY7 A;  3O33 A;  5TCM A;  3UV4 A;  4YAT A;  4QZS A;  4ALG A;  4QYD A;  5H1U A;  3JVJ A;  4TZ2 A;  5CQ3 A;  4N4H A;  2G4A A;  5F3A A;  4A9E A;  3SVH A;  4YH3 A;  4IR4 A;  1X0J A;  2DVV A;  5A5Q A;  5EA1 A;  4QR3 A;  4HXM A;  5DYA A;  4N3W A;  2OSS A;  5A5S A;  5EWH A;  4QSP A;  5LJ1 A;  4NYV A;  4YBT A;  5LKZ A;  4IOQ A;  4TYL A;  4X2I A;  3U5M A;  4MR6 A;  4KV1 A;  4MR3 A;  5ENF A;  5KTU A;  1E6I A;  5D25 A;  4YYI A;  5EWC A;  5D3P A;  3SVF A;  5HRV A;  2LSP B;  3JVL A;  5FG6 A;  5HRX A;  5E9L A;  4XUB A;  5CRM A;  5EVA A;  5F1L A;  5IGN A;  5CRZ A;  5E9K A;  2N9G A;  5A5R A;  2RI7 A;  4PKL A;  5DKD A;  4J0S A;  4NUC A;  5I89 A;  4IR3 A;  3S91 A;  5HEM A;  5D3R A;  4NQM A;  4OGJ A;  3SVG A;  4NS5 A;  2F6J A;  2R10 A;  2DVR A;  5IG6 A;  2RFJ A;  5F60 A;  4LYI A;  2YDW A;  5II1 A;  1JM4 B;  3MQM A;  5CQ8 A;  3ZYU A;  2E7O A;  5AME A;  3IU5 A;  4Q0N A;  5LKX A;  5EWV A;  4C67 A;  3P1D A;  4XUA A;  5I80 A;  2F6N A;  3RCW A;  5DKH A;  5EV9 A;  5AD3 A;  2YW5 A;  4TU4 A;  3MUK A;  4HXR A;  4QR5 A;  5DFC A;  3LQI A;  5DBM A;  4PTB A;  4O76 A;  5HQ5 A;  4J0R A;  4XYA A;  3D7C A;  5D3H A;  5HQ7 A;  5I40 A;  5CZG A;  5FE5 A;  5C87 A;  4NR7 A; 
#chains in the Genus database with same CATH topology
 5L8T A;  5HQ6 A;  4O7F A;  5EPB A;  5F61 A;  2R0Y A;  4J1P A;  4N4G A;  4A9O A;  4HBY A;  2DWW A;  5L98 A;  5F62 A;  5KO4 A;  4QNS A;  5EGU A;  4NR9 A;  3G0J A;  5EWW A;  4N4F A;  5D3S A;  5D3L A;  5CQ5 A;  4QEW A;  2I8N A;  4QB3 A;  5CUB A;  4YYJ A;  5CUG A;  5EPR A;  4NUE A;  4NR8 A;  4TS8 A;  2GRC A;  5FE0 A;  5CUE A;  5FH6 A;  5E9I A;  4HBV A;  4WHW A;  5L97 A;  5I1Q A;  4QSU A;  5HEL A;  4CUU A;  5E3G A;  5ENC A;  5FFW A;  3ONI A;  3U5J A;  5E9M A;  2OUO A;  5ETB A;  4NUD A;  5HFQ A;  5HJC A;  4O7C A;  3Q2E A;  4CFK A;  4CFL A;  2D82 A;  5FE7 A;  5H85 A;  3AQA A;  4YYH A;  3DWY A;  4Z93 A;  5LUU A;  5DLZ A;  5HLS A;  4F3I A;  5IID A;  1EQF A;  4HXK A;  4O7B A;  4UYE A;  5CY9 A;  1JSP B;  4NYX A;  5CS8 A;  4BW3 A;  5ENE A;  4QR4 A;  3ERR A;  4AKH A;  4TTE A;  4ZQL A;  5EPS A;  5KU3 A;  4QY4 A;  4UYF B;  4QBM A;  4YAX A;  5A7C A;  4LYW A;  5CQ7 A;  4IR6 A;  5AMF A;  5LJ2 A;  4YYK A;  5FFY A;  2D9E A;  3UVD A;  5EI4 A;  5E9Y A;  5H1T A;  5HCL A;  5DW2 A;  4BHW A;  5DKC A;  5I7X A;  3VKG A;  5ETD A;  3MXF A;  4RVR A;  5I88 A;  4QC3 A;  5TB6 A;  5FE2 A;  3G0L A;  5A5N A;  5IGL A;  2KTB B;  4YY4 A;  5BT5 A;  4LYS A;  2L84 A;  2YEK A;  2YEM A;  2E3K A;  4O74 A;  3UVX A;  5I83 A;  3MB3 A;  4Q0O A;  5DX4 A;  4MEP A;  5D3T A;  4AKN A;  1N72 A;  5CUC A;  4A9N A;  5E3D A;  4A9H A;  3MB4 A;  3HMH A;  3UV2 A;  4ZW1 A;  5ACY A;  2H60 A;  5CP5 A;  5HM0 A;  4HXN A;  5EWD A;  1ZS5 A;  2MJV B;  5CPE A;  4J3I A;  4OGI A;  4O78 A;  4QSS A;  2I7K A;  3JVM A;  4QUT A;  5D26 A;  3O35 A;  4QSX A;  5II2 A;  3QZV A;  3HME A;  4YBM A;  4LR6 A;  5DLX A;  4WIV A;  5FBX A;  5C4Q A;  2OO1 A;  5L99 A;  3LXJ A;  4UIW A;  5CFW A;  2RS9 B;  4HXO A;  4NRC A;  3U5P A;  4ALH A;  5A83 A;  5KTW A;  5F25 A;  3D1D A;  4QSW A;  2E7N A;  4IOO A;  5E0R A;  1WUG A;  2WP2 A;  4O77 A;  4CUR A;  4NXJ A;  4YH4 A;  4YYM A;  4Z1S A;  5HFR A;  5LVQ A;  4PS5 A;  4UYD A;  4HXS A;  5E9V A;  2DAT A;  5IGK A;  5FE4 A;  4LDF A;  2FSA A;  4NQN A;  4CLB A;  5I7Y A;  4QUU A;  4GPJ A;  4CL9 A;  5C89 A;  4IOR A;  4LRG A;  5IGM A;  5FE1 A;  5DYC A;  4CUT A;  5D3J A;  4O70 A;  4FLP A;  4YC9 A;  5E7D A;  5ENI A;  5COI A;  5D24 A;  4QC1 A;  1F68 A;  4MR5 A;  4KCX A;  4XY9 A;  5C85 A;  5LVR A;  2RO1 A;  4C66 A;  4UIY A;  5A85 A;  5FG4 A;  4N4I A;  3QZS A;  4YY6 A;  4A9I A;  5ENJ A;  5FE9 A;  4O72 A;  5CGP A;  5D7X A;  4Z1Q A;  3JVK A;  4QSQ A;  5A5O A;  5E73 A;  5FH7 A;  4YYD A;  4Z6I A;  3AAD A;  5D0C A;  4Y03 A;  3P1C A;  2YYN A;  3TLP A;  4O7E A;  5CQT A;  4CUQ A;  3DAI A;  5KHM A;  3O37 A;  2R0S A;  5CU8 A;  3UV5 A;  5DW1 A;  5F1H A;  5EIS A;  3U5N A;  4IR5 A;  5DFB A;  3NXB A;  3S92 A;  4E96 A;  4HXP A;  1WUM A;  5EM3 A;  4A9J A;  5CQA A;  4TZ8 A;  2RNY A;  5ENH A;  5FH8 A;  3HMF A;  3D1B A;  4PY6 A;  5IBN A;  3Q2F A;  2RNX A;  4NRB A;  4Z6H A;  5G4S A;  4AKI A;  3UW9 A;  5C8G A;  5LJ0 A;  4MEN A;  5CQ4 A;  4YAB A;  4XY8 A;  3FKM X;  4OUF A;  4A9L A;  3LQJ A;  4ZC9 A;  5D3N A;  2WP1 A;  3U5O A;  5BT3 A;  5EK9 A;  5KTX A;  4UIX A;  4UYF A;  5EU1 A;  5H1V A;  4BW1 A;  5CUA A;  5BT4 A;  4LZR A;  4O7A A;  5F2P A;  4A9F A;  3IU6 A;  5LKU A;  4YAD A;  5FE8 A;  3QZT A;  5EQ1 A;  2DVQ A;  5LKT A;  5ENB A;  5FB1 A;  5I86 A;  4BW4 A;  4NR5 A;  2RNW A;  2DVS A;  5AD2 A;  5G4R A;  3LJW A;  4PCI A;  5FG5 A;  5C7N A;  4NR6 A;  4A9M A;  5FB0 A;  5L96 A;  4UIZ A;  4AKG A;  4UIT A;  5FE6 A;  4QEV A;  2YQD A;  5J0D A;  3UVW A;  4PCE A;  2L85 A;  3O36 A;  5DYU A;  5F63 A;  4QSV A;  4QSR A;  4UYG A;  5F5Z A;  2NXB A;  4NYW A;  5EIC A;  4NR4 A;  5JI8 A;  3GG3 A;  4QEU A;  4TT2 A;  4TT4 A;  2YEL A;  4BJX A;  5CTL A;  5EP7 A;  4YYN A;  4HBW A;  4LC2 A;  5FFV A;  5JWM A;  3P1E A;  5FDZ A;  5A5P A;  3O34 A;  5I29 A;  4QYL A;  4KV4 A;  4MEO A;  3UVY A;  4CUP A;  3U5L A;  4NRA A;  4TU6 A;  4WHU A;  3U5K A;  4UYH A;  5E74 A;  3P1F A;  5FE3 A;  4YBS A;  4O75 A;  4A9K A;  3P5O A;  5A81 A;  5L8U A;  5CUD A;  4BW2 A;  5HRW A;  4UIU A;  4DON A;  3LQH A;  5DYX A;  5CQ6 A;  4AI6 A;  4LZS A;  4MR4 A;  4LZ2 A;  3I3J A;  4HBX A;  4TQN A;  5DFD A;  4TT6 A;  5A82 A;  3MUL A;  5ENG A;  4MEQ A;  2L5E A;  4CUS A;  4YYG A;  5K29 A;  3K2J A;  4UIV A;  5F36 A;  4QST A;  4HXL A;  4YK0 A;  2R0V A;  4O71 A;  5HEN A;  2DKW A;  5DY7 A;  3O33 A;  5TCM A;  3UV4 A;  4YAT A;  4QZS A;  4ALG A;  4QYD A;  5H1U A;  3JVJ A;  4TZ2 A;  3VKH A;  5CQ3 A;  4N4H A;  2G4A A;  5F3A A;  4A9E A;  3SVH A;  4YH3 A;  4IR4 A;  1X0J A;  2DVV A;  5A5Q A;  5EA1 A;  4QR3 A;  4HXM A;  5DYA A;  4N3W A;  2OSS A;  5A5S A;  5EWH A;  4QSP A;  5LJ1 A;  4NYV A;  4YBT A;  5LKZ A;  4IOQ A;  4TYL A;  4X2I A;  3U5M A;  4MR6 A;  4KV1 A;  2EJN A;  4MR3 A;  5ENF A;  5KTU A;  1E6I A;  5D25 A;  4YYI A;  5EWC A;  5D3P A;  3SVF A;  5HRV A;  2LSP B;  3JVL A;  5FG6 A;  5HRX A;  5E9L A;  4XUB A;  5CRM A;  5EVA A;  5F1L A;  5IGN A;  5CRZ A;  5E9K A;  2N9G A;  5A5R A;  2RI7 A;  4PKL A;  5DKD A;  4J0S A;  4NUC A;  5I89 A;  4IR3 A;  3S91 A;  5HEM A;  5D3R A;  4NQM A;  4OGJ A;  3SVG A;  4NS5 A;  1PUO A;  2F6J A;  2R10 A;  2DVR A;  5IG6 A;  2RFJ A;  5F60 A;  1ZKR A;  4LYI A;  2YDW A;  5II1 A;  1JM4 B;  3MQM A;  5CQ8 A;  3ZYU A;  2E7O A;  5AME A;  3IU5 A;  4Q0N A;  5LKX A;  5EWV A;  4C67 A;  3P1D A;  4XUA A;  5I80 A;  2F6N A;  3RCW A;  5DKH A;  5EV9 A;  5AD3 A;  2YW5 A;  4TU4 A;  3MUK A;  4HXR A;  4QR5 A;  5DFC A;  3LQI A;  5DBM A;  4PTB A;  4O76 A;  5HQ5 A;  4J0R A;  4XYA A;  3D7C A;  5D3H A;  5HQ7 A;  5I40 A;  5CZG A;  5FE5 A;  5C87 A;  4NR7 A; 
#chains in the Genus database with same CATH homology
 5L8T A;  5HQ6 A;  4O7F A;  5EPB A;  5F61 A;  2R0Y A;  4J1P A;  4N4G A;  4A9O A;  4HBY A;  2DWW A;  5L98 A;  5F62 A;  5KO4 A;  4QNS A;  5EGU A;  4NR9 A;  3G0J A;  5EWW A;  4N4F A;  5D3S A;  5D3L A;  5CQ5 A;  4QEW A;  2I8N A;  4QB3 A;  5CUB A;  4YYJ A;  5CUG A;  5EPR A;  4NUE A;  4NR8 A;  4TS8 A;  2GRC A;  5FE0 A;  5CUE A;  5FH6 A;  5E9I A;  4HBV A;  4WHW A;  5L97 A;  5I1Q A;  4QSU A;  5HEL A;  4CUU A;  5E3G A;  5ENC A;  5FFW A;  3ONI A;  3U5J A;  5E9M A;  2OUO A;  5ETB A;  4NUD A;  5HFQ A;  5HJC A;  4O7C A;  3Q2E A;  4CFK A;  4CFL A;  2D82 A;  5FE7 A;  5H85 A;  3AQA A;  4YYH A;  3DWY A;  4Z93 A;  5LUU A;  5DLZ A;  5HLS A;  4F3I A;  5IID A;  1EQF A;  4HXK A;  4O7B A;  4UYE A;  5CY9 A;  1JSP B;  4NYX A;  5CS8 A;  4BW3 A;  5ENE A;  4QR4 A;  4TTE A;  4ZQL A;  5EPS A;  5KU3 A;  4QY4 A;  4UYF B;  4QBM A;  4YAX A;  5A7C A;  4LYW A;  5CQ7 A;  4IR6 A;  5AMF A;  5LJ2 A;  4YYK A;  5FFY A;  2D9E A;  3UVD A;  5EI4 A;  5E9Y A;  5H1T A;  5HCL A;  5DW2 A;  4BHW A;  5DKC A;  5I7X A;  5ETD A;  3MXF A;  4RVR A;  5I88 A;  4QC3 A;  5TB6 A;  5FE2 A;  3G0L A;  5A5N A;  5IGL A;  2KTB B;  4YY4 A;  5BT5 A;  4LYS A;  2L84 A;  2YEK A;  2YEM A;  2E3K A;  4O74 A;  3UVX A;  5I83 A;  3MB3 A;  4Q0O A;  5DX4 A;  4MEP A;  5D3T A;  4AKN A;  1N72 A;  5CUC A;  4A9N A;  5E3D A;  4A9H A;  3MB4 A;  3HMH A;  3UV2 A;  4ZW1 A;  5ACY A;  2H60 A;  5CP5 A;  5HM0 A;  4HXN A;  5EWD A;  1ZS5 A;  2MJV B;  5CPE A;  4J3I A;  4OGI A;  4O78 A;  4QSS A;  2I7K A;  3JVM A;  4QUT A;  5D26 A;  3O35 A;  4QSX A;  5II2 A;  3QZV A;  3HME A;  4YBM A;  4LR6 A;  5DLX A;  4WIV A;  5FBX A;  5C4Q A;  2OO1 A;  5L99 A;  3LXJ A;  4UIW A;  5CFW A;  2RS9 B;  4HXO A;  4NRC A;  3U5P A;  4ALH A;  5A83 A;  5KTW A;  5F25 A;  4QSW A;  2E7N A;  4IOO A;  5E0R A;  1WUG A;  2WP2 A;  4O77 A;  4CUR A;  4NXJ A;  4YH4 A;  4YYM A;  4Z1S A;  5HFR A;  5LVQ A;  4PS5 A;  4UYD A;  4HXS A;  5E9V A;  2DAT A;  5IGK A;  5FE4 A;  4LDF A;  2FSA A;  4NQN A;  4CLB A;  5I7Y A;  4QUU A;  4GPJ A;  4CL9 A;  5C89 A;  4IOR A;  4LRG A;  5IGM A;  5FE1 A;  5DYC A;  4CUT A;  5D3J A;  4O70 A;  4FLP A;  4YC9 A;  5E7D A;  5ENI A;  5COI A;  5D24 A;  4QC1 A;  1F68 A;  4MR5 A;  4KCX A;  4XY9 A;  5C85 A;  5LVR A;  2RO1 A;  4C66 A;  4UIY A;  5A85 A;  5FG4 A;  4N4I A;  3QZS A;  4YY6 A;  4A9I A;  5ENJ A;  5FE9 A;  4O72 A;  5CGP A;  5D7X A;  4Z1Q A;  3JVK A;  4QSQ A;  5A5O A;  5E73 A;  5FH7 A;  4YYD A;  4Z6I A;  3AAD A;  5D0C A;  4Y03 A;  3P1C A;  2YYN A;  3TLP A;  4O7E A;  5CQT A;  4CUQ A;  3DAI A;  5KHM A;  3O37 A;  2R0S A;  5CU8 A;  3UV5 A;  5DW1 A;  5F1H A;  5EIS A;  3U5N A;  4IR5 A;  5DFB A;  3NXB A;  3S92 A;  4E96 A;  4HXP A;  1WUM A;  5EM3 A;  4A9J A;  5CQA A;  4TZ8 A;  2RNY A;  5ENH A;  5FH8 A;  3HMF A;  4PY6 A;  5IBN A;  3Q2F A;  2RNX A;  4NRB A;  4Z6H A;  5G4S A;  3UW9 A;  5C8G A;  5LJ0 A;  4MEN A;  5CQ4 A;  4YAB A;  4XY8 A;  3FKM X;  4OUF A;  4A9L A;  3LQJ A;  4ZC9 A;  5D3N A;  2WP1 A;  3U5O A;  5BT3 A;  5EK9 A;  5KTX A;  4UIX A;  4UYF A;  5EU1 A;  5H1V A;  4BW1 A;  5CUA A;  5BT4 A;  4LZR A;  4O7A A;  5F2P A;  4A9F A;  3IU6 A;  5LKU A;  4YAD A;  5FE8 A;  3QZT A;  5EQ1 A;  2DVQ A;  5LKT A;  5ENB A;  5FB1 A;  5I86 A;  4BW4 A;  4NR5 A;  2RNW A;  2DVS A;  5AD2 A;  5G4R A;  3LJW A;  4PCI A;  5FG5 A;  5C7N A;  4NR6 A;  4A9M A;  5FB0 A;  5L96 A;  4UIZ A;  4UIT A;  5FE6 A;  4QEV A;  2YQD A;  5J0D A;  3UVW A;  4PCE A;  2L85 A;  3O36 A;  5DYU A;  5F63 A;  4QSV A;  4QSR A;  4UYG A;  5F5Z A;  2NXB A;  4NYW A;  5EIC A;  4NR4 A;  5JI8 A;  3GG3 A;  4QEU A;  4TT2 A;  4TT4 A;  2YEL A;  4BJX A;  5CTL A;  5EP7 A;  4YYN A;  4HBW A;  4LC2 A;  5FFV A;  5JWM A;  3P1E A;  5FDZ A;  5A5P A;  3O34 A;  5I29 A;  4QYL A;  4KV4 A;  4MEO A;  3UVY A;  4CUP A;  3U5L A;  4NRA A;  4TU6 A;  4WHU A;  3U5K A;  4UYH A;  5E74 A;  3P1F A;  5FE3 A;  4YBS A;  4O75 A;  4A9K A;  3P5O A;  5A81 A;  5L8U A;  5CUD A;  4BW2 A;  5HRW A;  4UIU A;  4DON A;  3LQH A;  5DYX A;  5CQ6 A;  4LZS A;  4MR4 A;  4LZ2 A;  3I3J A;  4HBX A;  4TQN A;  5DFD A;  4TT6 A;  5A82 A;  3MUL A;  5ENG A;  4MEQ A;  2L5E A;  4CUS A;  4YYG A;  5K29 A;  3K2J A;  4UIV A;  5F36 A;  4QST A;  4HXL A;  4YK0 A;  2R0V A;  4O71 A;  5HEN A;  2DKW A;  5DY7 A;  3O33 A;  5TCM A;  3UV4 A;  4YAT A;  4QZS A;  4ALG A;  4QYD A;  5H1U A;  3JVJ A;  4TZ2 A;  5CQ3 A;  4N4H A;  2G4A A;  5F3A A;  4A9E A;  3SVH A;  4YH3 A;  4IR4 A;  1X0J A;  2DVV A;  5A5Q A;  5EA1 A;  4QR3 A;  4HXM A;  5DYA A;  4N3W A;  2OSS A;  5A5S A;  5EWH A;  4QSP A;  5LJ1 A;  4NYV A;  4YBT A;  5LKZ A;  4IOQ A;  4TYL A;  4X2I A;  3U5M A;  4MR6 A;  4KV1 A;  4MR3 A;  5ENF A;  5KTU A;  1E6I A;  5D25 A;  4YYI A;  5EWC A;  5D3P A;  3SVF A;  5HRV A;  2LSP B;  3JVL A;  5FG6 A;  5HRX A;  5E9L A;  4XUB A;  5CRM A;  5EVA A;  5F1L A;  5IGN A;  5CRZ A;  5E9K A;  2N9G A;  5A5R A;  2RI7 A;  4PKL A;  5DKD A;  4J0S A;  4NUC A;  5I89 A;  4IR3 A;  3S91 A;  5HEM A;  5D3R A;  4NQM A;  4OGJ A;  3SVG A;  4NS5 A;  2F6J A;  2R10 A;  2DVR A;  5IG6 A;  2RFJ A;  5F60 A;  4LYI A;  2YDW A;  5II1 A;  1JM4 B;  3MQM A;  5CQ8 A;  3ZYU A;  2E7O A;  5AME A;  3IU5 A;  4Q0N A;  5LKX A;  5EWV A;  4C67 A;  3P1D A;  4XUA A;  5I80 A;  2F6N A;  3RCW A;  5DKH A;  5EV9 A;  5AD3 A;  2YW5 A;  4TU4 A;  3MUK A;  4HXR A;  4QR5 A;  5DFC A;  3LQI A;  5DBM A;  4PTB A;  4O76 A;  5HQ5 A;  4J0R A;  4XYA A;  3D7C A;  5D3H A;  5HQ7 A;  5I40 A;  5CZG A;  5FE5 A;  5C87 A;  4NR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...