4YYIA

Crystal structure of brd9 bromodomain bound to an acetylated peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
TPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 100
sequence length 100
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yyiA00
4KCXA 4UYDA 2DVSA 4NR4A 5LVRA 3P1EA 5D3NA 3U5MA 4F3IA 5FG4A 4ALGA 4NUEA 5HFRA 4QZSA 5ENCA 3G0LA 4CUSA 4YYKA 1F68A 5AD2A 4YAXA 4A9EA 5BT3A 5A5OA 4IR4A 5F63A 5EWWA 2KTBB 5D3PA 3MB4A 3O37A 4PS5A 4Q0OA 4QEVA 5FE7A 5HQ7A 5EWDA 5F5ZA 3DAIA 4N4IA 5FG6A 5CRMA 4MEOA 5A5SA 4J1PA 4CURA 5DFDA 4OGIA 5E7DA 2GRCA 4FLPA 4CUTA 1EQFA 5EWVA 2I7KA 4IORA 5A83A 5TB6A 2OO1A 1WUGA 5LKTA 3K2JA 5CQ4A 3P1FA 2G4AA 3LQJA 4NQMA 4MEPA 5J0DA 4NRAA 4YH3A 5HENA 4O77A 3UV2A 5C85A 5E3DA 4QUTA 4PCEA 5DFCA 4WIVA 4X2IA 4J0SA 2FSAA 3LXJA 5F1LA 5LJ1A 4XY8A 3HMEA 4NR8A 4A9IA 4YADA 4YC9A 3O33A 4LRGA 4NRCA 4YK0A 4NUDA 5FE0A 5DW1A 4MR4A 2R0YA 3UW9A 5D24A 3U5OA 5DLXA 4ZC9A 5C8GA 2L85A 5HJCA 5DW2A 3MXFA 2NXBA 4NXJA 5D26A 3DWYA 5DBMA 5ENHA 5ACYA 5KTWA 5H1TA 5EV9A 4QSPA 4Z1SA 5I29A 4QSRA 4O78A 4NRBA 4NYVA 4NQNA 4CFKA 3QZTA 5F36A 5E9IA 4ZQLA 2RFJA 4O74A 5DFBA 5DYAA 3O34A 5L97A 5FE1A 5I88A 4Y03A 3SVGA 4A9FA 5FB0A 4BJXA 5EICA 5CQ5A 4Z6HA 4PTBA 5A85A 4NR7A 4UYHA 5E9MA 2D9EA 5DLZA 5EPBA 3ONIA 5EP7A 4LZ2A 4PY6A 3U5JA 5HRXA 5IGLA 4TQNA 5E74A 5I80A 5E73A 4BHWA 5CQ7A 2YQDA 4LR6A 5HQ5A 4UIZA 4XY9A 5E9YA 1N72A 1X0JA 5LKXA 5DKDA 5E0RA 3U5KA 5FFVA 5II2A 4YYNA 5A81A 4IR6A 4MEQA 3MQMA 5CQAA 5CS8A 4WHWA 3RCWA 4HXRA 5HRWA 5CQ8A 5EGUA 2RNXA 2YDWA 3O36A 3QZVA 4PKLA 3U5LA 5LUUA 4QR4A 4UYFA 5JWMA 4TYLA 5D3HA 5FH8A 4N4HA 5CFWA 5I83A 5I7YA 2N9GA 4TT6A 5FFYA 2LSPB 2MJVB 3D7CA 5I1QA 2R10A 5EK9A 5DYCA 4YBTA 5EWHA 5D3SA 3U5NA 5CUAA 4HBXA 3G0JA 5EVAA 4IOOA 4N3WA 4CUQA 3UVXA 3JVLA 5IGMA 3SVHA 3P1CA 5FG5A 2DKWA 4LC2A 5F62A 5D3RA 4HXMA 2I8NA 5CPEA 4HXKA 5I7XA 5ENBA 4QSWA 4NR9A 5FB1A 3JVJA 5ENIA 5EM3A 3MB3A 3S91A 5KU3A 4ZW1A 4J3IA 5CY9A 2WP2A 4YYGA 5EQ1A 5AMFA 2DVQA 4LDFA 4BW2A 5CQ6A 4HXLA 4O70A 5G4SA 5EU1A 4YYHA 4QSSA 4N4GA 4HBWA 1JSPB 5C87A 5E3GA 4A9NA 4UIYA 4IR5A 3TLPA 2E7OA 4HXPA 3HMHA 4QR5A 4MR5A 5C89A 2YYNA 2E3KA 4MR6A 5CZGA 3LQHA 4O75A 5BT5A 5KHMA 5I89A 1ZS5A 3MULA 5ETDA 5II1A 5CQ3A 5HELA 5DYUA 3GG3A 4GPJA 5CUCA 5COIA 5BT4A 5I86A 4YYDA 4C67A 4QC3A 5CU8A 5LJ2A 5F3AA 3UV5A 5E9LA 4O7BA 4OGJA 5EA1A 2WP1A 2D82A 4DONA 5FBXA 5HLSA 5I40A 2RI7A 5KO4A 3LQIA 4LZRA 5HQ6A 4O7CA 5CUGA 4QC1A 4NR5A 5F25A 5EISA 5H85A 3FKMX 5K29A 3P1DA 5DY7A 5IIDA 3I3JA 4XYAA 5FE5A 4A9HA 5H1UA 4TTEA 4LYIA 1E6IA 4RVRA 4TZ2A 2H60A 4QSQA 3S92A 5FH6A 2YW5A 4XUBA 5ENFA 4O72A 3MUKA 1WUMA 2DVVA 4UYEA 2OUOA 4YY6A 4KV1A 4Z6IA 2F6JA 2DATA 4Z93A 5IG6A 4IOQA 3NXBA 4A9LA 5IBNA 4YYJA 5L99A 4QYLA 4A9MA 3UVWA 2F6NA 5D25A 4TU6A 5FE2A 5A5RA 5FE9A 5CTLA 5DKCA 5HM0A 5H1VA 5IGKA 5D0CA 4CL9A 4UIVA 5G4RA 5DX4A 4QSUA 4A9JA 4KV4A 4O7FA 5AMEA 4ALHA 3IU5A 4UITA 5JI8A 3QZSA 5CUBA 4NYXA 4YABA 2R0VA 4QB3A 2E7NA 2YELA 5IGNA 5L8UA 2OSSA 5D3JA 4LYSA 5D7XA 5CP5A 2DVRA 5L8TA 4XUAA 4YY4A 2YEMA 4YYIA 5LKUA 5A5QA 5F61A 4CLBA 5D3TA 4N4FA 4NUCA 4TU4A 3UVDA 5CRZA 5EWCA 4CFLA 4J0RA 5L98A 3UV4A 4YYMA 4BW1A 5C4QA 5L96A 4HBVA 5LKZA 5F2PA 4O7AA 3IU6A 5A5NA 5FE4A 2RNYA 3U5PA 4HXNA 4QSVA 5KTUA 3LJWA 4TT4A 5FE3A 4A9KA 5EPSA 2L5EA 4UYGA 4QR3A 4QUUA 5DYXA 4LYWA 5FE8A 5CUDA 4OUFA 4HXOA 5CUEA 3Q2EA 4NYWA 4QYDA 4UIUA 4NS5A 4QBMA 3UVYA 5FH7A 5CQTA 5E9KA 5FDZA 3O35A 5E9VA 5HRVA 2RS9B 5A5PA 2RO1A 5EPRA 4CUUA 4YBSA 4C66A 4YBMA 4UYFB 5LVQA 4MENA 4O7EA 5F1HA 1JM4B 3AADA 5ENEA 5FFWA 4HBYA 4O76A 5C7NA 2R0SA 5KTXA 4QEUA 4TT2A 4QEWA 2RNWA 3P5OA 5A7CA 4E96A 4QY4A 4YH4A 3SVFA 5HEMA 5TCMA 4WHUA 4UIWA 5CGPA 2YEKA 3ZYUA 4LZSA 5ENJA 5D3LA 4Z1QA 4Q0NA 5AD3A 2L84A 5ENGA 4QSTA 5EI4A 4BW4A 4NR6A 5HCLA 5ETBA 3Q2FA 3JVMA 4UIXA 5FE6A 4QNSA 4YATA 4AKNA 4PCIA 3JVKA 4QSXA 4TZ8A 5LJ0A 4TS8A 5F60A 2DWWA 4MR3A 4BW3A 4IR3A 3AQAA 4CUPA 4HXSA 5HFQA 5A82A 4A9OA 4O71A 5DKHA 3HMFA
chains in the Genus database with same CATH superfamily
4KCXA 4UYDA 2DVSA 4NR4A 5LVRA 3P1EA 5D3NA 3U5MA 4F3IA 5FG4A 4ALGA 4NUEA 5HFRA 4QZSA 5ENCA 3G0LA 3D1BA 4CUSA 4YYKA 1F68A 5AD2A 4YAXA 4A9EA 5BT3A 5A5OA 4IR4A 5F63A 5EWWA 2KTBB 5D3PA 3MB4A 3O37A 4PS5A 4Q0OA 4QEVA 5FE7A 5HQ7A 5EWDA 5F5ZA 3DAIA 4N4IA 5FG6A 5CRMA 4MEOA 5A5SA 4J1PA 4CURA 5DFDA 4OGIA 5E7DA 2GRCA 4FLPA 4CUTA 1EQFA 5EWVA 2I7KA 4IORA 5A83A 5TB6A 2OO1A 1WUGA 5LKTA 3K2JA 5CQ4A 3P1FA 2G4AA 3LQJA 4NQMA 4MEPA 5J0DA 4NRAA 4YH3A 5HENA 4O77A 3UV2A 5C85A 5E3DA 4QUTA 4PCEA 5DFCA 4WIVA 4X2IA 4J0SA 2FSAA 3LXJA 5F1LA 5LJ1A 4XY8A 3VKGA 3HMEA 4NR8A 4A9IA 4YADA 4YC9A 3O33A 4LRGA 4NRCA 4YK0A 4NUDA 5FE0A 5DW1A 4MR4A 2R0YA 3UW9A 5D24A 3U5OA 5DLXA 4ZC9A 5C8GA 2L85A 5HJCA 5DW2A 3MXFA 2NXBA 4NXJA 5D26A 3DWYA 5DBMA 5ENHA 5ACYA 5KTWA 5H1TA 5EV9A 4QSPA 4Z1SA 5I29A 4QSRA 4O78A 4NRBA 4NYVA 4NQNA 4CFKA 3QZTA 5F36A 5E9IA 4ZQLA 2RFJA 4O74A 5DFBA 5DYAA 3O34A 5L97A 5FE1A 5I88A 4Y03A 3SVGA 4A9FA 5FB0A 4BJXA 5EICA 5CQ5A 4Z6HA 4PTBA 5A85A 4NR7A 4UYHA 5E9MA 2D9EA 5DLZA 5EPBA 3ONIA 5EP7A 4LZ2A 4PY6A 3U5JA 5HRXA 5IGLA 4TQNA 5E74A 5I80A 5E73A 4BHWA 5CQ7A 2YQDA 4LR6A 5HQ5A 4UIZA 4XY9A 5E9YA 1N72A 1X0JA 4AKIA 5LKXA 5DKDA 5E0RA 3U5KA 5FFVA 5II2A 4YYNA 5A81A 4IR6A 4MEQA 3MQMA 5CQAA 5CS8A 4WHWA 3RCWA 4HXRA 5HRWA 5CQ8A 5EGUA 2RNXA 2YDWA 3O36A 3QZVA 4PKLA 3U5LA 5LUUA 4QR4A 4UYFA 5JWMA 4TYLA 5D3HA 5FH8A 4N4HA 5CFWA 5I83A 5I7YA 2N9GA 4TT6A 5FFYA 2LSPB 2MJVB 3D7CA 5I1QA 2R10A 5EK9A 5DYCA 4YBTA 5EWHA 5D3SA 3U5NA 5CUAA 4HBXA 3G0JA 5EVAA 4IOOA 4N3WA 4CUQA 3UVXA 3JVLA 5IGMA 3SVHA 3P1CA 5FG5A 2DKWA 4LC2A 5F62A 5D3RA 4HXMA 2I8NA 5CPEA 4HXKA 5I7XA 5ENBA 4QSWA 4NR9A 5FB1A 3JVJA 5ENIA 5EM3A 3MB3A 3S91A 5KU3A 4ZW1A 4J3IA 5CY9A 2WP2A 4YYGA 5EQ1A 5AMFA 2DVQA 4LDFA 4BW2A 5CQ6A 4HXLA 4O70A 5G4SA 5EU1A 4YYHA 4QSSA 4N4GA 4HBWA 1JSPB 5C87A 5E3GA 4A9NA 4UIYA 4IR5A 3TLPA 2E7OA 4HXPA 3HMHA 4QR5A 4MR5A 5C89A 2YYNA 2E3KA 4MR6A 5CZGA 3ERRA 3LQHA 4O75A 5BT5A 5KHMA 5I89A 1ZS5A 3MULA 5ETDA 5II1A 5CQ3A 5HELA 5DYUA 2EJNA 3GG3A 4AKGA 4GPJA 5CUCA 5COIA 5BT4A 5I86A 4YYDA 4C67A 4QC3A 5CU8A 5LJ2A 5F3AA 3UV5A 5E9LA 4O7BA 4OGJA 5EA1A 2WP1A 2D82A 4DONA 5FBXA 5HLSA 5I40A 2RI7A 5KO4A 3LQIA 4LZRA 5HQ6A 4O7CA 5CUGA 4QC1A 4NR5A 5F25A 5EISA 5H85A 3FKMX 5K29A 3P1DA 5DY7A 5IIDA 3I3JA 4XYAA 5FE5A 4A9HA 5H1UA 4TTEA 4LYIA 1E6IA 4RVRA 4TZ2A 2H60A 4QSQA 3S92A 5FH6A 2YW5A 4XUBA 5ENFA 4O72A 3MUKA 1WUMA 2DVVA 4UYEA 2OUOA 4YY6A 4KV1A 4Z6IA 2F6JA 2DATA 4Z93A 5IG6A 4IOQA 3NXBA 4A9LA 5IBNA 4YYJA 5L99A 4QYLA 4A9MA 3UVWA 2F6NA 5D25A 4TU6A 5FE2A 5A5RA 5FE9A 4AI6A 5CTLA 5DKCA 5HM0A 5H1VA 5IGKA 5D0CA 4CL9A 4UIVA 5G4RA 5DX4A 4QSUA 4A9JA 4KV4A 4O7FA 5AMEA 4AKHA 4ALHA 3IU5A 4UITA 5JI8A 3QZSA 5CUBA 4NYXA 4YABA 2R0VA 4QB3A 2E7NA 2YELA 5IGNA 5L8UA 2OSSA 5D3JA 4LYSA 5D7XA 5CP5A 2DVRA 5L8TA 4XUAA 4YY4A 2YEMA 4YYIA 5LKUA 5A5QA 1PUOA 5F61A 4CLBA 5D3TA 4N4FA 4NUCA 4TU4A 3UVDA 5CRZA 5EWCA 4CFLA 4J0RA 5L98A 3UV4A 4YYMA 4BW1A 5C4QA 5L96A 4HBVA 5LKZA 5F2PA 4O7AA 3IU6A 5A5NA 5FE4A 2RNYA 3U5PA 4HXNA 4QSVA 5KTUA 3VKHA 3LJWA 4TT4A 5FE3A 4A9KA 5EPSA 2L5EA 4UYGA 4QR3A 4QUUA 5DYXA 4LYWA 5FE8A 5CUDA 4OUFA 4HXOA 5CUEA 3Q2EA 4NYWA 4QYDA 4UIUA 4NS5A 4QBMA 3UVYA 5FH7A 5CQTA 5E9KA 5FDZA 3D1DA 3O35A 5E9VA 5HRVA 2RS9B 5A5PA 2RO1A 5EPRA 4CUUA 4YBSA 4C66A 4YBMA 4UYFB 5LVQA 4MENA 4O7EA 5F1HA 1JM4B 3AADA 5ENEA 5FFWA 4HBYA 4O76A 5C7NA 2R0SA 5KTXA 4QEUA 4TT2A 4QEWA 2RNWA 3P5OA 5A7CA 4E96A 4QY4A 4YH4A 3SVFA 5HEMA 5TCMA 4WHUA 4UIWA 5CGPA 2YEKA 3ZYUA 4LZSA 5ENJA 5D3LA 4Z1QA 4Q0NA 5AD3A 2L84A 5ENGA 4QSTA 1ZKRA 5EI4A 4BW4A 4NR6A 5HCLA 5ETBA 3Q2FA 3JVMA 4UIXA 5FE6A 4QNSA 4YATA 4AKNA 4PCIA 3JVKA 4QSXA 4TZ8A 5LJ0A 4TS8A 5F60A 2DWWA 4MR3A 4BW3A 4IR3A 3AQAA 4CUPA 4HXSA 5HFQA 5A82A 4A9OA 4O71A 5DKHA 3HMFA
chains in the Genus database with same CATH topology
4KCXA 4UYDA 2DVSA 4NR4A 5LVRA 3P1EA 5D3NA 3U5MA 4F3IA 5FG4A 4ALGA 4NUEA 5HFRA 4QZSA 5ENCA 3G0LA 4CUSA 4YYKA 1F68A 5AD2A 4YAXA 4A9EA 5BT3A 5A5OA 4IR4A 5F63A 5EWWA 2KTBB 5D3PA 3MB4A 3O37A 4PS5A 4Q0OA 4QEVA 5FE7A 5HQ7A 5EWDA 5F5ZA 3DAIA 4N4IA 5FG6A 5CRMA 4MEOA 5A5SA 4J1PA 4CURA 5DFDA 4OGIA 5E7DA 2GRCA 4FLPA 4CUTA 1EQFA 5EWVA 2I7KA 4IORA 5A83A 5TB6A 2OO1A 1WUGA 5LKTA 3K2JA 5CQ4A 3P1FA 2G4AA 3LQJA 4NQMA 4MEPA 5J0DA 4NRAA 4YH3A 5HENA 4O77A 3UV2A 5C85A 5E3DA 4QUTA 4PCEA 5DFCA 4WIVA 4X2IA 4J0SA 2FSAA 3LXJA 5F1LA 5LJ1A 4XY8A 3HMEA 4NR8A 4A9IA 4YADA 4YC9A 3O33A 4LRGA 4NRCA 4YK0A 4NUDA 5FE0A 5DW1A 4MR4A 2R0YA 3UW9A 5D24A 3U5OA 5DLXA 4ZC9A 5C8GA 2L85A 5HJCA 5DW2A 3MXFA 2NXBA 4NXJA 5D26A 3DWYA 5DBMA 5ENHA 5ACYA 5KTWA 5H1TA 5EV9A 4QSPA 4Z1SA 5I29A 4QSRA 4O78A 4NRBA 4NYVA 4NQNA 4CFKA 3QZTA 5F36A 5E9IA 4ZQLA 2RFJA 4O74A 5DFBA 5DYAA 3O34A 5L97A 5FE1A 5I88A 4Y03A 3SVGA 4A9FA 5FB0A 4BJXA 5EICA 5CQ5A 4Z6HA 4PTBA 5A85A 4NR7A 4UYHA 5E9MA 2D9EA 5DLZA 5EPBA 3ONIA 5EP7A 4LZ2A 4PY6A 3U5JA 5HRXA 5IGLA 4TQNA 5E74A 5I80A 5E73A 4BHWA 5CQ7A 2YQDA 4LR6A 5HQ5A 4UIZA 4XY9A 5E9YA 1N72A 1X0JA 5LKXA 5DKDA 5E0RA 3U5KA 5FFVA 5II2A 4YYNA 5A81A 4IR6A 4MEQA 3MQMA 5CQAA 5CS8A 4WHWA 3RCWA 4HXRA 5HRWA 5CQ8A 5EGUA 2RNXA 2YDWA 3O36A 3QZVA 4PKLA 3U5LA 5LUUA 4QR4A 4UYFA 5JWMA 4TYLA 5D3HA 5FH8A 4N4HA 5CFWA 5I83A 5I7YA 2N9GA 4TT6A 5FFYA 2LSPB 2MJVB 3D7CA 5I1QA 2R10A 5EK9A 5DYCA 4YBTA 5EWHA 5D3SA 3U5NA 5CUAA 4HBXA 3G0JA 5EVAA 4IOOA 4N3WA 4CUQA 3UVXA 3JVLA 5IGMA 3SVHA 3P1CA 5FG5A 2DKWA 4LC2A 5F62A 5D3RA 4HXMA 2I8NA 5CPEA 4HXKA 5I7XA 5ENBA 4QSWA 4NR9A 5FB1A 3JVJA 5ENIA 5EM3A 3MB3A 3S91A 5KU3A 4ZW1A 4J3IA 5CY9A 2WP2A 4YYGA 5EQ1A 5AMFA 2DVQA 4LDFA 4BW2A 5CQ6A 4HXLA 4O70A 5G4SA 5EU1A 4YYHA 4QSSA 4N4GA 4HBWA 1JSPB 5C87A 5E3GA 4A9NA 4UIYA 4IR5A 3TLPA 2E7OA 4HXPA 3HMHA 4QR5A 4MR5A 5C89A 2YYNA 2E3KA 4MR6A 5CZGA 3LQHA 4O75A 5BT5A 5KHMA 5I89A 1ZS5A 3MULA 5ETDA 5II1A 5CQ3A 5HELA 5DYUA 3GG3A 4GPJA 5CUCA 5COIA 5BT4A 5I86A 4YYDA 4C67A 4QC3A 5CU8A 5LJ2A 5F3AA 3UV5A 5E9LA 4O7BA 4OGJA 5EA1A 2WP1A 2D82A 4DONA 5FBXA 5HLSA 5I40A 2RI7A 5KO4A 3LQIA 4LZRA 5HQ6A 4O7CA 5CUGA 4QC1A 4NR5A 5F25A 5EISA 5H85A 3FKMX 5K29A 3P1DA 5DY7A 5IIDA 3I3JA 4XYAA 5FE5A 4A9HA 5H1UA 4TTEA 4LYIA 1E6IA 4RVRA 4TZ2A 2H60A 4QSQA 3S92A 5FH6A 2YW5A 4XUBA 5ENFA 4O72A 3MUKA 1WUMA 2DVVA 4UYEA 2OUOA 4YY6A 4KV1A 4Z6IA 2F6JA 2DATA 4Z93A 5IG6A 4IOQA 3NXBA 4A9LA 5IBNA 4YYJA 5L99A 4QYLA 4A9MA 3UVWA 2F6NA 5D25A 4TU6A 5FE2A 5A5RA 5FE9A 5CTLA 5DKCA 5HM0A 5H1VA 5IGKA 5D0CA 4CL9A 4UIVA 5G4RA 5DX4A 4QSUA 4A9JA 4KV4A 4O7FA 5AMEA 4ALHA 3IU5A 4UITA 5JI8A 3QZSA 5CUBA 4NYXA 4YABA 2R0VA 4QB3A 2E7NA 2YELA 5IGNA 5L8UA 2OSSA 5D3JA 4LYSA 5D7XA 5CP5A 2DVRA 5L8TA 4XUAA 4YY4A 2YEMA 4YYIA 5LKUA 5A5QA 5F61A 4CLBA 5D3TA 4N4FA 4NUCA 4TU4A 3UVDA 5CRZA 5EWCA 4CFLA 4J0RA 5L98A 3UV4A 4YYMA 4BW1A 5C4QA 5L96A 4HBVA 5LKZA 5F2PA 4O7AA 3IU6A 5A5NA 5FE4A 2RNYA 3U5PA 4HXNA 4QSVA 5KTUA 3LJWA 4TT4A 5FE3A 4A9KA 5EPSA 2L5EA 4UYGA 4QR3A 4QUUA 5DYXA 4LYWA 5FE8A 5CUDA 4OUFA 4HXOA 5CUEA 3Q2EA 4NYWA 4QYDA 4UIUA 4NS5A 4QBMA 3UVYA 5FH7A 5CQTA 5E9KA 5FDZA 3O35A 5E9VA 5HRVA 2RS9B 5A5PA 2RO1A 5EPRA 4CUUA 4YBSA 4C66A 4YBMA 4UYFB 5LVQA 4MENA 4O7EA 5F1HA 1JM4B 3AADA 5ENEA 5FFWA 4HBYA 4O76A 5C7NA 2R0SA 5KTXA 4QEUA 4TT2A 4QEWA 2RNWA 3P5OA 5A7CA 4E96A 4QY4A 4YH4A 3SVFA 5HEMA 5TCMA 4WHUA 4UIWA 5CGPA 2YEKA 3ZYUA 4LZSA 5ENJA 5D3LA 4Z1QA 4Q0NA 5AD3A 2L84A 5ENGA 4QSTA 5EI4A 4BW4A 4NR6A 5HCLA 5ETBA 3Q2FA 3JVMA 4UIXA 5FE6A 4QNSA 4YATA 4AKNA 4PCIA 3JVKA 4QSXA 4TZ8A 5LJ0A 4TS8A 5F60A 2DWWA 4MR3A 4BW3A 4IR3A 3AQAA 4CUPA 4HXSA 5HFQA 5A82A 4A9OA 4O71A 5DKHA 3HMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCX A;  4UYD A;  2DVS A;  4NR4 A;  5LVR A;  3P1E A;  5D3N A;  3U5M A;  4F3I A;  5FG4 A;  4ALG A;  4NUE A;  5HFR A;  4QZS A;  5ENC A;  3G0L A;  4CUS A;  4YYK A;  1F68 A;  5AD2 A;  4YAX A;  4A9E A;  5BT3 A;  5A5O A;  4IR4 A;  5F63 A;  5EWW A;  2KTB B;  5D3P A;  3MB4 A;  3O37 A;  4PS5 A;  4Q0O A;  4QEV A;  5FE7 A;  5HQ7 A;  5EWD A;  5F5Z A;  3DAI A;  4N4I A;  5FG6 A;  5CRM A;  4MEO A;  5A5S A;  4J1P A;  4CUR A;  5DFD A;  4OGI A;  5E7D A;  2GRC A;  4FLP A;  4CUT A;  1EQF A;  5EWV A;  2I7K A;  4IOR A;  5A83 A;  5TB6 A;  2OO1 A;  1WUG A;  5LKT A;  3K2J A;  5CQ4 A;  3P1F A;  2G4A A;  3LQJ A;  4NQM A;  4MEP A;  5J0D A;  4NRA A;  4YH3 A;  5HEN A;  4O77 A;  3UV2 A;  5C85 A;  5E3D A;  4QUT A;  4PCE A;  5DFC A;  4WIV A;  4X2I A;  4J0S A;  2FSA A;  3LXJ A;  5F1L A;  5LJ1 A;  4XY8 A;  3HME A;  4NR8 A;  4A9I A;  4YAD A;  4YC9 A;  3O33 A;  4LRG A;  4NRC A;  4YK0 A;  4NUD A;  5FE0 A;  5DW1 A;  4MR4 A;  2R0Y A;  3UW9 A;  5D24 A;  3U5O A;  5DLX A;  4ZC9 A;  5C8G A;  2L85 A;  5HJC A;  5DW2 A;  3MXF A;  2NXB A;  4NXJ A;  5D26 A;  3DWY A;  5DBM A;  5ENH A;  5ACY A;  5KTW A;  5H1T A;  5EV9 A;  4QSP A;  4Z1S A;  5I29 A;  4QSR A;  4O78 A;  4NRB A;  4NYV A;  4NQN A;  4CFK A;  3QZT A;  5F36 A;  5E9I A;  4ZQL A;  2RFJ A;  4O74 A;  5DFB A;  5DYA A;  3O34 A;  5L97 A;  5FE1 A;  5I88 A;  4Y03 A;  3SVG A;  4A9F A;  5FB0 A;  4BJX A;  5EIC A;  5CQ5 A;  4Z6H A;  4PTB A;  5A85 A;  4NR7 A;  4UYH A;  5E9M A;  2D9E A;  5DLZ A;  5EPB A;  3ONI A;  5EP7 A;  4LZ2 A;  4PY6 A;  3U5J A;  5HRX A;  5IGL A;  4TQN A;  5E74 A;  5I80 A;  5E73 A;  4BHW A;  5CQ7 A;  2YQD A;  4LR6 A;  5HQ5 A;  4UIZ A;  4XY9 A;  5E9Y A;  1N72 A;  1X0J A;  5LKX A;  5DKD A;  5E0R A;  3U5K A;  5FFV A;  5II2 A;  4YYN A;  5A81 A;  4IR6 A;  4MEQ A;  3MQM A;  5CQA A;  5CS8 A;  4WHW A;  3RCW A;  4HXR A;  5HRW A;  5CQ8 A;  5EGU A;  2RNX A;  2YDW A;  3O36 A;  3QZV A;  4PKL A;  3U5L A;  5LUU A;  4QR4 A;  4UYF A;  5JWM A;  4TYL A;  5D3H A;  5FH8 A;  4N4H A;  5CFW A;  5I83 A;  5I7Y A;  2N9G A;  4TT6 A;  5FFY A;  2LSP B;  2MJV B;  3D7C A;  5I1Q A;  2R10 A;  5EK9 A;  5DYC A;  4YBT A;  5EWH A;  5D3S A;  3U5N A;  5CUA A;  4HBX A;  3G0J A;  5EVA A;  4IOO A;  4N3W A;  4CUQ A;  3UVX A;  3JVL A;  5IGM A;  3SVH A;  3P1C A;  5FG5 A;  2DKW A;  4LC2 A;  5F62 A;  5D3R A;  4HXM A;  2I8N A;  5CPE A;  4HXK A;  5I7X A;  5ENB A;  4QSW A;  4NR9 A;  5FB1 A;  3JVJ A;  5ENI A;  5EM3 A;  3MB3 A;  3S91 A;  5KU3 A;  4ZW1 A;  4J3I A;  5CY9 A;  2WP2 A;  4YYG A;  5EQ1 A;  5AMF A;  2DVQ A;  4LDF A;  4BW2 A;  5CQ6 A;  4HXL A;  4O70 A;  5G4S A;  5EU1 A;  4YYH A;  4QSS A;  4N4G A;  4HBW A;  1JSP B;  5C87 A;  5E3G A;  4A9N A;  4UIY A;  4IR5 A;  3TLP A;  2E7O A;  4HXP A;  3HMH A;  4QR5 A;  4MR5 A;  5C89 A;  2YYN A;  2E3K A;  4MR6 A;  5CZG A;  3LQH A;  4O75 A;  5BT5 A;  5KHM A;  5I89 A;  1ZS5 A;  3MUL A;  5ETD A;  5II1 A;  5CQ3 A;  5HEL A;  5DYU A;  3GG3 A;  4GPJ A;  5CUC A;  5COI A;  5BT4 A;  5I86 A;  4YYD A;  4C67 A;  4QC3 A;  5CU8 A;  5LJ2 A;  5F3A A;  3UV5 A;  5E9L A;  4O7B A;  4OGJ A;  5EA1 A;  2WP1 A;  2D82 A;  4DON A;  5FBX A;  5HLS A;  5I40 A;  2RI7 A;  5KO4 A;  3LQI A;  4LZR A;  5HQ6 A;  4O7C A;  5CUG A;  4QC1 A;  4NR5 A;  5F25 A;  5EIS A;  5H85 A;  3FKM X;  5K29 A;  3P1D A;  5DY7 A;  5IID A;  3I3J A;  4XYA A;  5FE5 A;  4A9H A;  5H1U A;  4TTE A;  4LYI A;  1E6I A;  4RVR A;  4TZ2 A;  2H60 A;  4QSQ A;  3S92 A;  5FH6 A;  2YW5 A;  4XUB A;  5ENF A;  4O72 A;  3MUK A;  1WUM A;  2DVV A;  4UYE A;  2OUO A;  4YY6 A;  4KV1 A;  4Z6I A;  2F6J A;  2DAT A;  4Z93 A;  5IG6 A;  4IOQ A;  3NXB A;  4A9L A;  5IBN A;  4YYJ A;  5L99 A;  4QYL A;  4A9M A;  3UVW A;  2F6N A;  5D25 A;  4TU6 A;  5FE2 A;  5A5R A;  5FE9 A;  5CTL A;  5DKC A;  5HM0 A;  5H1V A;  5IGK A;  5D0C A;  4CL9 A;  4UIV A;  5G4R A;  5DX4 A;  4QSU A;  4A9J A;  4KV4 A;  4O7F A;  5AME A;  4ALH A;  3IU5 A;  4UIT A;  5JI8 A;  3QZS A;  5CUB A;  4NYX A;  4YAB A;  2R0V A;  4QB3 A;  2E7N A;  2YEL A;  5IGN A;  5L8U A;  2OSS A;  5D3J A;  4LYS A;  5D7X A;  5CP5 A;  2DVR A;  5L8T A;  4XUA A;  4YY4 A;  2YEM A;  4YYI A;  5LKU A;  5A5Q A;  5F61 A;  4CLB A;  5D3T A;  4N4F A;  4NUC A;  4TU4 A;  3UVD A;  5CRZ A;  5EWC A;  4CFL A;  4J0R A;  5L98 A;  3UV4 A;  4YYM A;  4BW1 A;  5C4Q A;  5L96 A;  4HBV A;  5LKZ A;  5F2P A;  4O7A A;  3IU6 A;  5A5N A;  5FE4 A;  2RNY A;  3U5P A;  4HXN A;  4QSV A;  5KTU A;  3LJW A;  4TT4 A;  5FE3 A;  4A9K A;  5EPS A;  2L5E A;  4UYG A;  4QR3 A;  4QUU A;  5DYX A;  4LYW A;  5FE8 A;  5CUD A;  4OUF A;  4HXO A;  5CUE A;  3Q2E A;  4NYW A;  4QYD A;  4UIU A;  4NS5 A;  4QBM A;  3UVY A;  5FH7 A;  5CQT A;  5E9K A;  5FDZ A;  3O35 A;  5E9V A;  5HRV A;  2RS9 B;  5A5P A;  2RO1 A;  5EPR A;  4CUU A;  4YBS A;  4C66 A;  4YBM A;  4UYF B;  5LVQ A;  4MEN A;  4O7E A;  5F1H A;  1JM4 B;  3AAD A;  5ENE A;  5FFW A;  4HBY A;  4O76 A;  5C7N A;  2R0S A;  5KTX A;  4QEU A;  4TT2 A;  4QEW A;  2RNW A;  3P5O A;  5A7C A;  4E96 A;  4QY4 A;  4YH4 A;  3SVF A;  5HEM A;  5TCM A;  4WHU A;  4UIW A;  5CGP A;  2YEK A;  3ZYU A;  4LZS A;  5ENJ A;  5D3L A;  4Z1Q A;  4Q0N A;  5AD3 A;  2L84 A;  5ENG A;  4QST A;  5EI4 A;  4BW4 A;  4NR6 A;  5HCL A;  5ETB A;  3Q2F A;  3JVM A;  4UIX A;  5FE6 A;  4QNS A;  4YAT A;  4AKN A;  4PCI A;  3JVK A;  4QSX A;  4TZ8 A;  5LJ0 A;  4TS8 A;  5F60 A;  2DWW A;  4MR3 A;  4BW3 A;  4IR3 A;  3AQA A;  4CUP A;  4HXS A;  5HFQ A;  5A82 A;  4A9O A;  4O71 A;  5DKH A;  3HMF A; 
#chains in the Genus database with same CATH topology
 4KCX A;  4UYD A;  2DVS A;  4NR4 A;  5LVR A;  3P1E A;  5D3N A;  3U5M A;  4F3I A;  5FG4 A;  4ALG A;  4NUE A;  5HFR A;  4QZS A;  5ENC A;  3G0L A;  3D1B A;  4CUS A;  4YYK A;  1F68 A;  5AD2 A;  4YAX A;  4A9E A;  5BT3 A;  5A5O A;  4IR4 A;  5F63 A;  5EWW A;  2KTB B;  5D3P A;  3MB4 A;  3O37 A;  4PS5 A;  4Q0O A;  4QEV A;  5FE7 A;  5HQ7 A;  5EWD A;  5F5Z A;  3DAI A;  4N4I A;  5FG6 A;  5CRM A;  4MEO A;  5A5S A;  4J1P A;  4CUR A;  5DFD A;  4OGI A;  5E7D A;  2GRC A;  4FLP A;  4CUT A;  1EQF A;  5EWV A;  2I7K A;  4IOR A;  5A83 A;  5TB6 A;  2OO1 A;  1WUG A;  5LKT A;  3K2J A;  5CQ4 A;  3P1F A;  2G4A A;  3LQJ A;  4NQM A;  4MEP A;  5J0D A;  4NRA A;  4YH3 A;  5HEN A;  4O77 A;  3UV2 A;  5C85 A;  5E3D A;  4QUT A;  4PCE A;  5DFC A;  4WIV A;  4X2I A;  4J0S A;  2FSA A;  3LXJ A;  5F1L A;  5LJ1 A;  4XY8 A;  3VKG A;  3HME A;  4NR8 A;  4A9I A;  4YAD A;  4YC9 A;  3O33 A;  4LRG A;  4NRC A;  4YK0 A;  4NUD A;  5FE0 A;  5DW1 A;  4MR4 A;  2R0Y A;  3UW9 A;  5D24 A;  3U5O A;  5DLX A;  4ZC9 A;  5C8G A;  2L85 A;  5HJC A;  5DW2 A;  3MXF A;  2NXB A;  4NXJ A;  5D26 A;  3DWY A;  5DBM A;  5ENH A;  5ACY A;  5KTW A;  5H1T A;  5EV9 A;  4QSP A;  4Z1S A;  5I29 A;  4QSR A;  4O78 A;  4NRB A;  4NYV A;  4NQN A;  4CFK A;  3QZT A;  5F36 A;  5E9I A;  4ZQL A;  2RFJ A;  4O74 A;  5DFB A;  5DYA A;  3O34 A;  5L97 A;  5FE1 A;  5I88 A;  4Y03 A;  3SVG A;  4A9F A;  5FB0 A;  4BJX A;  5EIC A;  5CQ5 A;  4Z6H A;  4PTB A;  5A85 A;  4NR7 A;  4UYH A;  5E9M A;  2D9E A;  5DLZ A;  5EPB A;  3ONI A;  5EP7 A;  4LZ2 A;  4PY6 A;  3U5J A;  5HRX A;  5IGL A;  4TQN A;  5E74 A;  5I80 A;  5E73 A;  4BHW A;  5CQ7 A;  2YQD A;  4LR6 A;  5HQ5 A;  4UIZ A;  4XY9 A;  5E9Y A;  1N72 A;  1X0J A;  4AKI A;  5LKX A;  5DKD A;  5E0R A;  3U5K A;  5FFV A;  5II2 A;  4YYN A;  5A81 A;  4IR6 A;  4MEQ A;  3MQM A;  5CQA A;  5CS8 A;  4WHW A;  3RCW A;  4HXR A;  5HRW A;  5CQ8 A;  5EGU A;  2RNX A;  2YDW A;  3O36 A;  3QZV A;  4PKL A;  3U5L A;  5LUU A;  4QR4 A;  4UYF A;  5JWM A;  4TYL A;  5D3H A;  5FH8 A;  4N4H A;  5CFW A;  5I83 A;  5I7Y A;  2N9G A;  4TT6 A;  5FFY A;  2LSP B;  2MJV B;  3D7C A;  5I1Q A;  2R10 A;  5EK9 A;  5DYC A;  4YBT A;  5EWH A;  5D3S A;  3U5N A;  5CUA A;  4HBX A;  3G0J A;  5EVA A;  4IOO A;  4N3W A;  4CUQ A;  3UVX A;  3JVL A;  5IGM A;  3SVH A;  3P1C A;  5FG5 A;  2DKW A;  4LC2 A;  5F62 A;  5D3R A;  4HXM A;  2I8N A;  5CPE A;  4HXK A;  5I7X A;  5ENB A;  4QSW A;  4NR9 A;  5FB1 A;  3JVJ A;  5ENI A;  5EM3 A;  3MB3 A;  3S91 A;  5KU3 A;  4ZW1 A;  4J3I A;  5CY9 A;  2WP2 A;  4YYG A;  5EQ1 A;  5AMF A;  2DVQ A;  4LDF A;  4BW2 A;  5CQ6 A;  4HXL A;  4O70 A;  5G4S A;  5EU1 A;  4YYH A;  4QSS A;  4N4G A;  4HBW A;  1JSP B;  5C87 A;  5E3G A;  4A9N A;  4UIY A;  4IR5 A;  3TLP A;  2E7O A;  4HXP A;  3HMH A;  4QR5 A;  4MR5 A;  5C89 A;  2YYN A;  2E3K A;  4MR6 A;  5CZG A;  3ERR A;  3LQH A;  4O75 A;  5BT5 A;  5KHM A;  5I89 A;  1ZS5 A;  3MUL A;  5ETD A;  5II1 A;  5CQ3 A;  5HEL A;  5DYU A;  2EJN A;  3GG3 A;  4AKG A;  4GPJ A;  5CUC A;  5COI A;  5BT4 A;  5I86 A;  4YYD A;  4C67 A;  4QC3 A;  5CU8 A;  5LJ2 A;  5F3A A;  3UV5 A;  5E9L A;  4O7B A;  4OGJ A;  5EA1 A;  2WP1 A;  2D82 A;  4DON A;  5FBX A;  5HLS A;  5I40 A;  2RI7 A;  5KO4 A;  3LQI A;  4LZR A;  5HQ6 A;  4O7C A;  5CUG A;  4QC1 A;  4NR5 A;  5F25 A;  5EIS A;  5H85 A;  3FKM X;  5K29 A;  3P1D A;  5DY7 A;  5IID A;  3I3J A;  4XYA A;  5FE5 A;  4A9H A;  5H1U A;  4TTE A;  4LYI A;  1E6I A;  4RVR A;  4TZ2 A;  2H60 A;  4QSQ A;  3S92 A;  5FH6 A;  2YW5 A;  4XUB A;  5ENF A;  4O72 A;  3MUK A;  1WUM A;  2DVV A;  4UYE A;  2OUO A;  4YY6 A;  4KV1 A;  4Z6I A;  2F6J A;  2DAT A;  4Z93 A;  5IG6 A;  4IOQ A;  3NXB A;  4A9L A;  5IBN A;  4YYJ A;  5L99 A;  4QYL A;  4A9M A;  3UVW A;  2F6N A;  5D25 A;  4TU6 A;  5FE2 A;  5A5R A;  5FE9 A;  4AI6 A;  5CTL A;  5DKC A;  5HM0 A;  5H1V A;  5IGK A;  5D0C A;  4CL9 A;  4UIV A;  5G4R A;  5DX4 A;  4QSU A;  4A9J A;  4KV4 A;  4O7F A;  5AME A;  4AKH A;  4ALH A;  3IU5 A;  4UIT A;  5JI8 A;  3QZS A;  5CUB A;  4NYX A;  4YAB A;  2R0V A;  4QB3 A;  2E7N A;  2YEL A;  5IGN A;  5L8U A;  2OSS A;  5D3J A;  4LYS A;  5D7X A;  5CP5 A;  2DVR A;  5L8T A;  4XUA A;  4YY4 A;  2YEM A;  4YYI A;  5LKU A;  5A5Q A;  1PUO A;  5F61 A;  4CLB A;  5D3T A;  4N4F A;  4NUC A;  4TU4 A;  3UVD A;  5CRZ A;  5EWC A;  4CFL A;  4J0R A;  5L98 A;  3UV4 A;  4YYM A;  4BW1 A;  5C4Q A;  5L96 A;  4HBV A;  5LKZ A;  5F2P A;  4O7A A;  3IU6 A;  5A5N A;  5FE4 A;  2RNY A;  3U5P A;  4HXN A;  4QSV A;  5KTU A;  3VKH A;  3LJW A;  4TT4 A;  5FE3 A;  4A9K A;  5EPS A;  2L5E A;  4UYG A;  4QR3 A;  4QUU A;  5DYX A;  4LYW A;  5FE8 A;  5CUD A;  4OUF A;  4HXO A;  5CUE A;  3Q2E A;  4NYW A;  4QYD A;  4UIU A;  4NS5 A;  4QBM A;  3UVY A;  5FH7 A;  5CQT A;  5E9K A;  5FDZ A;  3D1D A;  3O35 A;  5E9V A;  5HRV A;  2RS9 B;  5A5P A;  2RO1 A;  5EPR A;  4CUU A;  4YBS A;  4C66 A;  4YBM A;  4UYF B;  5LVQ A;  4MEN A;  4O7E A;  5F1H A;  1JM4 B;  3AAD A;  5ENE A;  5FFW A;  4HBY A;  4O76 A;  5C7N A;  2R0S A;  5KTX A;  4QEU A;  4TT2 A;  4QEW A;  2RNW A;  3P5O A;  5A7C A;  4E96 A;  4QY4 A;  4YH4 A;  3SVF A;  5HEM A;  5TCM A;  4WHU A;  4UIW A;  5CGP A;  2YEK A;  3ZYU A;  4LZS A;  5ENJ A;  5D3L A;  4Z1Q A;  4Q0N A;  5AD3 A;  2L84 A;  5ENG A;  4QST A;  1ZKR A;  5EI4 A;  4BW4 A;  4NR6 A;  5HCL A;  5ETB A;  3Q2F A;  3JVM A;  4UIX A;  5FE6 A;  4QNS A;  4YAT A;  4AKN A;  4PCI A;  3JVK A;  4QSX A;  4TZ8 A;  5LJ0 A;  4TS8 A;  5F60 A;  2DWW A;  4MR3 A;  4BW3 A;  4IR3 A;  3AQA A;  4CUP A;  4HXS A;  5HFQ A;  5A82 A;  4A9O A;  4O71 A;  5DKH A;  3HMF A; 
#chains in the Genus database with same CATH homology
 4KCX A;  4UYD A;  2DVS A;  4NR4 A;  5LVR A;  3P1E A;  5D3N A;  3U5M A;  4F3I A;  5FG4 A;  4ALG A;  4NUE A;  5HFR A;  4QZS A;  5ENC A;  3G0L A;  4CUS A;  4YYK A;  1F68 A;  5AD2 A;  4YAX A;  4A9E A;  5BT3 A;  5A5O A;  4IR4 A;  5F63 A;  5EWW A;  2KTB B;  5D3P A;  3MB4 A;  3O37 A;  4PS5 A;  4Q0O A;  4QEV A;  5FE7 A;  5HQ7 A;  5EWD A;  5F5Z A;  3DAI A;  4N4I A;  5FG6 A;  5CRM A;  4MEO A;  5A5S A;  4J1P A;  4CUR A;  5DFD A;  4OGI A;  5E7D A;  2GRC A;  4FLP A;  4CUT A;  1EQF A;  5EWV A;  2I7K A;  4IOR A;  5A83 A;  5TB6 A;  2OO1 A;  1WUG A;  5LKT A;  3K2J A;  5CQ4 A;  3P1F A;  2G4A A;  3LQJ A;  4NQM A;  4MEP A;  5J0D A;  4NRA A;  4YH3 A;  5HEN A;  4O77 A;  3UV2 A;  5C85 A;  5E3D A;  4QUT A;  4PCE A;  5DFC A;  4WIV A;  4X2I A;  4J0S A;  2FSA A;  3LXJ A;  5F1L A;  5LJ1 A;  4XY8 A;  3HME A;  4NR8 A;  4A9I A;  4YAD A;  4YC9 A;  3O33 A;  4LRG A;  4NRC A;  4YK0 A;  4NUD A;  5FE0 A;  5DW1 A;  4MR4 A;  2R0Y A;  3UW9 A;  5D24 A;  3U5O A;  5DLX A;  4ZC9 A;  5C8G A;  2L85 A;  5HJC A;  5DW2 A;  3MXF A;  2NXB A;  4NXJ A;  5D26 A;  3DWY A;  5DBM A;  5ENH A;  5ACY A;  5KTW A;  5H1T A;  5EV9 A;  4QSP A;  4Z1S A;  5I29 A;  4QSR A;  4O78 A;  4NRB A;  4NYV A;  4NQN A;  4CFK A;  3QZT A;  5F36 A;  5E9I A;  4ZQL A;  2RFJ A;  4O74 A;  5DFB A;  5DYA A;  3O34 A;  5L97 A;  5FE1 A;  5I88 A;  4Y03 A;  3SVG A;  4A9F A;  5FB0 A;  4BJX A;  5EIC A;  5CQ5 A;  4Z6H A;  4PTB A;  5A85 A;  4NR7 A;  4UYH A;  5E9M A;  2D9E A;  5DLZ A;  5EPB A;  3ONI A;  5EP7 A;  4LZ2 A;  4PY6 A;  3U5J A;  5HRX A;  5IGL A;  4TQN A;  5E74 A;  5I80 A;  5E73 A;  4BHW A;  5CQ7 A;  2YQD A;  4LR6 A;  5HQ5 A;  4UIZ A;  4XY9 A;  5E9Y A;  1N72 A;  1X0J A;  5LKX A;  5DKD A;  5E0R A;  3U5K A;  5FFV A;  5II2 A;  4YYN A;  5A81 A;  4IR6 A;  4MEQ A;  3MQM A;  5CQA A;  5CS8 A;  4WHW A;  3RCW A;  4HXR A;  5HRW A;  5CQ8 A;  5EGU A;  2RNX A;  2YDW A;  3O36 A;  3QZV A;  4PKL A;  3U5L A;  5LUU A;  4QR4 A;  4UYF A;  5JWM A;  4TYL A;  5D3H A;  5FH8 A;  4N4H A;  5CFW A;  5I83 A;  5I7Y A;  2N9G A;  4TT6 A;  5FFY A;  2LSP B;  2MJV B;  3D7C A;  5I1Q A;  2R10 A;  5EK9 A;  5DYC A;  4YBT A;  5EWH A;  5D3S A;  3U5N A;  5CUA A;  4HBX A;  3G0J A;  5EVA A;  4IOO A;  4N3W A;  4CUQ A;  3UVX A;  3JVL A;  5IGM A;  3SVH A;  3P1C A;  5FG5 A;  2DKW A;  4LC2 A;  5F62 A;  5D3R A;  4HXM A;  2I8N A;  5CPE A;  4HXK A;  5I7X A;  5ENB A;  4QSW A;  4NR9 A;  5FB1 A;  3JVJ A;  5ENI A;  5EM3 A;  3MB3 A;  3S91 A;  5KU3 A;  4ZW1 A;  4J3I A;  5CY9 A;  2WP2 A;  4YYG A;  5EQ1 A;  5AMF A;  2DVQ A;  4LDF A;  4BW2 A;  5CQ6 A;  4HXL A;  4O70 A;  5G4S A;  5EU1 A;  4YYH A;  4QSS A;  4N4G A;  4HBW A;  1JSP B;  5C87 A;  5E3G A;  4A9N A;  4UIY A;  4IR5 A;  3TLP A;  2E7O A;  4HXP A;  3HMH A;  4QR5 A;  4MR5 A;  5C89 A;  2YYN A;  2E3K A;  4MR6 A;  5CZG A;  3LQH A;  4O75 A;  5BT5 A;  5KHM A;  5I89 A;  1ZS5 A;  3MUL A;  5ETD A;  5II1 A;  5CQ3 A;  5HEL A;  5DYU A;  3GG3 A;  4GPJ A;  5CUC A;  5COI A;  5BT4 A;  5I86 A;  4YYD A;  4C67 A;  4QC3 A;  5CU8 A;  5LJ2 A;  5F3A A;  3UV5 A;  5E9L A;  4O7B A;  4OGJ A;  5EA1 A;  2WP1 A;  2D82 A;  4DON A;  5FBX A;  5HLS A;  5I40 A;  2RI7 A;  5KO4 A;  3LQI A;  4LZR A;  5HQ6 A;  4O7C A;  5CUG A;  4QC1 A;  4NR5 A;  5F25 A;  5EIS A;  5H85 A;  3FKM X;  5K29 A;  3P1D A;  5DY7 A;  5IID A;  3I3J A;  4XYA A;  5FE5 A;  4A9H A;  5H1U A;  4TTE A;  4LYI A;  1E6I A;  4RVR A;  4TZ2 A;  2H60 A;  4QSQ A;  3S92 A;  5FH6 A;  2YW5 A;  4XUB A;  5ENF A;  4O72 A;  3MUK A;  1WUM A;  2DVV A;  4UYE A;  2OUO A;  4YY6 A;  4KV1 A;  4Z6I A;  2F6J A;  2DAT A;  4Z93 A;  5IG6 A;  4IOQ A;  3NXB A;  4A9L A;  5IBN A;  4YYJ A;  5L99 A;  4QYL A;  4A9M A;  3UVW A;  2F6N A;  5D25 A;  4TU6 A;  5FE2 A;  5A5R A;  5FE9 A;  5CTL A;  5DKC A;  5HM0 A;  5H1V A;  5IGK A;  5D0C A;  4CL9 A;  4UIV A;  5G4R A;  5DX4 A;  4QSU A;  4A9J A;  4KV4 A;  4O7F A;  5AME A;  4ALH A;  3IU5 A;  4UIT A;  5JI8 A;  3QZS A;  5CUB A;  4NYX A;  4YAB A;  2R0V A;  4QB3 A;  2E7N A;  2YEL A;  5IGN A;  5L8U A;  2OSS A;  5D3J A;  4LYS A;  5D7X A;  5CP5 A;  2DVR A;  5L8T A;  4XUA A;  4YY4 A;  2YEM A;  4YYI A;  5LKU A;  5A5Q A;  5F61 A;  4CLB A;  5D3T A;  4N4F A;  4NUC A;  4TU4 A;  3UVD A;  5CRZ A;  5EWC A;  4CFL A;  4J0R A;  5L98 A;  3UV4 A;  4YYM A;  4BW1 A;  5C4Q A;  5L96 A;  4HBV A;  5LKZ A;  5F2P A;  4O7A A;  3IU6 A;  5A5N A;  5FE4 A;  2RNY A;  3U5P A;  4HXN A;  4QSV A;  5KTU A;  3LJW A;  4TT4 A;  5FE3 A;  4A9K A;  5EPS A;  2L5E A;  4UYG A;  4QR3 A;  4QUU A;  5DYX A;  4LYW A;  5FE8 A;  5CUD A;  4OUF A;  4HXO A;  5CUE A;  3Q2E A;  4NYW A;  4QYD A;  4UIU A;  4NS5 A;  4QBM A;  3UVY A;  5FH7 A;  5CQT A;  5E9K A;  5FDZ A;  3O35 A;  5E9V A;  5HRV A;  2RS9 B;  5A5P A;  2RO1 A;  5EPR A;  4CUU A;  4YBS A;  4C66 A;  4YBM A;  4UYF B;  5LVQ A;  4MEN A;  4O7E A;  5F1H A;  1JM4 B;  3AAD A;  5ENE A;  5FFW A;  4HBY A;  4O76 A;  5C7N A;  2R0S A;  5KTX A;  4QEU A;  4TT2 A;  4QEW A;  2RNW A;  3P5O A;  5A7C A;  4E96 A;  4QY4 A;  4YH4 A;  3SVF A;  5HEM A;  5TCM A;  4WHU A;  4UIW A;  5CGP A;  2YEK A;  3ZYU A;  4LZS A;  5ENJ A;  5D3L A;  4Z1Q A;  4Q0N A;  5AD3 A;  2L84 A;  5ENG A;  4QST A;  5EI4 A;  4BW4 A;  4NR6 A;  5HCL A;  5ETB A;  3Q2F A;  3JVM A;  4UIX A;  5FE6 A;  4QNS A;  4YAT A;  4AKN A;  4PCI A;  3JVK A;  4QSX A;  4TZ8 A;  5LJ0 A;  4TS8 A;  5F60 A;  2DWW A;  4MR3 A;  4BW3 A;  4IR3 A;  3AQA A;  4CUP A;  4HXS A;  5HFQ A;  5A82 A;  4A9O A;  4O71 A;  5DKH A;  3HMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...