5ENCA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with n-(2,6-dichlorobenzyl)acetamide (sgc - diamond i04-1 fragment screening)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5encA00
5FG4A 4QR4A 5HJCA 4YH4A 5FB0A 5DLZA 5F36A 4O78A 3S91A 4KV4A 2I7KA 4O7AA 5D3PA 5CFWA 3TLPA 5J0DA 2WP2A 5I29A 4NR6A 4NR9A 5CQAA 5FE5A 1E6IA 4XUBA 5ENEA 3O36A 5CQ8A 5FBXA 5C8GA 4TYLA 5G4SA 2L85A 1JM4B 2YW5A 4O72A 2RNWA 5KTUA 4A9EA 5C87A 5HFRA 5KTXA 4YYHA 2E7OA 5TCMA 4HXMA 4KCXA 5D3TA 5E7DA 4YABA 3QZVA 2R0YA 4GPJA 4A9NA 4BW4A 4UITA 4O7EA 4TT2A 4LZSA 4N4HA 5FH7A 4YYDA 4QSWA 5EPBA 5JWMA 5IIDA 5ACYA 4QB3A 4IR5A 3AQAA 1WUMA 5C4QA 5DFDA 5CGPA 4ZQLA 3UVWA 4F3IA 1X0JA 4NQMA 5D3LA 4A9OA 5DYUA 1JSPB 3JVKA 5AD3A 5DKDA 5I80A 2R0VA 5CZGA 4A9HA 5C85A 3HMHA 5F5ZA 2YEMA 4UYFA 4NUDA 5A5SA 5E74A 5H1VA 4HBWA 2FSAA 5FE6A 4YYJA 5EWHA 2KTBB 5CQ5A 3UV2A 4CUPA 4O7CA 1WUGA 5E9IA 5FFYA 3U5MA 4XY9A 5EGUA 5DFCA 2E3KA 4WHWA 4NS5A 4UYFB 4O7FA 4WIVA 4Z6HA 4O71A 2L5EA 5EWWA 2G4AA 5KO4A 3JVJA 4LZ2A 2R10A 4FLPA 3DWYA 5F3AA 4Y03A 5F2PA 4HXLA 4LZRA 3O34A 4O75A 5COIA 5FE8A 4WHUA 5ETBA 5I86A 5EICA 4A9FA 5A5QA 4UIXA 4Z1SA 5CUGA 5CPEA 4QR5A 4TT4A 5I7YA 4YADA 5F63A 5AMFA 3Q2EA 4NXJA 5D0CA 2N9GA 3ONIA 3LQHA 3U5KA 4CLBA 5IG6A 5II2A 4NUCA 2YQDA 4YYKA 5LKZA 5EU1A 4QEUA 5FH8A 3JVLA 3HMFA 4O74A 5LVQA 5CQ6A 4IORA 4OGJA 4UIUA 2D9EA 4NQNA 4NYXA 5KTWA 2L84A 1F68A 5I83A 2WP1A 4TTEA 5E9VA 2DVRA 4HXPA 4O7BA 5CUBA 3MB4A 2OUOA 4J1PA 4ALGA 5H1UA 5EI4A 4HBXA 2F6NA 5A7CA 5CRZA 5CUEA 5D24A 2E7NA 5FE1A 4O76A 4YAXA 5DFBA 5L98A 3MXFA 4CFLA 2RI7A 4BJXA 5BT3A 5EWVA 5A5OA 5ENFA 4MEOA 3K2JA 4QC3A 4QC1A 5E73A 4NR7A 1N72A 2RNYA 3O37A 5ETDA 4HBYA 4PCEA 2OSSA 5E3GA 4TT6A 4XY8A 4BW1A 4Z1QA 4UYHA 5F60A 5HENA 4CUTA 4OUFA 4DONA 5HEMA 5HQ7A 4N4FA 5DKCA 4YBSA 5I40A 4A9IA 4CFKA 4YYIA 4LYSA 4C66A 5A5NA 5D3NA 4LYWA 5F1HA 5CY9A 5EISA 5TB6A 2DVSA 3MQMA 4PKLA 4UIWA 4NRCA 5E9KA 4NRAA 4QSQA 4YK0A 4CUQA 2I8NA 2H60A 3ZYUA 3QZSA 5FG5A 5IGKA 4NR4A 3P5OA 3QZTA 5HFQA 4CUUA 5EM3A 4ZC9A 5AMEA 3UW9A 5L97A 5I7XA 5L8TA 5DW2A 5F62A 5E3DA 4BHWA 4IR3A 2GRCA 4UIZA 4XUAA 5EA1A 4LR6A 2DVVA 2RS9B 5LVRA 4QEVA 4IR4A 5DW1A 5E9MA 3GG3A 4HBVA 5HQ6A 2OO1A 4MEQA 5D26A 3P1CA 4QSSA 3UV4A 5F25A 3LXJA 5DYXA 4YY4A 5I89A 2LSPB 4QSUA 5A5RA 4Q0OA 5FFWA 2RNXA 5D3RA 4A9MA 5I88A 5JI8A 4YATA 5CP5A 4NYVA 5DKHA 3SVFA 5BT4A 5H1TA 4MR5A 5ENGA 5CQTA 5F1LA 5CUDA 3AADA 4BW2A 4UIYA 3U5OA 4QZSA 4J0RA 4RVRA 5EQ1A 5LKTA 5EWCA 5IGMA 3G0LA 4LRGA 5E9LA 5E9YA 5I1QA 4PY6A 4TU6A 5EVAA 5F61A 5CTLA 4PTBA 5KU3A 5CU8A 5LKXA 4QSXA 3UVYA 4MENA 5HRWA 4N4IA 3IU6A 4NRBA 3IU5A 4XYAA 3MB3A 5A82A 4ALHA 4X2IA 4CL9A 4N4GA 4LDFA 5IBNA 2F6JA 2DWWA 4PCIA 5D25A 4OGIA 4CURA 5D3HA 3RCWA 4YBMA 4YY6A 4PS5A 5ENCA 3P1DA 2YEKA 5DX4A 3MULA 5K29A 4QUTA 4TQNA 4QYLA 1EQFA 4HXSA 4QSRA 5CRMA 3SVHA 5CQ7A 3LQJA 3LQIA 5EP7A 5FE2A 5II1A 4J0SA 5CQ3A 4J3IA 5CUAA 4Q0NA 5FE0A 3O33A 5EPRA 5IGNA 5D3JA 4TZ8A 4UYGA 2NXBA 4QEWA 3D7CA 4UYEA 5DBMA 4IOQA 5FB1A 4Z6IA 3I3JA 4O77A 4TS8A 5G4RA 5A83A 5FE7A 1ZS5A 5EV9A 3NXBA 3DAIA 5FDZA 5EPSA 5LJ2A 5FG6A 2DATA 4NR5A 4QYDA 3U5NA 4N3WA 5D7XA 4QNSA 2R0SA 4MR4A 2YDWA 4YYGA 3S92A 3UV5A 3JVMA 3U5JA 4QY4A 4ZW1A 2DKWA 3O35A 5CUCA 4QR3A 3P1FA 4A9LA 5FH6A 5E0RA 4HXNA 4MEPA 5LKUA 3Q2FA 5DLXA 5DYCA 3G0JA 4E96A 4QBMA 4LYIA 4MR6A 5D3SA 5HLSA 4NYWA 5LUUA 5HRXA 5CS8A 4BW3A 4YBTA 4YH3A 5DY7A 3P1EA 3SVGA 5BT5A 3U5PA 4QSVA 5EK9A 4UYDA 5FE9A 5L8UA 4O70A 4C67A 5HCLA 5L96A 5HELA 4TU4A 4NR8A 2RO1A 5LJ0A 4HXRA 4YYNA 5AD2A 4A9JA 5CQ4A 5KHMA 5L99A 2YYNA 4Z93A 2YELA 4NUEA 3FKMX 5ENIA 5A81A 4MR3A 4QSTA 4QUUA 5ENJA 5FFVA 3LJWA 5HQ5A 4A9KA 3MUKA 5C7NA 5FE4A 5C89A 5HM0A 5H85A 4AKNA 2DVQA 4LC2A 2MJVB 2RFJA 2D82A 4KV1A 5FE3A 3UVXA 4HXKA 5A85A 5LJ1A 5ENBA 5DYAA 4CUSA 4IOOA 5ENHA 5IGLA 4YYMA 4HXOA 3HMEA 4UIVA 4QSPA 3U5LA 5EWDA 4TZ2A 5HRVA 4YC9A 4IR6A 5A5PA 3UVDA
chains in the Genus database with same CATH superfamily
5FG4A 4QR4A 4AI6A 5HJCA 4YH4A 5FB0A 3VKGA 5DLZA 5F36A 4O78A 3S91A 4KV4A 2I7KA 4O7AA 5D3PA 5CFWA 3TLPA 5J0DA 2WP2A 5I29A 4NR6A 4NR9A 5CQAA 5FE5A 1E6IA 4XUBA 5ENEA 3O36A 5CQ8A 5FBXA 5C8GA 4TYLA 5G4SA 2L85A 1JM4B 2YW5A 4O72A 2RNWA 5KTUA 4A9EA 5C87A 5HFRA 5KTXA 4YYHA 2E7OA 5TCMA 4HXMA 4KCXA 5D3TA 5E7DA 4YABA 3QZVA 2R0YA 4GPJA 4A9NA 4BW4A 4UITA 4O7EA 4TT2A 4LZSA 4N4HA 5FH7A 4YYDA 4QSWA 3D1BA 5EPBA 5JWMA 5IIDA 5ACYA 4QB3A 4IR5A 3AQAA 1WUMA 5C4QA 5DFDA 5CGPA 4ZQLA 3UVWA 4F3IA 1X0JA 4NQMA 5D3LA 4A9OA 5DYUA 1JSPB 3JVKA 5AD3A 5DKDA 5I80A 2R0VA 5CZGA 4A9HA 5C85A 3HMHA 5F5ZA 2YEMA 4UYFA 4NUDA 5A5SA 5E74A 5H1VA 4HBWA 2FSAA 5FE6A 4YYJA 5EWHA 2KTBB 5CQ5A 3UV2A 4CUPA 4O7CA 1WUGA 5E9IA 5FFYA 3U5MA 4XY9A 5EGUA 5DFCA 2E3KA 4WHWA 4NS5A 4UYFB 4O7FA 4WIVA 4Z6HA 4O71A 2L5EA 5EWWA 2G4AA 5KO4A 3JVJA 4LZ2A 2R10A 4FLPA 3DWYA 5F3AA 4Y03A 5F2PA 4HXLA 4LZRA 3O34A 4O75A 5COIA 5FE8A 4WHUA 5ETBA 5I86A 5EICA 4A9FA 5A5QA 4UIXA 4Z1SA 5CUGA 5CPEA 4QR5A 4TT4A 5I7YA 4YADA 5F63A 5AMFA 3Q2EA 4NXJA 5D0CA 2N9GA 3ONIA 3LQHA 3U5KA 4CLBA 5IG6A 5II2A 4NUCA 2YQDA 4YYKA 5LKZA 5EU1A 4QEUA 5FH8A 3JVLA 3HMFA 4O74A 5LVQA 5CQ6A 4IORA 4OGJA 4UIUA 2D9EA 4NQNA 4NYXA 3D1DA 5KTWA 2L84A 1F68A 5I83A 2WP1A 4TTEA 5E9VA 2DVRA 4HXPA 4O7BA 5CUBA 3MB4A 2OUOA 4J1PA 4ALGA 5H1UA 5EI4A 4AKHA 4HBXA 2F6NA 5A7CA 5CRZA 5CUEA 5D24A 2E7NA 5FE1A 4O76A 4YAXA 5DFBA 5L98A 3MXFA 4CFLA 2RI7A 4BJXA 5BT3A 5EWVA 5A5OA 5ENFA 4MEOA 3K2JA 4QC3A 4QC1A 5E73A 4NR7A 1N72A 2RNYA 3O37A 5ETDA 4HBYA 4PCEA 2OSSA 5E3GA 4TT6A 4XY8A 4BW1A 4Z1QA 4UYHA 5F60A 5HENA 4CUTA 4OUFA 4DONA 5HEMA 5HQ7A 4N4FA 5DKCA 4YBSA 5I40A 4A9IA 4CFKA 4YYIA 4LYSA 4C66A 5A5NA 5D3NA 4LYWA 5F1HA 5CY9A 5EISA 5TB6A 2DVSA 3MQMA 4PKLA 4UIWA 4NRCA 5E9KA 4NRAA 4QSQA 4YK0A 4CUQA 2I8NA 2H60A 3ZYUA 3QZSA 5FG5A 5IGKA 4NR4A 3P5OA 3QZTA 5HFQA 4CUUA 5EM3A 4ZC9A 5AMEA 3UW9A 5L97A 5I7XA 5L8TA 5DW2A 5F62A 5E3DA 4BHWA 4IR3A 2GRCA 4UIZA 4XUAA 5EA1A 4LR6A 2DVVA 2RS9B 5LVRA 4QEVA 4IR4A 5DW1A 5E9MA 3GG3A 4HBVA 5HQ6A 2OO1A 4MEQA 5D26A 3P1CA 3ERRA 4QSSA 3UV4A 5F25A 3LXJA 5DYXA 4YY4A 5I89A 2LSPB 4QSUA 5A5RA 4Q0OA 5FFWA 2RNXA 4AKGA 5D3RA 4A9MA 5I88A 5JI8A 4YATA 5CP5A 4NYVA 5DKHA 3SVFA 5BT4A 5H1TA 4MR5A 5ENGA 5CQTA 5F1LA 5CUDA 3AADA 4BW2A 4UIYA 3U5OA 4QZSA 4J0RA 4RVRA 5EQ1A 5LKTA 5EWCA 5IGMA 3G0LA 4LRGA 5E9LA 5E9YA 5I1QA 4PY6A 3UVDA 4TU6A 5EVAA 5F61A 5CTLA 4PTBA 5KU3A 5CU8A 5LKXA 4QSXA 3UVYA 4MENA 5HRWA 4N4IA 3IU6A 4NRBA 3IU5A 4XYAA 3MB3A 5A82A 4ALHA 4X2IA 4CL9A 4N4GA 4LDFA 5IBNA 2F6JA 2DWWA 4PCIA 5D25A 4OGIA 4CURA 5D3HA 3RCWA 4YBMA 4YY6A 4PS5A 5ENCA 3P1DA 2YEKA 5DX4A 3MULA 5K29A 4QUTA 4TQNA 4QYLA 1EQFA 4HXSA 4QSRA 5CRMA 3SVHA 5CQ7A 3LQJA 3LQIA 5EP7A 5FE2A 5II1A 4J0SA 5CQ3A 4J3IA 5CUAA 4Q0NA 1ZKRA 5FE0A 3O33A 5EPRA 5IGNA 5D3JA 4TZ8A 4UYGA 2NXBA 4QEWA 3D7CA 4UYEA 4AKIA 5DBMA 4IOQA 5FB1A 4Z6IA 3I3JA 4O77A 4TS8A 5G4RA 5A83A 5FE7A 1ZS5A 5EV9A 3NXBA 3DAIA 5FDZA 5EPSA 5LJ2A 5FG6A 2DATA 4NR5A 4QYDA 3U5NA 4N3WA 5D7XA 4QNSA 2R0SA 4MR4A 2YDWA 4YYGA 3S92A 3UV5A 3JVMA 3U5JA 1PUOA 4QY4A 4ZW1A 2DKWA 3O35A 5CUCA 4QR3A 3P1FA 4A9LA 5FH6A 5E0RA 4HXNA 4MEPA 5LKUA 3Q2FA 5DLXA 5DYCA 3G0JA 4E96A 4QBMA 4LYIA 4MR6A 5D3SA 5HLSA 4NYWA 5LUUA 5HRXA 5CS8A 4BW3A 4YBTA 4YH3A 5DY7A 3P1EA 3SVGA 5BT5A 3U5PA 4QSVA 5EK9A 4UYDA 5FE9A 5L8UA 4O70A 4C67A 5HCLA 5L96A 5HELA 4TU4A 4NR8A 2RO1A 5LJ0A 4HXRA 4YYNA 5AD2A 4A9JA 5CQ4A 5KHMA 5L99A 2YYNA 4Z93A 2YELA 4NUEA 3FKMX 5ENIA 5A81A 4MR3A 4QSTA 4QUUA 5ENJA 5FFVA 3LJWA 5HQ5A 4A9KA 3MUKA 5C7NA 5FE4A 5C89A 5HM0A 5H85A 4AKNA 2DVQA 4LC2A 2MJVB 2RFJA 2D82A 4KV1A 3VKHA 5FE3A 3UVXA 4HXKA 5A85A 5LJ1A 5ENBA 5DYAA 4CUSA 4IOOA 5ENHA 5IGLA 4YYMA 4HXOA 3HMEA 4UIVA 4QSPA 3U5LA 5EWDA 4TZ2A 5HRVA 4YC9A 4IR6A 5A5PA 2EJNA
chains in the Genus database with same CATH topology
5FG4A 4QR4A 5HJCA 4YH4A 5FB0A 5DLZA 5F36A 4O78A 3S91A 4KV4A 2I7KA 4O7AA 5D3PA 5CFWA 3TLPA 5J0DA 2WP2A 5I29A 4NR6A 4NR9A 5CQAA 5FE5A 1E6IA 4XUBA 5ENEA 3O36A 5CQ8A 5FBXA 5C8GA 4TYLA 5G4SA 2L85A 1JM4B 2YW5A 4O72A 2RNWA 5KTUA 4A9EA 5C87A 5HFRA 5KTXA 4YYHA 2E7OA 5TCMA 4HXMA 4KCXA 5D3TA 5E7DA 4YABA 3QZVA 2R0YA 4GPJA 4A9NA 4BW4A 4UITA 4O7EA 4TT2A 4LZSA 4N4HA 5FH7A 4YYDA 4QSWA 5EPBA 5JWMA 5IIDA 5ACYA 4QB3A 4IR5A 3AQAA 1WUMA 5C4QA 5DFDA 5CGPA 4ZQLA 3UVWA 4F3IA 1X0JA 4NQMA 5D3LA 4A9OA 5DYUA 1JSPB 3JVKA 5AD3A 5DKDA 5I80A 2R0VA 5CZGA 4A9HA 5C85A 3HMHA 5F5ZA 2YEMA 4UYFA 4NUDA 5A5SA 5E74A 5H1VA 4HBWA 2FSAA 5FE6A 4YYJA 5EWHA 2KTBB 5CQ5A 3UV2A 4CUPA 4O7CA 1WUGA 5E9IA 5FFYA 3U5MA 4XY9A 5EGUA 5DFCA 2E3KA 4WHWA 4NS5A 4UYFB 4O7FA 4WIVA 4Z6HA 4O71A 2L5EA 5EWWA 2G4AA 5KO4A 3JVJA 4LZ2A 2R10A 4FLPA 3DWYA 5F3AA 4Y03A 5F2PA 4HXLA 4LZRA 3O34A 4O75A 5COIA 5FE8A 4WHUA 5ETBA 5I86A 5EICA 4A9FA 5A5QA 4UIXA 4Z1SA 5CUGA 5CPEA 4QR5A 4TT4A 5I7YA 4YADA 5F63A 5AMFA 3Q2EA 4NXJA 5D0CA 2N9GA 3ONIA 3LQHA 3U5KA 4CLBA 5IG6A 5II2A 4NUCA 2YQDA 4YYKA 5LKZA 5EU1A 4QEUA 5FH8A 3JVLA 3HMFA 4O74A 5LVQA 5CQ6A 4IORA 4OGJA 4UIUA 2D9EA 4NQNA 4NYXA 5KTWA 2L84A 1F68A 5I83A 2WP1A 4TTEA 5E9VA 2DVRA 4HXPA 4O7BA 5CUBA 3MB4A 2OUOA 4J1PA 4ALGA 5H1UA 5EI4A 4HBXA 2F6NA 5A7CA 5CRZA 5CUEA 5D24A 2E7NA 5FE1A 4O76A 4YAXA 5DFBA 5L98A 3MXFA 4CFLA 2RI7A 4BJXA 5BT3A 5EWVA 5A5OA 5ENFA 4MEOA 3K2JA 4QC3A 4QC1A 5E73A 4NR7A 1N72A 2RNYA 3O37A 5ETDA 4HBYA 4PCEA 2OSSA 5E3GA 4TT6A 4XY8A 4BW1A 4Z1QA 4UYHA 5F60A 5HENA 4CUTA 4OUFA 4DONA 5HEMA 5HQ7A 4N4FA 5DKCA 4YBSA 5I40A 4A9IA 4CFKA 4YYIA 4LYSA 4C66A 5A5NA 5D3NA 4LYWA 5F1HA 5CY9A 5EISA 5TB6A 2DVSA 3MQMA 4PKLA 4UIWA 4NRCA 5E9KA 4NRAA 4QSQA 4YK0A 4CUQA 2I8NA 2H60A 3ZYUA 3QZSA 5FG5A 5IGKA 4NR4A 3P5OA 3QZTA 5HFQA 4CUUA 5EM3A 4ZC9A 5AMEA 3UW9A 5L97A 5I7XA 5L8TA 5DW2A 5F62A 5E3DA 4BHWA 4IR3A 2GRCA 4UIZA 4XUAA 5EA1A 4LR6A 2DVVA 2RS9B 5LVRA 4QEVA 4IR4A 5DW1A 5E9MA 3GG3A 4HBVA 5HQ6A 2OO1A 4MEQA 5D26A 3P1CA 4QSSA 3UV4A 5F25A 3LXJA 5DYXA 4YY4A 5I89A 2LSPB 4QSUA 5A5RA 4Q0OA 5FFWA 2RNXA 5D3RA 4A9MA 5I88A 5JI8A 4YATA 5CP5A 4NYVA 5DKHA 3SVFA 5BT4A 5H1TA 4MR5A 5ENGA 5CQTA 5F1LA 5CUDA 3AADA 4BW2A 4UIYA 3U5OA 4QZSA 4J0RA 4RVRA 5EQ1A 5LKTA 5EWCA 5IGMA 3G0LA 4LRGA 5E9LA 5E9YA 5I1QA 4PY6A 4TU6A 5EVAA 5F61A 5CTLA 4PTBA 5KU3A 5CU8A 5LKXA 4QSXA 3UVYA 4MENA 5HRWA 4N4IA 3IU6A 4NRBA 3IU5A 4XYAA 3MB3A 5A82A 4ALHA 4X2IA 4CL9A 4N4GA 4LDFA 5IBNA 2F6JA 2DWWA 4PCIA 5D25A 4OGIA 4CURA 5D3HA 3RCWA 4YBMA 4YY6A 4PS5A 5ENCA 3P1DA 2YEKA 5DX4A 3MULA 5K29A 4QUTA 4TQNA 4QYLA 1EQFA 4HXSA 4QSRA 5CRMA 3SVHA 5CQ7A 3LQJA 3LQIA 5EP7A 5FE2A 5II1A 4J0SA 5CQ3A 4J3IA 5CUAA 4Q0NA 5FE0A 3O33A 5EPRA 5IGNA 5D3JA 4TZ8A 4UYGA 2NXBA 4QEWA 3D7CA 4UYEA 5DBMA 4IOQA 5FB1A 4Z6IA 3I3JA 4O77A 4TS8A 5G4RA 5A83A 5FE7A 1ZS5A 5EV9A 3NXBA 3DAIA 5FDZA 5EPSA 5LJ2A 5FG6A 2DATA 4NR5A 4QYDA 3U5NA 4N3WA 5D7XA 4QNSA 2R0SA 4MR4A 2YDWA 4YYGA 3S92A 3UV5A 3JVMA 3U5JA 4QY4A 4ZW1A 2DKWA 3O35A 5CUCA 4QR3A 3P1FA 4A9LA 5FH6A 5E0RA 4HXNA 4MEPA 5LKUA 3Q2FA 5DLXA 5DYCA 3G0JA 4E96A 4QBMA 4LYIA 4MR6A 5D3SA 5HLSA 4NYWA 5LUUA 5HRXA 5CS8A 4BW3A 4YBTA 4YH3A 5DY7A 3P1EA 3SVGA 5BT5A 3U5PA 4QSVA 5EK9A 4UYDA 5FE9A 5L8UA 4O70A 4C67A 5HCLA 5L96A 5HELA 4TU4A 4NR8A 2RO1A 5LJ0A 4HXRA 4YYNA 5AD2A 4A9JA 5CQ4A 5KHMA 5L99A 2YYNA 4Z93A 2YELA 4NUEA 3FKMX 5ENIA 5A81A 4MR3A 4QSTA 4QUUA 5ENJA 5FFVA 3LJWA 5HQ5A 4A9KA 3MUKA 5C7NA 5FE4A 5C89A 5HM0A 5H85A 4AKNA 2DVQA 4LC2A 2MJVB 2RFJA 2D82A 4KV1A 5FE3A 3UVXA 4HXKA 5A85A 5LJ1A 5ENBA 5DYAA 4CUSA 4IOOA 5ENHA 5IGLA 4YYMA 4HXOA 3HMEA 4UIVA 4QSPA 3U5LA 5EWDA 4TZ2A 5HRVA 4YC9A 4IR6A 5A5PA 3UVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FG4 A;  4QR4 A;  5HJC A;  4YH4 A;  5FB0 A;  5DLZ A;  5F36 A;  4O78 A;  3S91 A;  4KV4 A;  2I7K A;  4O7A A;  5D3P A;  5CFW A;  3TLP A;  5J0D A;  2WP2 A;  5I29 A;  4NR6 A;  4NR9 A;  5CQA A;  5FE5 A;  1E6I A;  4XUB A;  5ENE A;  3O36 A;  5CQ8 A;  5FBX A;  5C8G A;  4TYL A;  5G4S A;  2L85 A;  1JM4 B;  2YW5 A;  4O72 A;  2RNW A;  5KTU A;  4A9E A;  5C87 A;  5HFR A;  5KTX A;  4YYH A;  2E7O A;  5TCM A;  4HXM A;  4KCX A;  5D3T A;  5E7D A;  4YAB A;  3QZV A;  2R0Y A;  4GPJ A;  4A9N A;  4BW4 A;  4UIT A;  4O7E A;  4TT2 A;  4LZS A;  4N4H A;  5FH7 A;  4YYD A;  4QSW A;  5EPB A;  5JWM A;  5IID A;  5ACY A;  4QB3 A;  4IR5 A;  3AQA A;  1WUM A;  5C4Q A;  5DFD A;  5CGP A;  4ZQL A;  3UVW A;  4F3I A;  1X0J A;  4NQM A;  5D3L A;  4A9O A;  5DYU A;  1JSP B;  3JVK A;  5AD3 A;  5DKD A;  5I80 A;  2R0V A;  5CZG A;  4A9H A;  5C85 A;  3HMH A;  5F5Z A;  2YEM A;  4UYF A;  4NUD A;  5A5S A;  5E74 A;  5H1V A;  4HBW A;  2FSA A;  5FE6 A;  4YYJ A;  5EWH A;  2KTB B;  5CQ5 A;  3UV2 A;  4CUP A;  4O7C A;  1WUG A;  5E9I A;  5FFY A;  3U5M A;  4XY9 A;  5EGU A;  5DFC A;  2E3K A;  4WHW A;  4NS5 A;  4UYF B;  4O7F A;  4WIV A;  4Z6H A;  4O71 A;  2L5E A;  5EWW A;  2G4A A;  5KO4 A;  3JVJ A;  4LZ2 A;  2R10 A;  4FLP A;  3DWY A;  5F3A A;  4Y03 A;  5F2P A;  4HXL A;  4LZR A;  3O34 A;  4O75 A;  5COI A;  5FE8 A;  4WHU A;  5ETB A;  5I86 A;  5EIC A;  4A9F A;  5A5Q A;  4UIX A;  4Z1S A;  5CUG A;  5CPE A;  4QR5 A;  4TT4 A;  5I7Y A;  4YAD A;  5F63 A;  5AMF A;  3Q2E A;  4NXJ A;  5D0C A;  2N9G A;  3ONI A;  3LQH A;  3U5K A;  4CLB A;  5IG6 A;  5II2 A;  4NUC A;  2YQD A;  4YYK A;  5LKZ A;  5EU1 A;  4QEU A;  5FH8 A;  3JVL A;  3HMF A;  4O74 A;  5LVQ A;  5CQ6 A;  4IOR A;  4OGJ A;  4UIU A;  2D9E A;  4NQN A;  4NYX A;  5KTW A;  2L84 A;  1F68 A;  5I83 A;  2WP1 A;  4TTE A;  5E9V A;  2DVR A;  4HXP A;  4O7B A;  5CUB A;  3MB4 A;  2OUO A;  4J1P A;  4ALG A;  5H1U A;  5EI4 A;  4HBX A;  2F6N A;  5A7C A;  5CRZ A;  5CUE A;  5D24 A;  2E7N A;  5FE1 A;  4O76 A;  4YAX A;  5DFB A;  5L98 A;  3MXF A;  4CFL A;  2RI7 A;  4BJX A;  5BT3 A;  5EWV A;  5A5O A;  5ENF A;  4MEO A;  3K2J A;  4QC3 A;  4QC1 A;  5E73 A;  4NR7 A;  1N72 A;  2RNY A;  3O37 A;  5ETD A;  4HBY A;  4PCE A;  2OSS A;  5E3G A;  4TT6 A;  4XY8 A;  4BW1 A;  4Z1Q A;  4UYH A;  5F60 A;  5HEN A;  4CUT A;  4OUF A;  4DON A;  5HEM A;  5HQ7 A;  4N4F A;  5DKC A;  4YBS A;  5I40 A;  4A9I A;  4CFK A;  4YYI A;  4LYS A;  4C66 A;  5A5N A;  5D3N A;  4LYW A;  5F1H A;  5CY9 A;  5EIS A;  5TB6 A;  2DVS A;  3MQM A;  4PKL A;  4UIW A;  4NRC A;  5E9K A;  4NRA A;  4QSQ A;  4YK0 A;  4CUQ A;  2I8N A;  2H60 A;  3ZYU A;  3QZS A;  5FG5 A;  5IGK A;  4NR4 A;  3P5O A;  3QZT A;  5HFQ A;  4CUU A;  5EM3 A;  4ZC9 A;  5AME A;  3UW9 A;  5L97 A;  5I7X A;  5L8T A;  5DW2 A;  5F62 A;  5E3D A;  4BHW A;  4IR3 A;  2GRC A;  4UIZ A;  4XUA A;  5EA1 A;  4LR6 A;  2DVV A;  2RS9 B;  5LVR A;  4QEV A;  4IR4 A;  5DW1 A;  5E9M A;  3GG3 A;  4HBV A;  5HQ6 A;  2OO1 A;  4MEQ A;  5D26 A;  3P1C A;  4QSS A;  3UV4 A;  5F25 A;  3LXJ A;  5DYX A;  4YY4 A;  5I89 A;  2LSP B;  4QSU A;  5A5R A;  4Q0O A;  5FFW A;  2RNX A;  5D3R A;  4A9M A;  5I88 A;  5JI8 A;  4YAT A;  5CP5 A;  4NYV A;  5DKH A;  3SVF A;  5BT4 A;  5H1T A;  4MR5 A;  5ENG A;  5CQT A;  5F1L A;  5CUD A;  3AAD A;  4BW2 A;  4UIY A;  3U5O A;  4QZS A;  4J0R A;  4RVR A;  5EQ1 A;  5LKT A;  5EWC A;  5IGM A;  3G0L A;  4LRG A;  5E9L A;  5E9Y A;  5I1Q A;  4PY6 A;  4TU6 A;  5EVA A;  5F61 A;  5CTL A;  4PTB A;  5KU3 A;  5CU8 A;  5LKX A;  4QSX A;  3UVY A;  4MEN A;  5HRW A;  4N4I A;  3IU6 A;  4NRB A;  3IU5 A;  4XYA A;  3MB3 A;  5A82 A;  4ALH A;  4X2I A;  4CL9 A;  4N4G A;  4LDF A;  5IBN A;  2F6J A;  2DWW A;  4PCI A;  5D25 A;  4OGI A;  4CUR A;  5D3H A;  3RCW A;  4YBM A;  4YY6 A;  4PS5 A;  5ENC A;  3P1D A;  2YEK A;  5DX4 A;  3MUL A;  5K29 A;  4QUT A;  4TQN A;  4QYL A;  1EQF A;  4HXS A;  4QSR A;  5CRM A;  3SVH A;  5CQ7 A;  3LQJ A;  3LQI A;  5EP7 A;  5FE2 A;  5II1 A;  4J0S A;  5CQ3 A;  4J3I A;  5CUA A;  4Q0N A;  5FE0 A;  3O33 A;  5EPR A;  5IGN A;  5D3J A;  4TZ8 A;  4UYG A;  2NXB A;  4QEW A;  3D7C A;  4UYE A;  5DBM A;  4IOQ A;  5FB1 A;  4Z6I A;  3I3J A;  4O77 A;  4TS8 A;  5G4R A;  5A83 A;  5FE7 A;  1ZS5 A;  5EV9 A;  3NXB A;  3DAI A;  5FDZ A;  5EPS A;  5LJ2 A;  5FG6 A;  2DAT A;  4NR5 A;  4QYD A;  3U5N A;  4N3W A;  5D7X A;  4QNS A;  2R0S A;  4MR4 A;  2YDW A;  4YYG A;  3S92 A;  3UV5 A;  3JVM A;  3U5J A;  4QY4 A;  4ZW1 A;  2DKW A;  3O35 A;  5CUC A;  4QR3 A;  3P1F A;  4A9L A;  5FH6 A;  5E0R A;  4HXN A;  4MEP A;  5LKU A;  3Q2F A;  5DLX A;  5DYC A;  3G0J A;  4E96 A;  4QBM A;  4LYI A;  4MR6 A;  5D3S A;  5HLS A;  4NYW A;  5LUU A;  5HRX A;  5CS8 A;  4BW3 A;  4YBT A;  4YH3 A;  5DY7 A;  3P1E A;  3SVG A;  5BT5 A;  3U5P A;  4QSV A;  5EK9 A;  4UYD A;  5FE9 A;  5L8U A;  4O70 A;  4C67 A;  5HCL A;  5L96 A;  5HEL A;  4TU4 A;  4NR8 A;  2RO1 A;  5LJ0 A;  4HXR A;  4YYN A;  5AD2 A;  4A9J A;  5CQ4 A;  5KHM A;  5L99 A;  2YYN A;  4Z93 A;  2YEL A;  4NUE A;  3FKM X;  5ENI A;  5A81 A;  4MR3 A;  4QST A;  4QUU A;  5ENJ A;  5FFV A;  3LJW A;  5HQ5 A;  4A9K A;  3MUK A;  5C7N A;  5FE4 A;  5C89 A;  5HM0 A;  5H85 A;  4AKN A;  2DVQ A;  4LC2 A;  2MJV B;  2RFJ A;  2D82 A;  4KV1 A;  5FE3 A;  3UVX A;  4HXK A;  5A85 A;  5LJ1 A;  5ENB A;  5DYA A;  4CUS A;  4IOO A;  5ENH A;  5IGL A;  4YYM A;  4HXO A;  3HME A;  4UIV A;  4QSP A;  3U5L A;  5EWD A;  4TZ2 A;  5HRV A;  4YC9 A;  4IR6 A;  5A5P A;  3UVD A; 
#chains in the Genus database with same CATH topology
 5FG4 A;  4QR4 A;  4AI6 A;  5HJC A;  4YH4 A;  5FB0 A;  3VKG A;  5DLZ A;  5F36 A;  4O78 A;  3S91 A;  4KV4 A;  2I7K A;  4O7A A;  5D3P A;  5CFW A;  3TLP A;  5J0D A;  2WP2 A;  5I29 A;  4NR6 A;  4NR9 A;  5CQA A;  5FE5 A;  1E6I A;  4XUB A;  5ENE A;  3O36 A;  5CQ8 A;  5FBX A;  5C8G A;  4TYL A;  5G4S A;  2L85 A;  1JM4 B;  2YW5 A;  4O72 A;  2RNW A;  5KTU A;  4A9E A;  5C87 A;  5HFR A;  5KTX A;  4YYH A;  2E7O A;  5TCM A;  4HXM A;  4KCX A;  5D3T A;  5E7D A;  4YAB A;  3QZV A;  2R0Y A;  4GPJ A;  4A9N A;  4BW4 A;  4UIT A;  4O7E A;  4TT2 A;  4LZS A;  4N4H A;  5FH7 A;  4YYD A;  4QSW A;  3D1B A;  5EPB A;  5JWM A;  5IID A;  5ACY A;  4QB3 A;  4IR5 A;  3AQA A;  1WUM A;  5C4Q A;  5DFD A;  5CGP A;  4ZQL A;  3UVW A;  4F3I A;  1X0J A;  4NQM A;  5D3L A;  4A9O A;  5DYU A;  1JSP B;  3JVK A;  5AD3 A;  5DKD A;  5I80 A;  2R0V A;  5CZG A;  4A9H A;  5C85 A;  3HMH A;  5F5Z A;  2YEM A;  4UYF A;  4NUD A;  5A5S A;  5E74 A;  5H1V A;  4HBW A;  2FSA A;  5FE6 A;  4YYJ A;  5EWH A;  2KTB B;  5CQ5 A;  3UV2 A;  4CUP A;  4O7C A;  1WUG A;  5E9I A;  5FFY A;  3U5M A;  4XY9 A;  5EGU A;  5DFC A;  2E3K A;  4WHW A;  4NS5 A;  4UYF B;  4O7F A;  4WIV A;  4Z6H A;  4O71 A;  2L5E A;  5EWW A;  2G4A A;  5KO4 A;  3JVJ A;  4LZ2 A;  2R10 A;  4FLP A;  3DWY A;  5F3A A;  4Y03 A;  5F2P A;  4HXL A;  4LZR A;  3O34 A;  4O75 A;  5COI A;  5FE8 A;  4WHU A;  5ETB A;  5I86 A;  5EIC A;  4A9F A;  5A5Q A;  4UIX A;  4Z1S A;  5CUG A;  5CPE A;  4QR5 A;  4TT4 A;  5I7Y A;  4YAD A;  5F63 A;  5AMF A;  3Q2E A;  4NXJ A;  5D0C A;  2N9G A;  3ONI A;  3LQH A;  3U5K A;  4CLB A;  5IG6 A;  5II2 A;  4NUC A;  2YQD A;  4YYK A;  5LKZ A;  5EU1 A;  4QEU A;  5FH8 A;  3JVL A;  3HMF A;  4O74 A;  5LVQ A;  5CQ6 A;  4IOR A;  4OGJ A;  4UIU A;  2D9E A;  4NQN A;  4NYX A;  3D1D A;  5KTW A;  2L84 A;  1F68 A;  5I83 A;  2WP1 A;  4TTE A;  5E9V A;  2DVR A;  4HXP A;  4O7B A;  5CUB A;  3MB4 A;  2OUO A;  4J1P A;  4ALG A;  5H1U A;  5EI4 A;  4AKH A;  4HBX A;  2F6N A;  5A7C A;  5CRZ A;  5CUE A;  5D24 A;  2E7N A;  5FE1 A;  4O76 A;  4YAX A;  5DFB A;  5L98 A;  3MXF A;  4CFL A;  2RI7 A;  4BJX A;  5BT3 A;  5EWV A;  5A5O A;  5ENF A;  4MEO A;  3K2J A;  4QC3 A;  4QC1 A;  5E73 A;  4NR7 A;  1N72 A;  2RNY A;  3O37 A;  5ETD A;  4HBY A;  4PCE A;  2OSS A;  5E3G A;  4TT6 A;  4XY8 A;  4BW1 A;  4Z1Q A;  4UYH A;  5F60 A;  5HEN A;  4CUT A;  4OUF A;  4DON A;  5HEM A;  5HQ7 A;  4N4F A;  5DKC A;  4YBS A;  5I40 A;  4A9I A;  4CFK A;  4YYI A;  4LYS A;  4C66 A;  5A5N A;  5D3N A;  4LYW A;  5F1H A;  5CY9 A;  5EIS A;  5TB6 A;  2DVS A;  3MQM A;  4PKL A;  4UIW A;  4NRC A;  5E9K A;  4NRA A;  4QSQ A;  4YK0 A;  4CUQ A;  2I8N A;  2H60 A;  3ZYU A;  3QZS A;  5FG5 A;  5IGK A;  4NR4 A;  3P5O A;  3QZT A;  5HFQ A;  4CUU A;  5EM3 A;  4ZC9 A;  5AME A;  3UW9 A;  5L97 A;  5I7X A;  5L8T A;  5DW2 A;  5F62 A;  5E3D A;  4BHW A;  4IR3 A;  2GRC A;  4UIZ A;  4XUA A;  5EA1 A;  4LR6 A;  2DVV A;  2RS9 B;  5LVR A;  4QEV A;  4IR4 A;  5DW1 A;  5E9M A;  3GG3 A;  4HBV A;  5HQ6 A;  2OO1 A;  4MEQ A;  5D26 A;  3P1C A;  3ERR A;  4QSS A;  3UV4 A;  5F25 A;  3LXJ A;  5DYX A;  4YY4 A;  5I89 A;  2LSP B;  4QSU A;  5A5R A;  4Q0O A;  5FFW A;  2RNX A;  4AKG A;  5D3R A;  4A9M A;  5I88 A;  5JI8 A;  4YAT A;  5CP5 A;  4NYV A;  5DKH A;  3SVF A;  5BT4 A;  5H1T A;  4MR5 A;  5ENG A;  5CQT A;  5F1L A;  5CUD A;  3AAD A;  4BW2 A;  4UIY A;  3U5O A;  4QZS A;  4J0R A;  4RVR A;  5EQ1 A;  5LKT A;  5EWC A;  5IGM A;  3G0L A;  4LRG A;  5E9L A;  5E9Y A;  5I1Q A;  4PY6 A;  3UVD A;  4TU6 A;  5EVA A;  5F61 A;  5CTL A;  4PTB A;  5KU3 A;  5CU8 A;  5LKX A;  4QSX A;  3UVY A;  4MEN A;  5HRW A;  4N4I A;  3IU6 A;  4NRB A;  3IU5 A;  4XYA A;  3MB3 A;  5A82 A;  4ALH A;  4X2I A;  4CL9 A;  4N4G A;  4LDF A;  5IBN A;  2F6J A;  2DWW A;  4PCI A;  5D25 A;  4OGI A;  4CUR A;  5D3H A;  3RCW A;  4YBM A;  4YY6 A;  4PS5 A;  5ENC A;  3P1D A;  2YEK A;  5DX4 A;  3MUL A;  5K29 A;  4QUT A;  4TQN A;  4QYL A;  1EQF A;  4HXS A;  4QSR A;  5CRM A;  3SVH A;  5CQ7 A;  3LQJ A;  3LQI A;  5EP7 A;  5FE2 A;  5II1 A;  4J0S A;  5CQ3 A;  4J3I A;  5CUA A;  4Q0N A;  1ZKR A;  5FE0 A;  3O33 A;  5EPR A;  5IGN A;  5D3J A;  4TZ8 A;  4UYG A;  2NXB A;  4QEW A;  3D7C A;  4UYE A;  4AKI A;  5DBM A;  4IOQ A;  5FB1 A;  4Z6I A;  3I3J A;  4O77 A;  4TS8 A;  5G4R A;  5A83 A;  5FE7 A;  1ZS5 A;  5EV9 A;  3NXB A;  3DAI A;  5FDZ A;  5EPS A;  5LJ2 A;  5FG6 A;  2DAT A;  4NR5 A;  4QYD A;  3U5N A;  4N3W A;  5D7X A;  4QNS A;  2R0S A;  4MR4 A;  2YDW A;  4YYG A;  3S92 A;  3UV5 A;  3JVM A;  3U5J A;  1PUO A;  4QY4 A;  4ZW1 A;  2DKW A;  3O35 A;  5CUC A;  4QR3 A;  3P1F A;  4A9L A;  5FH6 A;  5E0R A;  4HXN A;  4MEP A;  5LKU A;  3Q2F A;  5DLX A;  5DYC A;  3G0J A;  4E96 A;  4QBM A;  4LYI A;  4MR6 A;  5D3S A;  5HLS A;  4NYW A;  5LUU A;  5HRX A;  5CS8 A;  4BW3 A;  4YBT A;  4YH3 A;  5DY7 A;  3P1E A;  3SVG A;  5BT5 A;  3U5P A;  4QSV A;  5EK9 A;  4UYD A;  5FE9 A;  5L8U A;  4O70 A;  4C67 A;  5HCL A;  5L96 A;  5HEL A;  4TU4 A;  4NR8 A;  2RO1 A;  5LJ0 A;  4HXR A;  4YYN A;  5AD2 A;  4A9J A;  5CQ4 A;  5KHM A;  5L99 A;  2YYN A;  4Z93 A;  2YEL A;  4NUE A;  3FKM X;  5ENI A;  5A81 A;  4MR3 A;  4QST A;  4QUU A;  5ENJ A;  5FFV A;  3LJW A;  5HQ5 A;  4A9K A;  3MUK A;  5C7N A;  5FE4 A;  5C89 A;  5HM0 A;  5H85 A;  4AKN A;  2DVQ A;  4LC2 A;  2MJV B;  2RFJ A;  2D82 A;  4KV1 A;  3VKH A;  5FE3 A;  3UVX A;  4HXK A;  5A85 A;  5LJ1 A;  5ENB A;  5DYA A;  4CUS A;  4IOO A;  5ENH A;  5IGL A;  4YYM A;  4HXO A;  3HME A;  4UIV A;  4QSP A;  3U5L A;  5EWD A;  4TZ2 A;  5HRV A;  4YC9 A;  4IR6 A;  5A5P A;  2EJN A; 
#chains in the Genus database with same CATH homology
 5FG4 A;  4QR4 A;  5HJC A;  4YH4 A;  5FB0 A;  5DLZ A;  5F36 A;  4O78 A;  3S91 A;  4KV4 A;  2I7K A;  4O7A A;  5D3P A;  5CFW A;  3TLP A;  5J0D A;  2WP2 A;  5I29 A;  4NR6 A;  4NR9 A;  5CQA A;  5FE5 A;  1E6I A;  4XUB A;  5ENE A;  3O36 A;  5CQ8 A;  5FBX A;  5C8G A;  4TYL A;  5G4S A;  2L85 A;  1JM4 B;  2YW5 A;  4O72 A;  2RNW A;  5KTU A;  4A9E A;  5C87 A;  5HFR A;  5KTX A;  4YYH A;  2E7O A;  5TCM A;  4HXM A;  4KCX A;  5D3T A;  5E7D A;  4YAB A;  3QZV A;  2R0Y A;  4GPJ A;  4A9N A;  4BW4 A;  4UIT A;  4O7E A;  4TT2 A;  4LZS A;  4N4H A;  5FH7 A;  4YYD A;  4QSW A;  5EPB A;  5JWM A;  5IID A;  5ACY A;  4QB3 A;  4IR5 A;  3AQA A;  1WUM A;  5C4Q A;  5DFD A;  5CGP A;  4ZQL A;  3UVW A;  4F3I A;  1X0J A;  4NQM A;  5D3L A;  4A9O A;  5DYU A;  1JSP B;  3JVK A;  5AD3 A;  5DKD A;  5I80 A;  2R0V A;  5CZG A;  4A9H A;  5C85 A;  3HMH A;  5F5Z A;  2YEM A;  4UYF A;  4NUD A;  5A5S A;  5E74 A;  5H1V A;  4HBW A;  2FSA A;  5FE6 A;  4YYJ A;  5EWH A;  2KTB B;  5CQ5 A;  3UV2 A;  4CUP A;  4O7C A;  1WUG A;  5E9I A;  5FFY A;  3U5M A;  4XY9 A;  5EGU A;  5DFC A;  2E3K A;  4WHW A;  4NS5 A;  4UYF B;  4O7F A;  4WIV A;  4Z6H A;  4O71 A;  2L5E A;  5EWW A;  2G4A A;  5KO4 A;  3JVJ A;  4LZ2 A;  2R10 A;  4FLP A;  3DWY A;  5F3A A;  4Y03 A;  5F2P A;  4HXL A;  4LZR A;  3O34 A;  4O75 A;  5COI A;  5FE8 A;  4WHU A;  5ETB A;  5I86 A;  5EIC A;  4A9F A;  5A5Q A;  4UIX A;  4Z1S A;  5CUG A;  5CPE A;  4QR5 A;  4TT4 A;  5I7Y A;  4YAD A;  5F63 A;  5AMF A;  3Q2E A;  4NXJ A;  5D0C A;  2N9G A;  3ONI A;  3LQH A;  3U5K A;  4CLB A;  5IG6 A;  5II2 A;  4NUC A;  2YQD A;  4YYK A;  5LKZ A;  5EU1 A;  4QEU A;  5FH8 A;  3JVL A;  3HMF A;  4O74 A;  5LVQ A;  5CQ6 A;  4IOR A;  4OGJ A;  4UIU A;  2D9E A;  4NQN A;  4NYX A;  5KTW A;  2L84 A;  1F68 A;  5I83 A;  2WP1 A;  4TTE A;  5E9V A;  2DVR A;  4HXP A;  4O7B A;  5CUB A;  3MB4 A;  2OUO A;  4J1P A;  4ALG A;  5H1U A;  5EI4 A;  4HBX A;  2F6N A;  5A7C A;  5CRZ A;  5CUE A;  5D24 A;  2E7N A;  5FE1 A;  4O76 A;  4YAX A;  5DFB A;  5L98 A;  3MXF A;  4CFL A;  2RI7 A;  4BJX A;  5BT3 A;  5EWV A;  5A5O A;  5ENF A;  4MEO A;  3K2J A;  4QC3 A;  4QC1 A;  5E73 A;  4NR7 A;  1N72 A;  2RNY A;  3O37 A;  5ETD A;  4HBY A;  4PCE A;  2OSS A;  5E3G A;  4TT6 A;  4XY8 A;  4BW1 A;  4Z1Q A;  4UYH A;  5F60 A;  5HEN A;  4CUT A;  4OUF A;  4DON A;  5HEM A;  5HQ7 A;  4N4F A;  5DKC A;  4YBS A;  5I40 A;  4A9I A;  4CFK A;  4YYI A;  4LYS A;  4C66 A;  5A5N A;  5D3N A;  4LYW A;  5F1H A;  5CY9 A;  5EIS A;  5TB6 A;  2DVS A;  3MQM A;  4PKL A;  4UIW A;  4NRC A;  5E9K A;  4NRA A;  4QSQ A;  4YK0 A;  4CUQ A;  2I8N A;  2H60 A;  3ZYU A;  3QZS A;  5FG5 A;  5IGK A;  4NR4 A;  3P5O A;  3QZT A;  5HFQ A;  4CUU A;  5EM3 A;  4ZC9 A;  5AME A;  3UW9 A;  5L97 A;  5I7X A;  5L8T A;  5DW2 A;  5F62 A;  5E3D A;  4BHW A;  4IR3 A;  2GRC A;  4UIZ A;  4XUA A;  5EA1 A;  4LR6 A;  2DVV A;  2RS9 B;  5LVR A;  4QEV A;  4IR4 A;  5DW1 A;  5E9M A;  3GG3 A;  4HBV A;  5HQ6 A;  2OO1 A;  4MEQ A;  5D26 A;  3P1C A;  4QSS A;  3UV4 A;  5F25 A;  3LXJ A;  5DYX A;  4YY4 A;  5I89 A;  2LSP B;  4QSU A;  5A5R A;  4Q0O A;  5FFW A;  2RNX A;  5D3R A;  4A9M A;  5I88 A;  5JI8 A;  4YAT A;  5CP5 A;  4NYV A;  5DKH A;  3SVF A;  5BT4 A;  5H1T A;  4MR5 A;  5ENG A;  5CQT A;  5F1L A;  5CUD A;  3AAD A;  4BW2 A;  4UIY A;  3U5O A;  4QZS A;  4J0R A;  4RVR A;  5EQ1 A;  5LKT A;  5EWC A;  5IGM A;  3G0L A;  4LRG A;  5E9L A;  5E9Y A;  5I1Q A;  4PY6 A;  4TU6 A;  5EVA A;  5F61 A;  5CTL A;  4PTB A;  5KU3 A;  5CU8 A;  5LKX A;  4QSX A;  3UVY A;  4MEN A;  5HRW A;  4N4I A;  3IU6 A;  4NRB A;  3IU5 A;  4XYA A;  3MB3 A;  5A82 A;  4ALH A;  4X2I A;  4CL9 A;  4N4G A;  4LDF A;  5IBN A;  2F6J A;  2DWW A;  4PCI A;  5D25 A;  4OGI A;  4CUR A;  5D3H A;  3RCW A;  4YBM A;  4YY6 A;  4PS5 A;  5ENC A;  3P1D A;  2YEK A;  5DX4 A;  3MUL A;  5K29 A;  4QUT A;  4TQN A;  4QYL A;  1EQF A;  4HXS A;  4QSR A;  5CRM A;  3SVH A;  5CQ7 A;  3LQJ A;  3LQI A;  5EP7 A;  5FE2 A;  5II1 A;  4J0S A;  5CQ3 A;  4J3I A;  5CUA A;  4Q0N A;  5FE0 A;  3O33 A;  5EPR A;  5IGN A;  5D3J A;  4TZ8 A;  4UYG A;  2NXB A;  4QEW A;  3D7C A;  4UYE A;  5DBM A;  4IOQ A;  5FB1 A;  4Z6I A;  3I3J A;  4O77 A;  4TS8 A;  5G4R A;  5A83 A;  5FE7 A;  1ZS5 A;  5EV9 A;  3NXB A;  3DAI A;  5FDZ A;  5EPS A;  5LJ2 A;  5FG6 A;  2DAT A;  4NR5 A;  4QYD A;  3U5N A;  4N3W A;  5D7X A;  4QNS A;  2R0S A;  4MR4 A;  2YDW A;  4YYG A;  3S92 A;  3UV5 A;  3JVM A;  3U5J A;  4QY4 A;  4ZW1 A;  2DKW A;  3O35 A;  5CUC A;  4QR3 A;  3P1F A;  4A9L A;  5FH6 A;  5E0R A;  4HXN A;  4MEP A;  5LKU A;  3Q2F A;  5DLX A;  5DYC A;  3G0J A;  4E96 A;  4QBM A;  4LYI A;  4MR6 A;  5D3S A;  5HLS A;  4NYW A;  5LUU A;  5HRX A;  5CS8 A;  4BW3 A;  4YBT A;  4YH3 A;  5DY7 A;  3P1E A;  3SVG A;  5BT5 A;  3U5P A;  4QSV A;  5EK9 A;  4UYD A;  5FE9 A;  5L8U A;  4O70 A;  4C67 A;  5HCL A;  5L96 A;  5HEL A;  4TU4 A;  4NR8 A;  2RO1 A;  5LJ0 A;  4HXR A;  4YYN A;  5AD2 A;  4A9J A;  5CQ4 A;  5KHM A;  5L99 A;  2YYN A;  4Z93 A;  2YEL A;  4NUE A;  3FKM X;  5ENI A;  5A81 A;  4MR3 A;  4QST A;  4QUU A;  5ENJ A;  5FFV A;  3LJW A;  5HQ5 A;  4A9K A;  3MUK A;  5C7N A;  5FE4 A;  5C89 A;  5HM0 A;  5H85 A;  4AKN A;  2DVQ A;  4LC2 A;  2MJV B;  2RFJ A;  2D82 A;  4KV1 A;  5FE3 A;  3UVX A;  4HXK A;  5A85 A;  5LJ1 A;  5ENB A;  5DYA A;  4CUS A;  4IOO A;  5ENH A;  5IGL A;  4YYM A;  4HXO A;  3HME A;  4UIV A;  4QSP A;  3U5L A;  5EWD A;  4TZ2 A;  5HRV A;  4YC9 A;  4IR6 A;  5A5P A;  3UVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...