5ENCA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with n-(2,6-dichlorobenzyl)acetamide (sgc - diamond i04-1 fragment screening)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5encA00
5EGUA 2DKWA 4HXSA 4IORA 5FDZA 3JVMA 4Z1SA 4ZW1A 5A5QA 5FBXA 5EWDA 4MR5A 5C8GA 5CUCA 3HMFA 4CUTA 4TT2A 5DKHA 5ENBA 4QZSA 4QR3A 4LC2A 2E7NA 4TT6A 5H1UA 5DFBA 1JSPB 3G0JA 5II2A 5D26A 5LKZA 4Y03A 3DAIA 5CUBA 3U5NA 4A9EA 4CURA 5IIDA 5DLZA 5FG4A 4LZSA 4UYGA 4LYIA 5E3DA 5HQ5A 3P1CA 3K2JA 5DY7A 3G0LA 5HJCA 4NQNA 4YC9A 4PCEA 5CPEA 4IR3A 4TS8A 2RS9B 4UYEA 5FE6A 2YW5A 5AD2A 3NXBA 4WIVA 4NUEA 5FH6A 4A9LA 4UYHA 5AMFA 4PCIA 3JVJA 2OO1A 4N4IA 4CUUA 5A83A 5A7CA 5HLSA 4NXJA 3MULA 5E7DA 4YH4A 2YEMA 5D0CA 5HCLA 5FB1A 5E9KA 4E96A 3IU6A 3U5JA 5F2PA 4BJXA 4BW4A 1E6IA 4OGIA 4OUFA 4Z6IA 4TTEA 4CUPA 4QSWA 4YK0A 4IR5A 4TQNA 4HXKA 4QSPA 4Z1QA 4QYDA 4YYNA 2F6JA 2YDWA 4NR6A 4YYGA 4XY8A 5FH7A 5EVAA 4ALHA 3UVDA 5I83A 5TCMA 4UIUA 3GG3A 5E74A 4MEQA 4NQMA 5C4QA 3LQJA 4QSQA 4QUTA 4UIZA 5DW2A 4DONA 2E3KA 4KV1A 4KV4A 4ALGA 5DYAA 4HBXA 5CQ7A 5C85A 5EA1A 5EISA 5D7XA 4NYXA 3UV4A 5DX4A 4N4GA 4LDFA 4GPJA 5C7NA 5LVRA 2R0SA 4QYLA 2RNYA 5I88A 2FSAA 4HXMA 5FH8A 4Z6HA 4N4FA 1F68A 2L84A 4FLPA 2MJVB 3UV2A 5L97A 4J0SA 4MEPA 4NUCA 5L8TA 4YY4A 5CTLA 2RO1A 5DYXA 5A82A 2NXBA 2LSPB 5HM0A 4QC1A 3TLPA 5IG6A 5A5PA 5C89A 4QR5A 5EPRA 4TZ2A 2YQDA 5CQTA 1EQFA 3P1EA 4UIYA 5ETDA 5E9VA 5F61A 3AADA 3UVXA 4Q0NA 5F36A 2R0YA 5IBNA 3U5KA 2DVQA 5D3RA 4YY6A 5I7YA 5DFCA 5LKUA 4J0RA 4LR6A 5D3NA 5DKDA 2YEKA 5KU3A 5F1HA 4YYJA 4PKLA 4F3IA 2RI7A 4QNSA 5TB6A 4YYIA 5F63A 5FE0A 3MXFA 3UVWA 2H60A 3UW9A 2RFJA 5CQ6A 5CFWA 5CQ3A 3DWYA 4NRAA 5DYUA 4HXNA 1X0JA 2GRCA 4N3WA 3P1FA 3HMEA 5EK9A 5A85A 2D9EA 2YYNA 5CU8A 5D3JA 3QZSA 5D3TA 5D24A 2G4AA 5ENHA 2I7KA 4BW1A 5I1QA 2RNXA 4NRCA 4O7CA 4A9FA 4IR4A 4ZC9A 2KTBB 5KTWA 5LJ1A 5LVQA 4IOQA 5FE8A 5H1TA 4QSTA 5F60A 4A9KA 5KTXA 4LYWA 2E7OA 3MQMA 4QUUA 5KO4A 4CFKA 4Z93A 4YBTA 4YH3A 3JVLA 5F1LA 3O36A 5ENCA 4C66A 4C67A 1WUGA 3O37A 3I3JA 5HELA 5L96A 5IGKA 2R0VA 4QSXA 5FE3A 3FKMX 5D3HA 3Q2EA 4PY6A 4BHWA 4OGJA 5I29A 2DVSA 4QEUA 4UIWA 5FFVA 5EV9A 1JM4B 4MEOA 4YADA 5EWWA 3ONIA 3LQHA 4QSUA 5HQ7A 5LJ0A 5EU1A 3P1DA 4UIVA 3Q2FA 5LUUA 3QZVA 5F3AA 5FE5A 5E9MA 5D3LA 3RCWA 5DLXA 5F62A 5F25A 2L85A 4HBVA 3MUKA 5A5NA 5C87A 3S92A 5EWCA 4UYFB 4O7FA 4X2IA 2DVVA 4HXPA 4QSRA 4TT4A 5KHMA 3D7CA 5G4RA 5H1VA 5EQ1A 3O33A 4KCXA 5EICA 4HXLA 5CS8A 5CQ8A 4XY9A 4MR3A 5HRXA 5D3PA 4CFLA 3O34A 2DWWA 4CUQA 4A9HA 4LRGA 3ZYUA 2DATA 4XYAA 3IU5A 5D3SA 4WHWA 4YYMA 4O7EA 5DKCA 3S91A 4YYKA 2R10A 4MR6A 4TYLA 5EM3A 4AKNA 5HENA 4YATA 5FB0A 3AQAA 2WP1A 5CUAA 5L99A 5ENIA 4CL9A 4QEVA 4RVRA 3HMHA 3MB3A 3LJWA 2OSSA 3LXJA 5CUEA 4LZRA 5D25A 4IR6A 5CQ4A 1WUMA 1ZS5A 4O78A 5H85A 5I7XA 4YYDA 4O71A 5CQAA 5EPSA 4UITA 5L98A 5F5ZA 5II1A 5IGLA 5E73A 4A9OA 5A5OA 5CUGA 5HRVA 4A9NA 5I40A 5HEMA 5CY9A 4O7AA 4N4HA 5E9IA 3U5MA 3O35A 4YBSA 2I8NA 4O7BA 5LKTA 4O72A 4TU4A 5E9YA 3P5OA 5EPBA 4PS5A 5A81A 4BW2A 4QSSA 2D82A 5HRWA 4O76A 2WP2A 4J3IA 4PTBA 5FE1A 5CQ5A 4HXRA 5EP7A 4J1PA 5HFQA 4HBWA 5E9LA 5DBMA 5E0RA 3UVYA 3SVHA 5KTUA 5EWHA 4TZ8A 5ENFA 5HFRA 4YAXA 4QR4A 5ENJA 3U5OA 3MB4A 4NYVA 4HXOA 3U5PA 5EI4A 5AD3A 5BT3A 4UYFA 4NR7A 4LYSA 5K29A 5CZGA 4CUSA 5DYCA 2F6NA 3LQIA 5J0DA 2OUOA 5JWMA 1N72A 4NR5A 4NUDA 4O75A 4NS5A 5CRZA 4YYHA 5ENGA 5FFWA 4IOOA 4A9JA 4HBYA 5FE4A 4UIXA 5CUDA 5ENEA 5CGPA 5L8UA 4QY4A 4LZ2A 4YABA 5E3GA 5LKXA 3JVKA 5ACYA 5DW1A 4ZQLA 5G4SA 4BW3A 5LJ2A 2N9GA 2DVRA 5FE7A 4CLBA 5I80A 4NR8A 5HQ6A 4MR4A 5I89A 5FFYA 4UYDA 5IGNA 4A9MA 4NR4A 5A5RA 4NR9A 4QEWA 3U5LA 4YBMA 3QZTA 5DFDA 4WHUA 5FE9A 4Q0OA 3UV5A 4O70A 4XUAA 5ETBA 4O74A 5FG5A 4QB3A 2RNWA 5IGMA 5BT4A 5EWVA 2YELA 3SVFA 4QBMA 4QC3A 5JI8A 5CP5A 5CRMA 4NYWA 5FG6A 4XUBA 5AMEA 5FE2A 4O77A 5COIA 4NRBA 3SVGA 5I86A 4QSVA 5BT5A 4A9IA 4TU6A 4MENA 2L5EA 5A5SA
chains in the Genus database with same CATH superfamily
5EGUA 2DKWA 4HXSA 1ZKRA 4IORA 5FDZA 3JVMA 4Z1SA 4ZW1A 5A5QA 5FBXA 5EWDA 4MR5A 5C8GA 5CUCA 3HMFA 4CUTA 4TT2A 5DKHA 5ENBA 4QZSA 4QR3A 4LC2A 2E7NA 4TT6A 5H1UA 5DFBA 1JSPB 3G0JA 5II2A 5D26A 5LKZA 4Y03A 3DAIA 5CUBA 3U5NA 4A9EA 4CURA 5IIDA 5DLZA 5FG4A 4LZSA 4UYGA 4LYIA 5E3DA 5HQ5A 3P1CA 3K2JA 5DY7A 3G0LA 5HJCA 4NQNA 4YC9A 4PCEA 5CPEA 4IR3A 4TS8A 2RS9B 4UYEA 5FE6A 2YW5A 5AD2A 3NXBA 4WIVA 4NUEA 5FH6A 4A9LA 4UYHA 5AMFA 4PCIA 3JVJA 2OO1A 4N4IA 4CUUA 5A83A 5A7CA 5HLSA 4NXJA 3MULA 5E7DA 4YH4A 2YEMA 5D0CA 5HCLA 5FB1A 5E9KA 4E96A 3IU6A 3U5JA 5F2PA 4BJXA 4BW4A 1E6IA 4OGIA 4OUFA 4Z6IA 4TTEA 4CUPA 4QSWA 4YK0A 4IR5A 4TQNA 4HXKA 4QSPA 4Z1QA 4QYDA 4YYNA 2F6JA 2YDWA 4NR6A 4YYGA 4XY8A 5FH7A 5EVAA 4ALHA 3UVDA 5I83A 5TCMA 4UIUA 3GG3A 5E74A 4MEQA 4NQMA 5C4QA 3LQJA 4QSQA 4QUTA 4UIZA 5DW2A 4DONA 2E3KA 4KV1A 4KV4A 4ALGA 5DYAA 4HBXA 5CQ7A 5C85A 5EA1A 5EISA 5D7XA 4NYXA 3UV4A 5DX4A 4N4GA 4LDFA 4GPJA 5C7NA 5LVRA 2R0SA 4QYLA 2RNYA 5I88A 2FSAA 4HXMA 5FH8A 4Z6HA 3VKHA 4N4FA 1F68A 2L84A 4FLPA 2MJVB 3UV2A 5L97A 4J0SA 4MEPA 4NUCA 5L8TA 1PUOA 4YY4A 5CTLA 2RO1A 5DYXA 5A82A 2NXBA 2LSPB 5HM0A 4QC1A 3TLPA 4AI6A 5IG6A 5A5PA 5C89A 4QR5A 5EPRA 4TZ2A 2YQDA 5CQTA 1EQFA 3P1EA 4UIYA 5ETDA 5E9VA 5F61A 3AADA 3UVXA 4Q0NA 5F36A 2R0YA 5IBNA 3U5KA 2DVQA 5D3RA 4YY6A 5I7YA 5DFCA 5LKUA 4J0RA 4LR6A 5D3NA 5DKDA 2YEKA 5KU3A 5F1HA 4YYJA 4PKLA 4F3IA 2RI7A 4QNSA 5TB6A 4YYIA 5F63A 5FE0A 3MXFA 3UVWA 2H60A 3UW9A 2RFJA 5CQ6A 5CFWA 5CQ3A 3DWYA 4NRAA 5DYUA 4HXNA 1X0JA 2GRCA 4N3WA 3P1FA 3HMEA 5EK9A 5A85A 2D9EA 2YYNA 5CU8A 5D3JA 3QZSA 5D3TA 5D24A 2G4AA 5ENHA 2I7KA 4BW1A 5I1QA 2RNXA 4NRCA 4O7CA 4A9FA 4IR4A 4ZC9A 2KTBB 5KTWA 5LJ1A 5LVQA 4IOQA 5FE8A 5H1TA 4QSTA 5F60A 4A9KA 5KTXA 4LYWA 2E7OA 3MQMA 4QUUA 5KO4A 4CFKA 4Z93A 2EJNA 4YBTA 4YH3A 3JVLA 5F1LA 3O36A 5ENCA 4C66A 4C67A 1WUGA 3O37A 4AKGA 3I3JA 5HELA 5L96A 5IGKA 2R0VA 4QSXA 5FE3A 3FKMX 5D3HA 3Q2EA 4PY6A 4BHWA 4OGJA 5I29A 2DVSA 4QEUA 4UIWA 5FFVA 5EV9A 1JM4B 4MEOA 4YADA 5EWWA 3ONIA 3LQHA 4QSUA 5HQ7A 5LJ0A 3D1BA 5EU1A 3P1DA 4UIVA 3Q2FA 5LUUA 3QZVA 5F3AA 5FE5A 5E9MA 5D3LA 3RCWA 5DLXA 5F62A 5F25A 2L85A 4HBVA 3MUKA 5A5NA 5C87A 3S92A 5EWCA 4UYFB 4O7FA 4X2IA 2DVVA 4HXPA 3ERRA 4QSRA 4TT4A 5KHMA 3D7CA 5G4RA 5H1VA 5EQ1A 3O33A 4KCXA 5EICA 4HXLA 5CS8A 5CQ8A 4XY9A 4MR3A 5HRXA 5D3PA 4CFLA 3O34A 2DWWA 4CUQA 4A9HA 4LRGA 3ZYUA 2DATA 4XYAA 3IU5A 5D3SA 4WHWA 4YYMA 4O7EA 5DKCA 3S91A 4YYKA 2R10A 4MR6A 4TYLA 5EM3A 4AKNA 5HENA 4YATA 5FB0A 3AQAA 2WP1A 5CUAA 5L99A 5ENIA 4CL9A 4QEVA 4RVRA 3HMHA 3MB3A 3LJWA 2OSSA 3LXJA 5CUEA 4LZRA 5D25A 4IR6A 5CQ4A 1WUMA 1ZS5A 4O78A 5H85A 5I7XA 4YYDA 4O71A 5CQAA 5EPSA 4UITA 5L98A 5F5ZA 5II1A 5IGLA 5E73A 4A9OA 3VKGA 5A5OA 5CUGA 5HRVA 4A9NA 5I40A 5HEMA 5CY9A 4O7AA 4N4HA 5E9IA 3U5MA 3O35A 4YBSA 2I8NA 4O7BA 5LKTA 4O72A 4TU4A 5E9YA 3P5OA 5EPBA 4PS5A 5A81A 4BW2A 4QSSA 2D82A 5HRWA 4O76A 2WP2A 4J3IA 4PTBA 5FE1A 5CQ5A 4HXRA 5EP7A 4J1PA 5HFQA 4HBWA 5E9LA 5DBMA 5E0RA 3UVYA 3SVHA 5KTUA 5EWHA 4TZ8A 5ENFA 5HFRA 4YAXA 4QR4A 5ENJA 3U5OA 3MB4A 4AKIA 4NYVA 4HXOA 3U5PA 5EI4A 5AD3A 5BT3A 4UYFA 4NR7A 4LYSA 5K29A 5CZGA 4CUSA 5DYCA 2F6NA 3LQIA 4AKHA 5J0DA 2OUOA 5JWMA 1N72A 4NR5A 4NUDA 4O75A 4NS5A 5CRZA 4YYHA 5ENGA 5FFWA 4IOOA 4A9JA 4HBYA 5FE4A 4UIXA 5CUDA 5ENEA 5CGPA 5L8UA 4QY4A 4LZ2A 4YABA 5E3GA 5LKXA 3JVKA 5ACYA 5DW1A 4ZQLA 5G4SA 4BW3A 5LJ2A 2N9GA 2DVRA 5FE7A 4CLBA 5I80A 4NR8A 5HQ6A 4MR4A 5I89A 5FFYA 4UYDA 5IGNA 4A9MA 4NR4A 5A5RA 4NR9A 4QEWA 3U5LA 4YBMA 3QZTA 5DFDA 4WHUA 5FE9A 4Q0OA 3UV5A 4O70A 4XUAA 5ETBA 4O74A 5FG5A 4QB3A 2RNWA 5IGMA 5BT4A 5EWVA 2YELA 3SVFA 4QBMA 4QC3A 5JI8A 5CP5A 5CRMA 4NYWA 5FG6A 4XUBA 5AMEA 5FE2A 4O77A 5COIA 4NRBA 3D1DA 3SVGA 5I86A 4QSVA 5BT5A 4A9IA 4TU6A 4MENA 2L5EA 5A5SA
chains in the Genus database with same CATH topology
5EGUA 2DKWA 4HXSA 4IORA 5FDZA 3JVMA 4Z1SA 4ZW1A 5A5QA 5FBXA 5EWDA 4MR5A 5C8GA 5CUCA 3HMFA 4CUTA 4TT2A 5DKHA 5ENBA 4QZSA 4QR3A 4LC2A 2E7NA 4TT6A 5H1UA 5DFBA 1JSPB 3G0JA 5II2A 5D26A 5LKZA 4Y03A 3DAIA 5CUBA 3U5NA 4A9EA 4CURA 5IIDA 5DLZA 5FG4A 4LZSA 4UYGA 4LYIA 5E3DA 5HQ5A 3P1CA 3K2JA 5DY7A 3G0LA 5HJCA 4NQNA 4YC9A 4PCEA 5CPEA 4IR3A 4TS8A 2RS9B 4UYEA 5FE6A 2YW5A 5AD2A 3NXBA 4WIVA 4NUEA 5FH6A 4A9LA 4UYHA 5AMFA 4PCIA 3JVJA 2OO1A 4N4IA 4CUUA 5A83A 5A7CA 5HLSA 4NXJA 3MULA 5E7DA 4YH4A 2YEMA 5D0CA 5HCLA 5FB1A 5E9KA 4E96A 3IU6A 3U5JA 5F2PA 4BJXA 4BW4A 1E6IA 4OGIA 4OUFA 4Z6IA 4TTEA 4CUPA 4QSWA 4YK0A 4IR5A 4TQNA 4HXKA 4QSPA 4Z1QA 4QYDA 4YYNA 2F6JA 2YDWA 4NR6A 4YYGA 4XY8A 5FH7A 5EVAA 4ALHA 3UVDA 5I83A 5TCMA 4UIUA 3GG3A 5E74A 4MEQA 4NQMA 5C4QA 3LQJA 4QSQA 4QUTA 4UIZA 5DW2A 4DONA 2E3KA 4KV1A 4KV4A 4ALGA 5DYAA 4HBXA 5CQ7A 5C85A 5EA1A 5EISA 5D7XA 4NYXA 3UV4A 5DX4A 4N4GA 4LDFA 4GPJA 5C7NA 5LVRA 2R0SA 4QYLA 2RNYA 5I88A 2FSAA 4HXMA 5FH8A 4Z6HA 4N4FA 1F68A 2L84A 4FLPA 2MJVB 3UV2A 5L97A 4J0SA 4MEPA 4NUCA 5L8TA 4YY4A 5CTLA 2RO1A 5DYXA 5A82A 2NXBA 2LSPB 5HM0A 4QC1A 3TLPA 5IG6A 5A5PA 5C89A 4QR5A 5EPRA 4TZ2A 2YQDA 5CQTA 1EQFA 3P1EA 4UIYA 5ETDA 5E9VA 5F61A 3AADA 3UVXA 4Q0NA 5F36A 2R0YA 5IBNA 3U5KA 2DVQA 5D3RA 4YY6A 5I7YA 5DFCA 5LKUA 4J0RA 4LR6A 5D3NA 5DKDA 2YEKA 5KU3A 5F1HA 4YYJA 4PKLA 4F3IA 2RI7A 4QNSA 5TB6A 4YYIA 5F63A 5FE0A 3MXFA 3UVWA 2H60A 3UW9A 2RFJA 5CQ6A 5CFWA 5CQ3A 3DWYA 4NRAA 5DYUA 4HXNA 1X0JA 2GRCA 4N3WA 3P1FA 3HMEA 5EK9A 5A85A 2D9EA 2YYNA 5CU8A 5D3JA 3QZSA 5D3TA 5D24A 2G4AA 5ENHA 2I7KA 4BW1A 5I1QA 2RNXA 4NRCA 4O7CA 4A9FA 4IR4A 4ZC9A 2KTBB 5KTWA 5LJ1A 5LVQA 4IOQA 5FE8A 5H1TA 4QSTA 5F60A 4A9KA 5KTXA 4LYWA 2E7OA 3MQMA 4QUUA 5KO4A 4CFKA 4Z93A 4YBTA 4YH3A 3JVLA 5F1LA 3O36A 5ENCA 4C66A 4C67A 1WUGA 3O37A 3I3JA 5HELA 5L96A 5IGKA 2R0VA 4QSXA 5FE3A 3FKMX 5D3HA 3Q2EA 4PY6A 4BHWA 4OGJA 5I29A 2DVSA 4QEUA 4UIWA 5FFVA 5EV9A 1JM4B 4MEOA 4YADA 5EWWA 3ONIA 3LQHA 4QSUA 5HQ7A 5LJ0A 5EU1A 3P1DA 4UIVA 3Q2FA 5LUUA 3QZVA 5F3AA 5FE5A 5E9MA 5D3LA 3RCWA 5DLXA 5F62A 5F25A 2L85A 4HBVA 3MUKA 5A5NA 5C87A 3S92A 5EWCA 4UYFB 4O7FA 4X2IA 2DVVA 4HXPA 4QSRA 4TT4A 5KHMA 3D7CA 5G4RA 5H1VA 5EQ1A 3O33A 4KCXA 5EICA 4HXLA 5CS8A 5CQ8A 4XY9A 4MR3A 5HRXA 5D3PA 4CFLA 3O34A 2DWWA 4CUQA 4A9HA 4LRGA 3ZYUA 2DATA 4XYAA 3IU5A 5D3SA 4WHWA 4YYMA 4O7EA 5DKCA 3S91A 4YYKA 2R10A 4MR6A 4TYLA 5EM3A 4AKNA 5HENA 4YATA 5FB0A 3AQAA 2WP1A 5CUAA 5L99A 5ENIA 4CL9A 4QEVA 4RVRA 3HMHA 3MB3A 3LJWA 2OSSA 3LXJA 5CUEA 4LZRA 5D25A 4IR6A 5CQ4A 1WUMA 1ZS5A 4O78A 5H85A 5I7XA 4YYDA 4O71A 5CQAA 5EPSA 4UITA 5L98A 5F5ZA 5II1A 5IGLA 5E73A 4A9OA 5A5OA 5CUGA 5HRVA 4A9NA 5I40A 5HEMA 5CY9A 4O7AA 4N4HA 5E9IA 3U5MA 3O35A 4YBSA 2I8NA 4O7BA 5LKTA 4O72A 4TU4A 5E9YA 3P5OA 5EPBA 4PS5A 5A81A 4BW2A 4QSSA 2D82A 5HRWA 4O76A 2WP2A 4J3IA 4PTBA 5FE1A 5CQ5A 4HXRA 5EP7A 4J1PA 5HFQA 4HBWA 5E9LA 5DBMA 5E0RA 3UVYA 3SVHA 5KTUA 5EWHA 4TZ8A 5ENFA 5HFRA 4YAXA 4QR4A 5ENJA 3U5OA 3MB4A 4NYVA 4HXOA 3U5PA 5EI4A 5AD3A 5BT3A 4UYFA 4NR7A 4LYSA 5K29A 5CZGA 4CUSA 5DYCA 2F6NA 3LQIA 5J0DA 2OUOA 5JWMA 1N72A 4NR5A 4NUDA 4O75A 4NS5A 5CRZA 4YYHA 5ENGA 5FFWA 4IOOA 4A9JA 4HBYA 5FE4A 4UIXA 5CUDA 5ENEA 5CGPA 5L8UA 4QY4A 4LZ2A 4YABA 5E3GA 5LKXA 3JVKA 5ACYA 5DW1A 4ZQLA 5G4SA 4BW3A 5LJ2A 2N9GA 2DVRA 5FE7A 4CLBA 5I80A 4NR8A 5HQ6A 4MR4A 5I89A 5FFYA 4UYDA 5IGNA 4A9MA 4NR4A 5A5RA 4NR9A 4QEWA 3U5LA 4YBMA 3QZTA 5DFDA 4WHUA 5FE9A 4Q0OA 3UV5A 4O70A 4XUAA 5ETBA 4O74A 5FG5A 4QB3A 2RNWA 5IGMA 5BT4A 5EWVA 2YELA 3SVFA 4QBMA 4QC3A 5JI8A 5CP5A 5CRMA 4NYWA 5FG6A 4XUBA 5AMEA 5FE2A 4O77A 5COIA 4NRBA 3SVGA 5I86A 4QSVA 5BT5A 4A9IA 4TU6A 4MENA 2L5EA 5A5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EGU A;  2DKW A;  4HXS A;  4IOR A;  5FDZ A;  3JVM A;  4Z1S A;  4ZW1 A;  5A5Q A;  5FBX A;  5EWD A;  4MR5 A;  5C8G A;  5CUC A;  3HMF A;  4CUT A;  4TT2 A;  5DKH A;  5ENB A;  4QZS A;  4QR3 A;  4LC2 A;  2E7N A;  4TT6 A;  5H1U A;  5DFB A;  1JSP B;  3G0J A;  5II2 A;  5D26 A;  5LKZ A;  4Y03 A;  3DAI A;  5CUB A;  3U5N A;  4A9E A;  4CUR A;  5IID A;  5DLZ A;  5FG4 A;  4LZS A;  4UYG A;  4LYI A;  5E3D A;  5HQ5 A;  3P1C A;  3K2J A;  5DY7 A;  3G0L A;  5HJC A;  4NQN A;  4YC9 A;  4PCE A;  5CPE A;  4IR3 A;  4TS8 A;  2RS9 B;  4UYE A;  5FE6 A;  2YW5 A;  5AD2 A;  3NXB A;  4WIV A;  4NUE A;  5FH6 A;  4A9L A;  4UYH A;  5AMF A;  4PCI A;  3JVJ A;  2OO1 A;  4N4I A;  4CUU A;  5A83 A;  5A7C A;  5HLS A;  4NXJ A;  3MUL A;  5E7D A;  4YH4 A;  2YEM A;  5D0C A;  5HCL A;  5FB1 A;  5E9K A;  4E96 A;  3IU6 A;  3U5J A;  5F2P A;  4BJX A;  4BW4 A;  1E6I A;  4OGI A;  4OUF A;  4Z6I A;  4TTE A;  4CUP A;  4QSW A;  4YK0 A;  4IR5 A;  4TQN A;  4HXK A;  4QSP A;  4Z1Q A;  4QYD A;  4YYN A;  2F6J A;  2YDW A;  4NR6 A;  4YYG A;  4XY8 A;  5FH7 A;  5EVA A;  4ALH A;  3UVD A;  5I83 A;  5TCM A;  4UIU A;  3GG3 A;  5E74 A;  4MEQ A;  4NQM A;  5C4Q A;  3LQJ A;  4QSQ A;  4QUT A;  4UIZ A;  5DW2 A;  4DON A;  2E3K A;  4KV1 A;  4KV4 A;  4ALG A;  5DYA A;  4HBX A;  5CQ7 A;  5C85 A;  5EA1 A;  5EIS A;  5D7X A;  4NYX A;  3UV4 A;  5DX4 A;  4N4G A;  4LDF A;  4GPJ A;  5C7N A;  5LVR A;  2R0S A;  4QYL A;  2RNY A;  5I88 A;  2FSA A;  4HXM A;  5FH8 A;  4Z6H A;  4N4F A;  1F68 A;  2L84 A;  4FLP A;  2MJV B;  3UV2 A;  5L97 A;  4J0S A;  4MEP A;  4NUC A;  5L8T A;  4YY4 A;  5CTL A;  2RO1 A;  5DYX A;  5A82 A;  2NXB A;  2LSP B;  5HM0 A;  4QC1 A;  3TLP A;  5IG6 A;  5A5P A;  5C89 A;  4QR5 A;  5EPR A;  4TZ2 A;  2YQD A;  5CQT A;  1EQF A;  3P1E A;  4UIY A;  5ETD A;  5E9V A;  5F61 A;  3AAD A;  3UVX A;  4Q0N A;  5F36 A;  2R0Y A;  5IBN A;  3U5K A;  2DVQ A;  5D3R A;  4YY6 A;  5I7Y A;  5DFC A;  5LKU A;  4J0R A;  4LR6 A;  5D3N A;  5DKD A;  2YEK A;  5KU3 A;  5F1H A;  4YYJ A;  4PKL A;  4F3I A;  2RI7 A;  4QNS A;  5TB6 A;  4YYI A;  5F63 A;  5FE0 A;  3MXF A;  3UVW A;  2H60 A;  3UW9 A;  2RFJ A;  5CQ6 A;  5CFW A;  5CQ3 A;  3DWY A;  4NRA A;  5DYU A;  4HXN A;  1X0J A;  2GRC A;  4N3W A;  3P1F A;  3HME A;  5EK9 A;  5A85 A;  2D9E A;  2YYN A;  5CU8 A;  5D3J A;  3QZS A;  5D3T A;  5D24 A;  2G4A A;  5ENH A;  2I7K A;  4BW1 A;  5I1Q A;  2RNX A;  4NRC A;  4O7C A;  4A9F A;  4IR4 A;  4ZC9 A;  2KTB B;  5KTW A;  5LJ1 A;  5LVQ A;  4IOQ A;  5FE8 A;  5H1T A;  4QST A;  5F60 A;  4A9K A;  5KTX A;  4LYW A;  2E7O A;  3MQM A;  4QUU A;  5KO4 A;  4CFK A;  4Z93 A;  4YBT A;  4YH3 A;  3JVL A;  5F1L A;  3O36 A;  5ENC A;  4C66 A;  4C67 A;  1WUG A;  3O37 A;  3I3J A;  5HEL A;  5L96 A;  5IGK A;  2R0V A;  4QSX A;  5FE3 A;  3FKM X;  5D3H A;  3Q2E A;  4PY6 A;  4BHW A;  4OGJ A;  5I29 A;  2DVS A;  4QEU A;  4UIW A;  5FFV A;  5EV9 A;  1JM4 B;  4MEO A;  4YAD A;  5EWW A;  3ONI A;  3LQH A;  4QSU A;  5HQ7 A;  5LJ0 A;  5EU1 A;  3P1D A;  4UIV A;  3Q2F A;  5LUU A;  3QZV A;  5F3A A;  5FE5 A;  5E9M A;  5D3L A;  3RCW A;  5DLX A;  5F62 A;  5F25 A;  2L85 A;  4HBV A;  3MUK A;  5A5N A;  5C87 A;  3S92 A;  5EWC A;  4UYF B;  4O7F A;  4X2I A;  2DVV A;  4HXP A;  4QSR A;  4TT4 A;  5KHM A;  3D7C A;  5G4R A;  5H1V A;  5EQ1 A;  3O33 A;  4KCX A;  5EIC A;  4HXL A;  5CS8 A;  5CQ8 A;  4XY9 A;  4MR3 A;  5HRX A;  5D3P A;  4CFL A;  3O34 A;  2DWW A;  4CUQ A;  4A9H A;  4LRG A;  3ZYU A;  2DAT A;  4XYA A;  3IU5 A;  5D3S A;  4WHW A;  4YYM A;  4O7E A;  5DKC A;  3S91 A;  4YYK A;  2R10 A;  4MR6 A;  4TYL A;  5EM3 A;  4AKN A;  5HEN A;  4YAT A;  5FB0 A;  3AQA A;  2WP1 A;  5CUA A;  5L99 A;  5ENI A;  4CL9 A;  4QEV A;  4RVR A;  3HMH A;  3MB3 A;  3LJW A;  2OSS A;  3LXJ A;  5CUE A;  4LZR A;  5D25 A;  4IR6 A;  5CQ4 A;  1WUM A;  1ZS5 A;  4O78 A;  5H85 A;  5I7X A;  4YYD A;  4O71 A;  5CQA A;  5EPS A;  4UIT A;  5L98 A;  5F5Z A;  5II1 A;  5IGL A;  5E73 A;  4A9O A;  5A5O A;  5CUG A;  5HRV A;  4A9N A;  5I40 A;  5HEM A;  5CY9 A;  4O7A A;  4N4H A;  5E9I A;  3U5M A;  3O35 A;  4YBS A;  2I8N A;  4O7B A;  5LKT A;  4O72 A;  4TU4 A;  5E9Y A;  3P5O A;  5EPB A;  4PS5 A;  5A81 A;  4BW2 A;  4QSS A;  2D82 A;  5HRW A;  4O76 A;  2WP2 A;  4J3I A;  4PTB A;  5FE1 A;  5CQ5 A;  4HXR A;  5EP7 A;  4J1P A;  5HFQ A;  4HBW A;  5E9L A;  5DBM A;  5E0R A;  3UVY A;  3SVH A;  5KTU A;  5EWH A;  4TZ8 A;  5ENF A;  5HFR A;  4YAX A;  4QR4 A;  5ENJ A;  3U5O A;  3MB4 A;  4NYV A;  4HXO A;  3U5P A;  5EI4 A;  5AD3 A;  5BT3 A;  4UYF A;  4NR7 A;  4LYS A;  5K29 A;  5CZG A;  4CUS A;  5DYC A;  2F6N A;  3LQI A;  5J0D A;  2OUO A;  5JWM A;  1N72 A;  4NR5 A;  4NUD A;  4O75 A;  4NS5 A;  5CRZ A;  4YYH A;  5ENG A;  5FFW A;  4IOO A;  4A9J A;  4HBY A;  5FE4 A;  4UIX A;  5CUD A;  5ENE A;  5CGP A;  5L8U A;  4QY4 A;  4LZ2 A;  4YAB A;  5E3G A;  5LKX A;  3JVK A;  5ACY A;  5DW1 A;  4ZQL A;  5G4S A;  4BW3 A;  5LJ2 A;  2N9G A;  2DVR A;  5FE7 A;  4CLB A;  5I80 A;  4NR8 A;  5HQ6 A;  4MR4 A;  5I89 A;  5FFY A;  4UYD A;  5IGN A;  4A9M A;  4NR4 A;  5A5R A;  4NR9 A;  4QEW A;  3U5L A;  4YBM A;  3QZT A;  5DFD A;  4WHU A;  5FE9 A;  4Q0O A;  3UV5 A;  4O70 A;  4XUA A;  5ETB A;  4O74 A;  5FG5 A;  4QB3 A;  2RNW A;  5IGM A;  5BT4 A;  5EWV A;  2YEL A;  3SVF A;  4QBM A;  4QC3 A;  5JI8 A;  5CP5 A;  5CRM A;  4NYW A;  5FG6 A;  4XUB A;  5AME A;  5FE2 A;  4O77 A;  5COI A;  4NRB A;  3SVG A;  5I86 A;  4QSV A;  5BT5 A;  4A9I A;  4TU6 A;  4MEN A;  2L5E A;  5A5S A; 
#chains in the Genus database with same CATH topology
 5EGU A;  2DKW A;  4HXS A;  1ZKR A;  4IOR A;  5FDZ A;  3JVM A;  4Z1S A;  4ZW1 A;  5A5Q A;  5FBX A;  5EWD A;  4MR5 A;  5C8G A;  5CUC A;  3HMF A;  4CUT A;  4TT2 A;  5DKH A;  5ENB A;  4QZS A;  4QR3 A;  4LC2 A;  2E7N A;  4TT6 A;  5H1U A;  5DFB A;  1JSP B;  3G0J A;  5II2 A;  5D26 A;  5LKZ A;  4Y03 A;  3DAI A;  5CUB A;  3U5N A;  4A9E A;  4CUR A;  5IID A;  5DLZ A;  5FG4 A;  4LZS A;  4UYG A;  4LYI A;  5E3D A;  5HQ5 A;  3P1C A;  3K2J A;  5DY7 A;  3G0L A;  5HJC A;  4NQN A;  4YC9 A;  4PCE A;  5CPE A;  4IR3 A;  4TS8 A;  2RS9 B;  4UYE A;  5FE6 A;  2YW5 A;  5AD2 A;  3NXB A;  4WIV A;  4NUE A;  5FH6 A;  4A9L A;  4UYH A;  5AMF A;  4PCI A;  3JVJ A;  2OO1 A;  4N4I A;  4CUU A;  5A83 A;  5A7C A;  5HLS A;  4NXJ A;  3MUL A;  5E7D A;  4YH4 A;  2YEM A;  5D0C A;  5HCL A;  5FB1 A;  5E9K A;  4E96 A;  3IU6 A;  3U5J A;  5F2P A;  4BJX A;  4BW4 A;  1E6I A;  4OGI A;  4OUF A;  4Z6I A;  4TTE A;  4CUP A;  4QSW A;  4YK0 A;  4IR5 A;  4TQN A;  4HXK A;  4QSP A;  4Z1Q A;  4QYD A;  4YYN A;  2F6J A;  2YDW A;  4NR6 A;  4YYG A;  4XY8 A;  5FH7 A;  5EVA A;  4ALH A;  3UVD A;  5I83 A;  5TCM A;  4UIU A;  3GG3 A;  5E74 A;  4MEQ A;  4NQM A;  5C4Q A;  3LQJ A;  4QSQ A;  4QUT A;  4UIZ A;  5DW2 A;  4DON A;  2E3K A;  4KV1 A;  4KV4 A;  4ALG A;  5DYA A;  4HBX A;  5CQ7 A;  5C85 A;  5EA1 A;  5EIS A;  5D7X A;  4NYX A;  3UV4 A;  5DX4 A;  4N4G A;  4LDF A;  4GPJ A;  5C7N A;  5LVR A;  2R0S A;  4QYL A;  2RNY A;  5I88 A;  2FSA A;  4HXM A;  5FH8 A;  4Z6H A;  3VKH A;  4N4F A;  1F68 A;  2L84 A;  4FLP A;  2MJV B;  3UV2 A;  5L97 A;  4J0S A;  4MEP A;  4NUC A;  5L8T A;  1PUO A;  4YY4 A;  5CTL A;  2RO1 A;  5DYX A;  5A82 A;  2NXB A;  2LSP B;  5HM0 A;  4QC1 A;  3TLP A;  4AI6 A;  5IG6 A;  5A5P A;  5C89 A;  4QR5 A;  5EPR A;  4TZ2 A;  2YQD A;  5CQT A;  1EQF A;  3P1E A;  4UIY A;  5ETD A;  5E9V A;  5F61 A;  3AAD A;  3UVX A;  4Q0N A;  5F36 A;  2R0Y A;  5IBN A;  3U5K A;  2DVQ A;  5D3R A;  4YY6 A;  5I7Y A;  5DFC A;  5LKU A;  4J0R A;  4LR6 A;  5D3N A;  5DKD A;  2YEK A;  5KU3 A;  5F1H A;  4YYJ A;  4PKL A;  4F3I A;  2RI7 A;  4QNS A;  5TB6 A;  4YYI A;  5F63 A;  5FE0 A;  3MXF A;  3UVW A;  2H60 A;  3UW9 A;  2RFJ A;  5CQ6 A;  5CFW A;  5CQ3 A;  3DWY A;  4NRA A;  5DYU A;  4HXN A;  1X0J A;  2GRC A;  4N3W A;  3P1F A;  3HME A;  5EK9 A;  5A85 A;  2D9E A;  2YYN A;  5CU8 A;  5D3J A;  3QZS A;  5D3T A;  5D24 A;  2G4A A;  5ENH A;  2I7K A;  4BW1 A;  5I1Q A;  2RNX A;  4NRC A;  4O7C A;  4A9F A;  4IR4 A;  4ZC9 A;  2KTB B;  5KTW A;  5LJ1 A;  5LVQ A;  4IOQ A;  5FE8 A;  5H1T A;  4QST A;  5F60 A;  4A9K A;  5KTX A;  4LYW A;  2E7O A;  3MQM A;  4QUU A;  5KO4 A;  4CFK A;  4Z93 A;  2EJN A;  4YBT A;  4YH3 A;  3JVL A;  5F1L A;  3O36 A;  5ENC A;  4C66 A;  4C67 A;  1WUG A;  3O37 A;  4AKG A;  3I3J A;  5HEL A;  5L96 A;  5IGK A;  2R0V A;  4QSX A;  5FE3 A;  3FKM X;  5D3H A;  3Q2E A;  4PY6 A;  4BHW A;  4OGJ A;  5I29 A;  2DVS A;  4QEU A;  4UIW A;  5FFV A;  5EV9 A;  1JM4 B;  4MEO A;  4YAD A;  5EWW A;  3ONI A;  3LQH A;  4QSU A;  5HQ7 A;  5LJ0 A;  3D1B A;  5EU1 A;  3P1D A;  4UIV A;  3Q2F A;  5LUU A;  3QZV A;  5F3A A;  5FE5 A;  5E9M A;  5D3L A;  3RCW A;  5DLX A;  5F62 A;  5F25 A;  2L85 A;  4HBV A;  3MUK A;  5A5N A;  5C87 A;  3S92 A;  5EWC A;  4UYF B;  4O7F A;  4X2I A;  2DVV A;  4HXP A;  3ERR A;  4QSR A;  4TT4 A;  5KHM A;  3D7C A;  5G4R A;  5H1V A;  5EQ1 A;  3O33 A;  4KCX A;  5EIC A;  4HXL A;  5CS8 A;  5CQ8 A;  4XY9 A;  4MR3 A;  5HRX A;  5D3P A;  4CFL A;  3O34 A;  2DWW A;  4CUQ A;  4A9H A;  4LRG A;  3ZYU A;  2DAT A;  4XYA A;  3IU5 A;  5D3S A;  4WHW A;  4YYM A;  4O7E A;  5DKC A;  3S91 A;  4YYK A;  2R10 A;  4MR6 A;  4TYL A;  5EM3 A;  4AKN A;  5HEN A;  4YAT A;  5FB0 A;  3AQA A;  2WP1 A;  5CUA A;  5L99 A;  5ENI A;  4CL9 A;  4QEV A;  4RVR A;  3HMH A;  3MB3 A;  3LJW A;  2OSS A;  3LXJ A;  5CUE A;  4LZR A;  5D25 A;  4IR6 A;  5CQ4 A;  1WUM A;  1ZS5 A;  4O78 A;  5H85 A;  5I7X A;  4YYD A;  4O71 A;  5CQA A;  5EPS A;  4UIT A;  5L98 A;  5F5Z A;  5II1 A;  5IGL A;  5E73 A;  4A9O A;  3VKG A;  5A5O A;  5CUG A;  5HRV A;  4A9N A;  5I40 A;  5HEM A;  5CY9 A;  4O7A A;  4N4H A;  5E9I A;  3U5M A;  3O35 A;  4YBS A;  2I8N A;  4O7B A;  5LKT A;  4O72 A;  4TU4 A;  5E9Y A;  3P5O A;  5EPB A;  4PS5 A;  5A81 A;  4BW2 A;  4QSS A;  2D82 A;  5HRW A;  4O76 A;  2WP2 A;  4J3I A;  4PTB A;  5FE1 A;  5CQ5 A;  4HXR A;  5EP7 A;  4J1P A;  5HFQ A;  4HBW A;  5E9L A;  5DBM A;  5E0R A;  3UVY A;  3SVH A;  5KTU A;  5EWH A;  4TZ8 A;  5ENF A;  5HFR A;  4YAX A;  4QR4 A;  5ENJ A;  3U5O A;  3MB4 A;  4AKI A;  4NYV A;  4HXO A;  3U5P A;  5EI4 A;  5AD3 A;  5BT3 A;  4UYF A;  4NR7 A;  4LYS A;  5K29 A;  5CZG A;  4CUS A;  5DYC A;  2F6N A;  3LQI A;  4AKH A;  5J0D A;  2OUO A;  5JWM A;  1N72 A;  4NR5 A;  4NUD A;  4O75 A;  4NS5 A;  5CRZ A;  4YYH A;  5ENG A;  5FFW A;  4IOO A;  4A9J A;  4HBY A;  5FE4 A;  4UIX A;  5CUD A;  5ENE A;  5CGP A;  5L8U A;  4QY4 A;  4LZ2 A;  4YAB A;  5E3G A;  5LKX A;  3JVK A;  5ACY A;  5DW1 A;  4ZQL A;  5G4S A;  4BW3 A;  5LJ2 A;  2N9G A;  2DVR A;  5FE7 A;  4CLB A;  5I80 A;  4NR8 A;  5HQ6 A;  4MR4 A;  5I89 A;  5FFY A;  4UYD A;  5IGN A;  4A9M A;  4NR4 A;  5A5R A;  4NR9 A;  4QEW A;  3U5L A;  4YBM A;  3QZT A;  5DFD A;  4WHU A;  5FE9 A;  4Q0O A;  3UV5 A;  4O70 A;  4XUA A;  5ETB A;  4O74 A;  5FG5 A;  4QB3 A;  2RNW A;  5IGM A;  5BT4 A;  5EWV A;  2YEL A;  3SVF A;  4QBM A;  4QC3 A;  5JI8 A;  5CP5 A;  5CRM A;  4NYW A;  5FG6 A;  4XUB A;  5AME A;  5FE2 A;  4O77 A;  5COI A;  4NRB A;  3D1D A;  3SVG A;  5I86 A;  4QSV A;  5BT5 A;  4A9I A;  4TU6 A;  4MEN A;  2L5E A;  5A5S A; 
#chains in the Genus database with same CATH homology
 5EGU A;  2DKW A;  4HXS A;  4IOR A;  5FDZ A;  3JVM A;  4Z1S A;  4ZW1 A;  5A5Q A;  5FBX A;  5EWD A;  4MR5 A;  5C8G A;  5CUC A;  3HMF A;  4CUT A;  4TT2 A;  5DKH A;  5ENB A;  4QZS A;  4QR3 A;  4LC2 A;  2E7N A;  4TT6 A;  5H1U A;  5DFB A;  1JSP B;  3G0J A;  5II2 A;  5D26 A;  5LKZ A;  4Y03 A;  3DAI A;  5CUB A;  3U5N A;  4A9E A;  4CUR A;  5IID A;  5DLZ A;  5FG4 A;  4LZS A;  4UYG A;  4LYI A;  5E3D A;  5HQ5 A;  3P1C A;  3K2J A;  5DY7 A;  3G0L A;  5HJC A;  4NQN A;  4YC9 A;  4PCE A;  5CPE A;  4IR3 A;  4TS8 A;  2RS9 B;  4UYE A;  5FE6 A;  2YW5 A;  5AD2 A;  3NXB A;  4WIV A;  4NUE A;  5FH6 A;  4A9L A;  4UYH A;  5AMF A;  4PCI A;  3JVJ A;  2OO1 A;  4N4I A;  4CUU A;  5A83 A;  5A7C A;  5HLS A;  4NXJ A;  3MUL A;  5E7D A;  4YH4 A;  2YEM A;  5D0C A;  5HCL A;  5FB1 A;  5E9K A;  4E96 A;  3IU6 A;  3U5J A;  5F2P A;  4BJX A;  4BW4 A;  1E6I A;  4OGI A;  4OUF A;  4Z6I A;  4TTE A;  4CUP A;  4QSW A;  4YK0 A;  4IR5 A;  4TQN A;  4HXK A;  4QSP A;  4Z1Q A;  4QYD A;  4YYN A;  2F6J A;  2YDW A;  4NR6 A;  4YYG A;  4XY8 A;  5FH7 A;  5EVA A;  4ALH A;  3UVD A;  5I83 A;  5TCM A;  4UIU A;  3GG3 A;  5E74 A;  4MEQ A;  4NQM A;  5C4Q A;  3LQJ A;  4QSQ A;  4QUT A;  4UIZ A;  5DW2 A;  4DON A;  2E3K A;  4KV1 A;  4KV4 A;  4ALG A;  5DYA A;  4HBX A;  5CQ7 A;  5C85 A;  5EA1 A;  5EIS A;  5D7X A;  4NYX A;  3UV4 A;  5DX4 A;  4N4G A;  4LDF A;  4GPJ A;  5C7N A;  5LVR A;  2R0S A;  4QYL A;  2RNY A;  5I88 A;  2FSA A;  4HXM A;  5FH8 A;  4Z6H A;  4N4F A;  1F68 A;  2L84 A;  4FLP A;  2MJV B;  3UV2 A;  5L97 A;  4J0S A;  4MEP A;  4NUC A;  5L8T A;  4YY4 A;  5CTL A;  2RO1 A;  5DYX A;  5A82 A;  2NXB A;  2LSP B;  5HM0 A;  4QC1 A;  3TLP A;  5IG6 A;  5A5P A;  5C89 A;  4QR5 A;  5EPR A;  4TZ2 A;  2YQD A;  5CQT A;  1EQF A;  3P1E A;  4UIY A;  5ETD A;  5E9V A;  5F61 A;  3AAD A;  3UVX A;  4Q0N A;  5F36 A;  2R0Y A;  5IBN A;  3U5K A;  2DVQ A;  5D3R A;  4YY6 A;  5I7Y A;  5DFC A;  5LKU A;  4J0R A;  4LR6 A;  5D3N A;  5DKD A;  2YEK A;  5KU3 A;  5F1H A;  4YYJ A;  4PKL A;  4F3I A;  2RI7 A;  4QNS A;  5TB6 A;  4YYI A;  5F63 A;  5FE0 A;  3MXF A;  3UVW A;  2H60 A;  3UW9 A;  2RFJ A;  5CQ6 A;  5CFW A;  5CQ3 A;  3DWY A;  4NRA A;  5DYU A;  4HXN A;  1X0J A;  2GRC A;  4N3W A;  3P1F A;  3HME A;  5EK9 A;  5A85 A;  2D9E A;  2YYN A;  5CU8 A;  5D3J A;  3QZS A;  5D3T A;  5D24 A;  2G4A A;  5ENH A;  2I7K A;  4BW1 A;  5I1Q A;  2RNX A;  4NRC A;  4O7C A;  4A9F A;  4IR4 A;  4ZC9 A;  2KTB B;  5KTW A;  5LJ1 A;  5LVQ A;  4IOQ A;  5FE8 A;  5H1T A;  4QST A;  5F60 A;  4A9K A;  5KTX A;  4LYW A;  2E7O A;  3MQM A;  4QUU A;  5KO4 A;  4CFK A;  4Z93 A;  4YBT A;  4YH3 A;  3JVL A;  5F1L A;  3O36 A;  5ENC A;  4C66 A;  4C67 A;  1WUG A;  3O37 A;  3I3J A;  5HEL A;  5L96 A;  5IGK A;  2R0V A;  4QSX A;  5FE3 A;  3FKM X;  5D3H A;  3Q2E A;  4PY6 A;  4BHW A;  4OGJ A;  5I29 A;  2DVS A;  4QEU A;  4UIW A;  5FFV A;  5EV9 A;  1JM4 B;  4MEO A;  4YAD A;  5EWW A;  3ONI A;  3LQH A;  4QSU A;  5HQ7 A;  5LJ0 A;  5EU1 A;  3P1D A;  4UIV A;  3Q2F A;  5LUU A;  3QZV A;  5F3A A;  5FE5 A;  5E9M A;  5D3L A;  3RCW A;  5DLX A;  5F62 A;  5F25 A;  2L85 A;  4HBV A;  3MUK A;  5A5N A;  5C87 A;  3S92 A;  5EWC A;  4UYF B;  4O7F A;  4X2I A;  2DVV A;  4HXP A;  4QSR A;  4TT4 A;  5KHM A;  3D7C A;  5G4R A;  5H1V A;  5EQ1 A;  3O33 A;  4KCX A;  5EIC A;  4HXL A;  5CS8 A;  5CQ8 A;  4XY9 A;  4MR3 A;  5HRX A;  5D3P A;  4CFL A;  3O34 A;  2DWW A;  4CUQ A;  4A9H A;  4LRG A;  3ZYU A;  2DAT A;  4XYA A;  3IU5 A;  5D3S A;  4WHW A;  4YYM A;  4O7E A;  5DKC A;  3S91 A;  4YYK A;  2R10 A;  4MR6 A;  4TYL A;  5EM3 A;  4AKN A;  5HEN A;  4YAT A;  5FB0 A;  3AQA A;  2WP1 A;  5CUA A;  5L99 A;  5ENI A;  4CL9 A;  4QEV A;  4RVR A;  3HMH A;  3MB3 A;  3LJW A;  2OSS A;  3LXJ A;  5CUE A;  4LZR A;  5D25 A;  4IR6 A;  5CQ4 A;  1WUM A;  1ZS5 A;  4O78 A;  5H85 A;  5I7X A;  4YYD A;  4O71 A;  5CQA A;  5EPS A;  4UIT A;  5L98 A;  5F5Z A;  5II1 A;  5IGL A;  5E73 A;  4A9O A;  5A5O A;  5CUG A;  5HRV A;  4A9N A;  5I40 A;  5HEM A;  5CY9 A;  4O7A A;  4N4H A;  5E9I A;  3U5M A;  3O35 A;  4YBS A;  2I8N A;  4O7B A;  5LKT A;  4O72 A;  4TU4 A;  5E9Y A;  3P5O A;  5EPB A;  4PS5 A;  5A81 A;  4BW2 A;  4QSS A;  2D82 A;  5HRW A;  4O76 A;  2WP2 A;  4J3I A;  4PTB A;  5FE1 A;  5CQ5 A;  4HXR A;  5EP7 A;  4J1P A;  5HFQ A;  4HBW A;  5E9L A;  5DBM A;  5E0R A;  3UVY A;  3SVH A;  5KTU A;  5EWH A;  4TZ8 A;  5ENF A;  5HFR A;  4YAX A;  4QR4 A;  5ENJ A;  3U5O A;  3MB4 A;  4NYV A;  4HXO A;  3U5P A;  5EI4 A;  5AD3 A;  5BT3 A;  4UYF A;  4NR7 A;  4LYS A;  5K29 A;  5CZG A;  4CUS A;  5DYC A;  2F6N A;  3LQI A;  5J0D A;  2OUO A;  5JWM A;  1N72 A;  4NR5 A;  4NUD A;  4O75 A;  4NS5 A;  5CRZ A;  4YYH A;  5ENG A;  5FFW A;  4IOO A;  4A9J A;  4HBY A;  5FE4 A;  4UIX A;  5CUD A;  5ENE A;  5CGP A;  5L8U A;  4QY4 A;  4LZ2 A;  4YAB A;  5E3G A;  5LKX A;  3JVK A;  5ACY A;  5DW1 A;  4ZQL A;  5G4S A;  4BW3 A;  5LJ2 A;  2N9G A;  2DVR A;  5FE7 A;  4CLB A;  5I80 A;  4NR8 A;  5HQ6 A;  4MR4 A;  5I89 A;  5FFY A;  4UYD A;  5IGN A;  4A9M A;  4NR4 A;  5A5R A;  4NR9 A;  4QEW A;  3U5L A;  4YBM A;  3QZT A;  5DFD A;  4WHU A;  5FE9 A;  4Q0O A;  3UV5 A;  4O70 A;  4XUA A;  5ETB A;  4O74 A;  5FG5 A;  4QB3 A;  2RNW A;  5IGM A;  5BT4 A;  5EWV A;  2YEL A;  3SVF A;  4QBM A;  4QC3 A;  5JI8 A;  5CP5 A;  5CRM A;  4NYW A;  5FG6 A;  4XUB A;  5AME A;  5FE2 A;  4O77 A;  5COI A;  4NRB A;  3SVG A;  5I86 A;  4QSV A;  5BT5 A;  4A9I A;  4TU6 A;  4MEN A;  2L5E A;  5A5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...