5ENCA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with n-(2,6-dichlorobenzyl)acetamide (sgc - diamond i04-1 fragment screening)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
124
structure length
124
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5encA00
5LUUA 2R10A 3O36A 5A5NA 3P1FA 4MR6A 5A82A 4OUFA 2L5EA 4WHUA 5LKZA 1E6IA 3QZSA 5CUCA 3ZYUA 4QSRA 5FE8A 3JVJA 5CP5A 3MULA 4UYDA 4WHWA 2WP1A 4ZC9A 4O72A 4YAXA 3U5LA 5HLSA 5HQ6A 2RI7A 5G4SA 5ENFA 4NUDA 5EWWA 4CFLA 5IGNA 4CL9A 3MQMA 4IR4A 2DVRA 5D3HA 4UYFB 5FG4A 2I8NA 5HEMA 4UYHA 3UVWA 4HXKA 4Y03A 2R0VA 3HMEA 2YELA 4E96A 4QR5A 5ACYA 3LJWA 4GPJA 4O71A 4LR6A 4YYDA 5FE2A 5CGPA 3NXBA 3JVLA 2E7OA 4UIZA 4YC9A 4NS5A 4F3IA 5FG5A 4O78A 5DKCA 4A9MA 4CUUA 3UW9A 5KTUA 2RFJA 3QZTA 4BW4A 5ETBA 4A9EA 4Z1QA 4NR6A 3MUKA 5D3SA 5I86A 5DFDA 5C8GA 5A7CA 4YATA 4O7CA 4UIWA 3O37A 4LYIA 4Z1SA 5E7DA 5DBMA 3G0JA 4NQNA 4YYNA 5CRZA 4A9OA 3JVKA 4TT6A 4TQNA 2E3KA 5FE4A 5FE5A 4IR3A 5CQ5A 5HRWA 5AMEA 4LC2A 4QR4A 3U5KA 2OSSA 3DAIA 4KCXA 4PS5A 2D82A 3SVFA 5IGMA 3ONIA 5FDZA 5HQ5A 5A83A 4PTBA 4RVRA 4YH4A 5ENCA 5EPBA 5DFBA 2OUOA 3HMHA 3G0LA 4O7FA 4NUEA 3UVYA 2YEKA 5I7YA 5EM3A 4O70A 5L96A 3P1EA 2D9EA 1JSPB 4BHWA 4J0RA 5BT4A 3K2JA 5CQAA 5DY7A 5FFVA 4N3WA 4YYHA 5HFQA 4TTEA 3DWYA 4HXNA 5F25A 5LVQA 4QEWA 5FBXA 4BW2A 4LYSA 5D3NA 4QSPA 4YBSA 5DLXA 4QSTA 1EQFA 4MEPA 4HXLA 4TS8A 2L84A 5E9KA 2DATA 5H1VA 5LKUA 5ENEA 5C87A 5HQ7A 4ALHA 4QEVA 2YYNA 4Z6HA 5CUAA 4Z6IA 5JWMA 5COIA 3QZVA 4TU6A 4UITA 5E9VA 5A5SA 4QNSA 5HELA 3Q2EA 2RNWA 5FFYA 5D3RA 4NRBA 4LYWA 4TU4A 2N9GA 5EWCA 5E9IA 4UIUA 2LSPB 4NR9A 4AKNA 5LJ2A 4PKLA 4YH3A 3RCWA 2E7NA 5A85A 5FE9A 4A9IA 5EVAA 5CUEA 5CUDA 4O7EA 4CLBA 5D26A 5D24A 4TT2A 5EWVA 5KTXA 4YYKA 5EQ1A 4NR5A 3IU6A 5D7XA 5F62A 2DVQA 5ENBA 3U5JA 5HENA 5CRMA 3SVGA 4UIYA 5C4QA 4IORA 4NR4A 5FE1A 4PCIA 5ENGA 5DYCA 5A81A 4MR5A 4TZ2A 4N4FA 4YADA 1WUGA 5F2PA 5DKDA 5DW1A 4O74A 4ALGA 4NRCA 4PY6A 4IR5A 5E9LA 4XY9A 5HRVA 4A9HA 4ZQLA 2YW5A 3SVHA 5HM0A 4C66A 4NQMA 4HBWA 4QSQA 4NUCA 4QSWA 2NXBA 5A5PA 2MJVB 3U5OA 5LJ1A 5F63A 3Q2FA 4TZ8A 5C7NA 2DWWA 2F6JA 5D25A 5IGKA 3O35A 4NYWA 4Q0NA 5I89A 5TB6A 4X2IA 5JI8A 4CURA 5ENIA 3D7CA 5CFWA 4IR6A 4NYVA 5CQ4A 5D3PA 4LZ2A 4A9KA 5G4RA 5KO4A 4J0SA 3LQIA 5EK9A 4YK0A 5L8UA 3S92A 3LQJA 5EU1A 4UYEA 4WIVA 4A9LA 4YYGA 4O7AA 5DX4A 4HBYA 5F3AA 4CUSA 5AMFA 5H1TA 5FE7A 4A9FA 1X0JA 4KV1A 4LRGA 4YY6A 4J1PA 5L99A 4QB3A 1ZS5A 3UV2A 5IGLA 5DYXA 2RNYA 4QSSA 4QUUA 4OGIA 5EICA 4HBVA 3HMFA 4TT4A 5F36A 5FB0A 5DLZA 5C85A 2OO1A 5CZGA 3FKMX 4NXJA 4O7BA 4UIXA 2FSAA 5J0DA 4YABA 5II2A 3UV4A 2RNXA 4YYIA 4YYMA 3O34A 5FH6A 4CUPA 2WP2A 5DYUA 4XUBA 5TCMA 3TLPA 4O75A 2RO1A 4MR3A 5DKHA 3P1DA 3UVDA 1WUMA 5CY9A 4BW3A 5F60A 4QUTA 4QYLA 4UIVA 4KV4A 4TYLA 5F1LA 4QC1A 5FB1A 5HFRA 5EWDA 5DFCA 5CTLA 5HCLA 3U5PA 4IOQA 5E74A 5EI4A 5L97A 5I88A 3AQAA 4NYXA 5IIDA 4MENA 5CQTA 5EGUA 4C67A 3AADA 5I80A 5I1QA 4BW1A 4QBMA 5CU8A 4FLPA 4QC3A 5A5QA 4HBXA 5FG6A 2F6NA 3GG3A 5H85A 2DKWA 5L8TA 5II1A 5ETDA 5DW2A 3P5OA 4OGJA 3UV5A 5KU3A 5CPEA 4A9NA 5EP7A 2DVVA 4YBMA 2G4AA 4N4GA 5C89A 5FE0A 4BJXA 4HXOA 4LZRA 5CQ8A 5A5OA 5E3DA 5AD2A 5EWHA 4CFKA 5F5ZA 4HXRA 5CUGA 5BT5A 3LXJA 4QYDA 5KHMA 4QSXA 2KTBB 2DVSA 4NR7A 5I40A 5F1HA 1JM4B 5BT3A 2L85A 5E3GA 4LDFA 2H60A 4QSVA 1N72A 3S91A 5A5RA 4MR4A 4N4HA 5HJCA 5E9YA 5EA1A 2R0YA 2RS9B 2YEMA 5CQ6A 5E0RA 4HXSA 3P1CA 5I7XA 4YBTA 5CQ7A 5KTWA 5D0CA 5LKXA 5EPRA 5IG6A 4NR8A 5I29A 5H1UA 3MXFA 5IBNA 5FH7A 2I7KA 5I83A 2YDWA 4XY8A 5F61A 4QR3A 5LKTA 5HRXA 3MB3A 5D3TA 5CS8A 4UYFA 2YQDA 4NRAA 5FH8A 3MB4A 2GRCA 4QZSA 5AD3A 3LQHA 3I3JA 5FFWA 4A9JA 5ENJA 4QSUA 3U5MA 4MEOA 1F68A 4LZSA 4XUAA 3O33A 5FE3A 5EPSA 4MEQA 4PCEA 4YY4A 5CQ3A 5E73A 3U5NA 5FE6A 4YYJA 4DONA 3JVMA 4Q0OA 4HXPA 5EISA 2R0SA 3UVXA 4UYGA 4CUTA 4O76A 4XYAA 5EV9A 4N4IA 5CUBA 4O77A 4Z93A 4QY4A 4CUQA 4IOOA 3IU5A 4HXMA 5D3JA 5L98A 5LVRA 5DYAA 4ZW1A 5LJ0A 4J3IA 5D3LA 5ENHA 5E9MA 5K29A 4QEUA
chains in the Genus database with same CATH superfamily
5LUUA 2R10A 3O36A 5A5NA 3P1FA 4MR6A 5A82A 4OUFA 2L5EA 4WHUA 5LKZA 1E6IA 3QZSA 5CUCA 3ZYUA 3D1DA 4QSRA 5FE8A 3JVJA 5CP5A 3MULA 4UYDA 4WHWA 2WP1A 4ZC9A 4O72A 4YAXA 3U5LA 5HLSA 5HQ6A 2RI7A 5G4SA 5ENFA 4NUDA 5EWWA 4CFLA 5IGNA 4CL9A 3MQMA 4IR4A 2DVRA 5D3HA 4UYFB 5FG4A 2I8NA 5HEMA 4UYHA 3UVWA 4HXKA 4Y03A 2R0VA 3HMEA 2YELA 4E96A 4QR5A 5ACYA 3LJWA 4GPJA 4O71A 4LR6A 4YYDA 5FE2A 5CGPA 3NXBA 3JVLA 2E7OA 4UIZA 4YC9A 4NS5A 4F3IA 5FG5A 4O78A 5DKCA 4A9MA 4CUUA 3UW9A 5KTUA 2RFJA 3QZTA 4BW4A 5ETBA 4A9EA 4Z1QA 4NR6A 3MUKA 5D3SA 5I86A 5DFDA 5C8GA 5A7CA 4YATA 4O7CA 4UIWA 3O37A 4LYIA 4Z1SA 5E7DA 5DBMA 3G0JA 4NQNA 4YYNA 5CRZA 4A9OA 3JVKA 4TT6A 4TQNA 2E3KA 5FE4A 5FE5A 4IR3A 5CQ5A 5HRWA 5AMEA 4LC2A 4QR4A 3U5KA 2OSSA 3DAIA 4KCXA 4PS5A 2D82A 3SVFA 5IGMA 3ONIA 5FDZA 5HQ5A 5A83A 4PTBA 4RVRA 4YH4A 5ENCA 5EPBA 5DFBA 2OUOA 3HMHA 3G0LA 4O7FA 4NUEA 3UVYA 2YEKA 5I7YA 5EM3A 4O70A 5L96A 3P1EA 2D9EA 1JSPB 4BHWA 4J0RA 5BT4A 3K2JA 5CQAA 5DY7A 5FFVA 4N3WA 4YYHA 5HFQA 4TTEA 3DWYA 4HXNA 5F25A 5LVQA 4QEWA 5FBXA 4BW2A 4LYSA 5D3NA 4QSPA 4YBSA 5DLXA 4QSTA 1EQFA 4MEPA 4AKHA 4HXLA 4TS8A 2L84A 5E9KA 2DATA 5H1VA 5LKUA 5ENEA 5C87A 5HQ7A 4ALHA 4QEVA 2YYNA 4Z6HA 5CUAA 4Z6IA 5JWMA 5COIA 3QZVA 4TU6A 4UITA 5E9VA 5A5SA 4QNSA 5HELA 3Q2EA 2RNWA 5FFYA 5D3RA 4NRBA 4LYWA 4TU4A 3VKHA 2N9GA 5EWCA 5E9IA 4UIUA 2LSPB 4NR9A 4AKNA 5LJ2A 4PKLA 4YH3A 3RCWA 2E7NA 5A85A 5FE9A 4A9IA 5EVAA 5CUEA 5CUDA 1PUOA 4O7EA 4CLBA 5D26A 5D24A 4TT2A 5EWVA 4AKGA 2EJNA 5KTXA 4YYKA 5EQ1A 4NR5A 3IU6A 5D7XA 5F62A 2DVQA 5ENBA 3U5JA 5HENA 5CRMA 3SVGA 4UIYA 5C4QA 4IORA 4NR4A 5FE1A 4PCIA 5ENGA 5DYCA 5A81A 4MR5A 4TZ2A 4N4FA 4YADA 1WUGA 5F2PA 5DKDA 5DW1A 4O74A 4ALGA 3ERRA 4NRCA 4PY6A 4IR5A 5E9LA 4XY9A 5HRVA 4A9HA 4ZQLA 2YW5A 3SVHA 5HM0A 4C66A 4NQMA 4HBWA 4QSQA 4NUCA 4QSWA 2NXBA 5A5PA 2MJVB 3U5OA 5LJ1A 5F63A 3Q2FA 4TZ8A 5C7NA 2DWWA 2F6JA 5D25A 5IGKA 3O35A 4NYWA 4Q0NA 5I89A 5TB6A 4X2IA 5JI8A 4CURA 5ENIA 3D7CA 5CFWA 4IR6A 4NYVA 5CQ4A 5D3PA 4LZ2A 4A9KA 5G4RA 5KO4A 4J0SA 3LQIA 5EK9A 4YK0A 5L8UA 3S92A 3LQJA 5EU1A 4UYEA 4WIVA 4A9LA 4YYGA 4O7AA 5DX4A 4HBYA 5F3AA 4CUSA 5AMFA 5H1TA 5FE7A 4A9FA 1X0JA 4KV1A 4LRGA 4YY6A 4J1PA 5L99A 3VKGA 4QB3A 1ZS5A 3UV2A 5IGLA 5DYXA 2RNYA 4QSSA 4QUUA 4OGIA 5EICA 4HBVA 3HMFA 4TT4A 5F36A 5FB0A 5DLZA 5C85A 2OO1A 5CZGA 3FKMX 4NXJA 4O7BA 4UIXA 2FSAA 5J0DA 4YABA 5II2A 3UV4A 2RNXA 4YYIA 4YYMA 3O34A 5FH6A 4CUPA 2WP2A 5DYUA 4XUBA 5TCMA 3TLPA 4O75A 2RO1A 4MR3A 5DKHA 3P1DA 4AKIA 3UVDA 1WUMA 5CY9A 4BW3A 5F60A 4QUTA 4QYLA 4UIVA 4KV4A 4TYLA 5F1LA 4QC1A 5FB1A 5HFRA 5EWDA 5DFCA 5CTLA 5HCLA 3U5PA 4IOQA 5E74A 5EI4A 5L97A 5I88A 3AQAA 4NYXA 5IIDA 4MENA 5CQTA 5EGUA 4C67A 3AADA 5I80A 5I1QA 4BW1A 4QBMA 5CU8A 4FLPA 4QC3A 5A5QA 4HBXA 5FG6A 2F6NA 3GG3A 5H85A 2DKWA 5L8TA 5II1A 5ETDA 5DW2A 3P5OA 4OGJA 3UV5A 5KU3A 5CPEA 4A9NA 5EP7A 2DVVA 4YBMA 2G4AA 4N4GA 5C89A 5FE0A 4BJXA 4HXOA 4LZRA 5CQ8A 5A5OA 5E3DA 5AD2A 5EWHA 4CFKA 5F5ZA 4HXRA 5CUGA 5BT5A 3LXJA 4QYDA 5KHMA 4QSXA 2KTBB 2DVSA 4NR7A 5I40A 5F1HA 1JM4B 5BT3A 2L85A 5E3GA 4LDFA 2H60A 4QSVA 1N72A 3S91A 5A5RA 4MR4A 4N4HA 5HJCA 5E9YA 5EA1A 2R0YA 2RS9B 2YEMA 5CQ6A 5E0RA 4HXSA 3P1CA 5I7XA 4YBTA 5CQ7A 5KTWA 5D0CA 5LKXA 5EPRA 5IG6A 4NR8A 5I29A 5H1UA 3MXFA 5IBNA 5FH7A 2I7KA 5I83A 2YDWA 4XY8A 5F61A 4QR3A 5LKTA 5HRXA 3MB3A 5D3TA 5CS8A 4UYFA 2YQDA 4NRAA 5FH8A 3MB4A 2GRCA 4QZSA 5AD3A 3LQHA 3I3JA 4AI6A 5FFWA 4A9JA 5ENJA 4QSUA 3U5MA 4MEOA 3D1BA 1F68A 4LZSA 4XUAA 3O33A 5FE3A 5EPSA 4MEQA 4PCEA 4YY4A 1ZKRA 5CQ3A 5E73A 3U5NA 5FE6A 4YYJA 4DONA 3JVMA 4Q0OA 4HXPA 5EISA 2R0SA 3UVXA 4UYGA 4CUTA 4O76A 4XYAA 5EV9A 4N4IA 5CUBA 4O77A 4Z93A 4QY4A 4CUQA 4IOOA 3IU5A 4HXMA 5D3JA 5L98A 5LVRA 5DYAA 4ZW1A 5LJ0A 4J3IA 5D3LA 5ENHA 5E9MA 5K29A 4QEUA
chains in the Genus database with same CATH topology
5LUUA 2R10A 3O36A 5A5NA 3P1FA 4MR6A 5A82A 4OUFA 2L5EA 4WHUA 5LKZA 1E6IA 3QZSA 5CUCA 3ZYUA 4QSRA 5FE8A 3JVJA 5CP5A 3MULA 4UYDA 4WHWA 2WP1A 4ZC9A 4O72A 4YAXA 3U5LA 5HLSA 5HQ6A 2RI7A 5G4SA 5ENFA 4NUDA 5EWWA 4CFLA 5IGNA 4CL9A 3MQMA 4IR4A 2DVRA 5D3HA 4UYFB 5FG4A 2I8NA 5HEMA 4UYHA 3UVWA 4HXKA 4Y03A 2R0VA 3HMEA 2YELA 4E96A 4QR5A 5ACYA 3LJWA 4GPJA 4O71A 4LR6A 4YYDA 5FE2A 5CGPA 3NXBA 3JVLA 2E7OA 4UIZA 4YC9A 4NS5A 4F3IA 5FG5A 4O78A 5DKCA 4A9MA 4CUUA 3UW9A 5KTUA 2RFJA 3QZTA 4BW4A 5ETBA 4A9EA 4Z1QA 4NR6A 3MUKA 5D3SA 5I86A 5DFDA 5C8GA 5A7CA 4YATA 4O7CA 4UIWA 3O37A 4LYIA 4Z1SA 5E7DA 5DBMA 3G0JA 4NQNA 4YYNA 5CRZA 4A9OA 3JVKA 4TT6A 4TQNA 2E3KA 5FE4A 5FE5A 4IR3A 5CQ5A 5HRWA 5AMEA 4LC2A 4QR4A 3U5KA 2OSSA 3DAIA 4KCXA 4PS5A 2D82A 3SVFA 5IGMA 3ONIA 5FDZA 5HQ5A 5A83A 4PTBA 4RVRA 4YH4A 5ENCA 5EPBA 5DFBA 2OUOA 3HMHA 3G0LA 4O7FA 4NUEA 3UVYA 2YEKA 5I7YA 5EM3A 4O70A 5L96A 3P1EA 2D9EA 1JSPB 4BHWA 4J0RA 5BT4A 3K2JA 5CQAA 5DY7A 5FFVA 4N3WA 4YYHA 5HFQA 4TTEA 3DWYA 4HXNA 5F25A 5LVQA 4QEWA 5FBXA 4BW2A 4LYSA 5D3NA 4QSPA 4YBSA 5DLXA 4QSTA 1EQFA 4MEPA 4HXLA 4TS8A 2L84A 5E9KA 2DATA 5H1VA 5LKUA 5ENEA 5C87A 5HQ7A 4ALHA 4QEVA 2YYNA 4Z6HA 5CUAA 4Z6IA 5JWMA 5COIA 3QZVA 4TU6A 4UITA 5E9VA 5A5SA 4QNSA 5HELA 3Q2EA 2RNWA 5FFYA 5D3RA 4NRBA 4LYWA 4TU4A 2N9GA 5EWCA 5E9IA 4UIUA 2LSPB 4NR9A 4AKNA 5LJ2A 4PKLA 4YH3A 3RCWA 2E7NA 5A85A 5FE9A 4A9IA 5EVAA 5CUEA 5CUDA 4O7EA 4CLBA 5D26A 5D24A 4TT2A 5EWVA 5KTXA 4YYKA 5EQ1A 4NR5A 3IU6A 5D7XA 5F62A 2DVQA 5ENBA 3U5JA 5HENA 5CRMA 3SVGA 4UIYA 5C4QA 4IORA 4NR4A 5FE1A 4PCIA 5ENGA 5DYCA 5A81A 4MR5A 4TZ2A 4N4FA 4YADA 1WUGA 5F2PA 5DKDA 5DW1A 4O74A 4ALGA 4NRCA 4PY6A 4IR5A 5E9LA 4XY9A 5HRVA 4A9HA 4ZQLA 2YW5A 3SVHA 5HM0A 4C66A 4NQMA 4HBWA 4QSQA 4NUCA 4QSWA 2NXBA 5A5PA 2MJVB 3U5OA 5LJ1A 5F63A 3Q2FA 4TZ8A 5C7NA 2DWWA 2F6JA 5D25A 5IGKA 3O35A 4NYWA 4Q0NA 5I89A 5TB6A 4X2IA 5JI8A 4CURA 5ENIA 3D7CA 5CFWA 4IR6A 4NYVA 5CQ4A 5D3PA 4LZ2A 4A9KA 5G4RA 5KO4A 4J0SA 3LQIA 5EK9A 4YK0A 5L8UA 3S92A 3LQJA 5EU1A 4UYEA 4WIVA 4A9LA 4YYGA 4O7AA 5DX4A 4HBYA 5F3AA 4CUSA 5AMFA 5H1TA 5FE7A 4A9FA 1X0JA 4KV1A 4LRGA 4YY6A 4J1PA 5L99A 4QB3A 1ZS5A 3UV2A 5IGLA 5DYXA 2RNYA 4QSSA 4QUUA 4OGIA 5EICA 4HBVA 3HMFA 4TT4A 5F36A 5FB0A 5DLZA 5C85A 2OO1A 5CZGA 3FKMX 4NXJA 4O7BA 4UIXA 2FSAA 5J0DA 4YABA 5II2A 3UV4A 2RNXA 4YYIA 4YYMA 3O34A 5FH6A 4CUPA 2WP2A 5DYUA 4XUBA 5TCMA 3TLPA 4O75A 2RO1A 4MR3A 5DKHA 3P1DA 3UVDA 1WUMA 5CY9A 4BW3A 5F60A 4QUTA 4QYLA 4UIVA 4KV4A 4TYLA 5F1LA 4QC1A 5FB1A 5HFRA 5EWDA 5DFCA 5CTLA 5HCLA 3U5PA 4IOQA 5E74A 5EI4A 5L97A 5I88A 3AQAA 4NYXA 5IIDA 4MENA 5CQTA 5EGUA 4C67A 3AADA 5I80A 5I1QA 4BW1A 4QBMA 5CU8A 4FLPA 4QC3A 5A5QA 4HBXA 5FG6A 2F6NA 3GG3A 5H85A 2DKWA 5L8TA 5II1A 5ETDA 5DW2A 3P5OA 4OGJA 3UV5A 5KU3A 5CPEA 4A9NA 5EP7A 2DVVA 4YBMA 2G4AA 4N4GA 5C89A 5FE0A 4BJXA 4HXOA 4LZRA 5CQ8A 5A5OA 5E3DA 5AD2A 5EWHA 4CFKA 5F5ZA 4HXRA 5CUGA 5BT5A 3LXJA 4QYDA 5KHMA 4QSXA 2KTBB 2DVSA 4NR7A 5I40A 5F1HA 1JM4B 5BT3A 2L85A 5E3GA 4LDFA 2H60A 4QSVA 1N72A 3S91A 5A5RA 4MR4A 4N4HA 5HJCA 5E9YA 5EA1A 2R0YA 2RS9B 2YEMA 5CQ6A 5E0RA 4HXSA 3P1CA 5I7XA 4YBTA 5CQ7A 5KTWA 5D0CA 5LKXA 5EPRA 5IG6A 4NR8A 5I29A 5H1UA 3MXFA 5IBNA 5FH7A 2I7KA 5I83A 2YDWA 4XY8A 5F61A 4QR3A 5LKTA 5HRXA 3MB3A 5D3TA 5CS8A 4UYFA 2YQDA 4NRAA 5FH8A 3MB4A 2GRCA 4QZSA 5AD3A 3LQHA 3I3JA 5FFWA 4A9JA 5ENJA 4QSUA 3U5MA 4MEOA 1F68A 4LZSA 4XUAA 3O33A 5FE3A 5EPSA 4MEQA 4PCEA 4YY4A 5CQ3A 5E73A 3U5NA 5FE6A 4YYJA 4DONA 3JVMA 4Q0OA 4HXPA 5EISA 2R0SA 3UVXA 4UYGA 4CUTA 4O76A 4XYAA 5EV9A 4N4IA 5CUBA 4O77A 4Z93A 4QY4A 4CUQA 4IOOA 3IU5A 4HXMA 5D3JA 5L98A 5LVRA 5DYAA 4ZW1A 5LJ0A 4J3IA 5D3LA 5ENHA 5E9MA 5K29A 4QEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LUU A;  2R10 A;  3O36 A;  5A5N A;  3P1F A;  4MR6 A;  5A82 A;  4OUF A;  2L5E A;  4WHU A;  5LKZ A;  1E6I A;  3QZS A;  5CUC A;  3ZYU A;  4QSR A;  5FE8 A;  3JVJ A;  5CP5 A;  3MUL A;  4UYD A;  4WHW A;  2WP1 A;  4ZC9 A;  4O72 A;  4YAX A;  3U5L A;  5HLS A;  5HQ6 A;  2RI7 A;  5G4S A;  5ENF A;  4NUD A;  5EWW A;  4CFL A;  5IGN A;  4CL9 A;  3MQM A;  4IR4 A;  2DVR A;  5D3H A;  4UYF B;  5FG4 A;  2I8N A;  5HEM A;  4UYH A;  3UVW A;  4HXK A;  4Y03 A;  2R0V A;  3HME A;  2YEL A;  4E96 A;  4QR5 A;  5ACY A;  3LJW A;  4GPJ A;  4O71 A;  4LR6 A;  4YYD A;  5FE2 A;  5CGP A;  3NXB A;  3JVL A;  2E7O A;  4UIZ A;  4YC9 A;  4NS5 A;  4F3I A;  5FG5 A;  4O78 A;  5DKC A;  4A9M A;  4CUU A;  3UW9 A;  5KTU A;  2RFJ A;  3QZT A;  4BW4 A;  5ETB A;  4A9E A;  4Z1Q A;  4NR6 A;  3MUK A;  5D3S A;  5I86 A;  5DFD A;  5C8G A;  5A7C A;  4YAT A;  4O7C A;  4UIW A;  3O37 A;  4LYI A;  4Z1S A;  5E7D A;  5DBM A;  3G0J A;  4NQN A;  4YYN A;  5CRZ A;  4A9O A;  3JVK A;  4TT6 A;  4TQN A;  2E3K A;  5FE4 A;  5FE5 A;  4IR3 A;  5CQ5 A;  5HRW A;  5AME A;  4LC2 A;  4QR4 A;  3U5K A;  2OSS A;  3DAI A;  4KCX A;  4PS5 A;  2D82 A;  3SVF A;  5IGM A;  3ONI A;  5FDZ A;  5HQ5 A;  5A83 A;  4PTB A;  4RVR A;  4YH4 A;  5ENC A;  5EPB A;  5DFB A;  2OUO A;  3HMH A;  3G0L A;  4O7F A;  4NUE A;  3UVY A;  2YEK A;  5I7Y A;  5EM3 A;  4O70 A;  5L96 A;  3P1E A;  2D9E A;  1JSP B;  4BHW A;  4J0R A;  5BT4 A;  3K2J A;  5CQA A;  5DY7 A;  5FFV A;  4N3W A;  4YYH A;  5HFQ A;  4TTE A;  3DWY A;  4HXN A;  5F25 A;  5LVQ A;  4QEW A;  5FBX A;  4BW2 A;  4LYS A;  5D3N A;  4QSP A;  4YBS A;  5DLX A;  4QST A;  1EQF A;  4MEP A;  4HXL A;  4TS8 A;  2L84 A;  5E9K A;  2DAT A;  5H1V A;  5LKU A;  5ENE A;  5C87 A;  5HQ7 A;  4ALH A;  4QEV A;  2YYN A;  4Z6H A;  5CUA A;  4Z6I A;  5JWM A;  5COI A;  3QZV A;  4TU6 A;  4UIT A;  5E9V A;  5A5S A;  4QNS A;  5HEL A;  3Q2E A;  2RNW A;  5FFY A;  5D3R A;  4NRB A;  4LYW A;  4TU4 A;  2N9G A;  5EWC A;  5E9I A;  4UIU A;  2LSP B;  4NR9 A;  4AKN A;  5LJ2 A;  4PKL A;  4YH3 A;  3RCW A;  2E7N A;  5A85 A;  5FE9 A;  4A9I A;  5EVA A;  5CUE A;  5CUD A;  4O7E A;  4CLB A;  5D26 A;  5D24 A;  4TT2 A;  5EWV A;  5KTX A;  4YYK A;  5EQ1 A;  4NR5 A;  3IU6 A;  5D7X A;  5F62 A;  2DVQ A;  5ENB A;  3U5J A;  5HEN A;  5CRM A;  3SVG A;  4UIY A;  5C4Q A;  4IOR A;  4NR4 A;  5FE1 A;  4PCI A;  5ENG A;  5DYC A;  5A81 A;  4MR5 A;  4TZ2 A;  4N4F A;  4YAD A;  1WUG A;  5F2P A;  5DKD A;  5DW1 A;  4O74 A;  4ALG A;  4NRC A;  4PY6 A;  4IR5 A;  5E9L A;  4XY9 A;  5HRV A;  4A9H A;  4ZQL A;  2YW5 A;  3SVH A;  5HM0 A;  4C66 A;  4NQM A;  4HBW A;  4QSQ A;  4NUC A;  4QSW A;  2NXB A;  5A5P A;  2MJV B;  3U5O A;  5LJ1 A;  5F63 A;  3Q2F A;  4TZ8 A;  5C7N A;  2DWW A;  2F6J A;  5D25 A;  5IGK A;  3O35 A;  4NYW A;  4Q0N A;  5I89 A;  5TB6 A;  4X2I A;  5JI8 A;  4CUR A;  5ENI A;  3D7C A;  5CFW A;  4IR6 A;  4NYV A;  5CQ4 A;  5D3P A;  4LZ2 A;  4A9K A;  5G4R A;  5KO4 A;  4J0S A;  3LQI A;  5EK9 A;  4YK0 A;  5L8U A;  3S92 A;  3LQJ A;  5EU1 A;  4UYE A;  4WIV A;  4A9L A;  4YYG A;  4O7A A;  5DX4 A;  4HBY A;  5F3A A;  4CUS A;  5AMF A;  5H1T A;  5FE7 A;  4A9F A;  1X0J A;  4KV1 A;  4LRG A;  4YY6 A;  4J1P A;  5L99 A;  4QB3 A;  1ZS5 A;  3UV2 A;  5IGL A;  5DYX A;  2RNY A;  4QSS A;  4QUU A;  4OGI A;  5EIC A;  4HBV A;  3HMF A;  4TT4 A;  5F36 A;  5FB0 A;  5DLZ A;  5C85 A;  2OO1 A;  5CZG A;  3FKM X;  4NXJ A;  4O7B A;  4UIX A;  2FSA A;  5J0D A;  4YAB A;  5II2 A;  3UV4 A;  2RNX A;  4YYI A;  4YYM A;  3O34 A;  5FH6 A;  4CUP A;  2WP2 A;  5DYU A;  4XUB A;  5TCM A;  3TLP A;  4O75 A;  2RO1 A;  4MR3 A;  5DKH A;  3P1D A;  3UVD A;  1WUM A;  5CY9 A;  4BW3 A;  5F60 A;  4QUT A;  4QYL A;  4UIV A;  4KV4 A;  4TYL A;  5F1L A;  4QC1 A;  5FB1 A;  5HFR A;  5EWD A;  5DFC A;  5CTL A;  5HCL A;  3U5P A;  4IOQ A;  5E74 A;  5EI4 A;  5L97 A;  5I88 A;  3AQA A;  4NYX A;  5IID A;  4MEN A;  5CQT A;  5EGU A;  4C67 A;  3AAD A;  5I80 A;  5I1Q A;  4BW1 A;  4QBM A;  5CU8 A;  4FLP A;  4QC3 A;  5A5Q A;  4HBX A;  5FG6 A;  2F6N A;  3GG3 A;  5H85 A;  2DKW A;  5L8T A;  5II1 A;  5ETD A;  5DW2 A;  3P5O A;  4OGJ A;  3UV5 A;  5KU3 A;  5CPE A;  4A9N A;  5EP7 A;  2DVV A;  4YBM A;  2G4A A;  4N4G A;  5C89 A;  5FE0 A;  4BJX A;  4HXO A;  4LZR A;  5CQ8 A;  5A5O A;  5E3D A;  5AD2 A;  5EWH A;  4CFK A;  5F5Z A;  4HXR A;  5CUG A;  5BT5 A;  3LXJ A;  4QYD A;  5KHM A;  4QSX A;  2KTB B;  2DVS A;  4NR7 A;  5I40 A;  5F1H A;  1JM4 B;  5BT3 A;  2L85 A;  5E3G A;  4LDF A;  2H60 A;  4QSV A;  1N72 A;  3S91 A;  5A5R A;  4MR4 A;  4N4H A;  5HJC A;  5E9Y A;  5EA1 A;  2R0Y A;  2RS9 B;  2YEM A;  5CQ6 A;  5E0R A;  4HXS A;  3P1C A;  5I7X A;  4YBT A;  5CQ7 A;  5KTW A;  5D0C A;  5LKX A;  5EPR A;  5IG6 A;  4NR8 A;  5I29 A;  5H1U A;  3MXF A;  5IBN A;  5FH7 A;  2I7K A;  5I83 A;  2YDW A;  4XY8 A;  5F61 A;  4QR3 A;  5LKT A;  5HRX A;  3MB3 A;  5D3T A;  5CS8 A;  4UYF A;  2YQD A;  4NRA A;  5FH8 A;  3MB4 A;  2GRC A;  4QZS A;  5AD3 A;  3LQH A;  3I3J A;  5FFW A;  4A9J A;  5ENJ A;  4QSU A;  3U5M A;  4MEO A;  1F68 A;  4LZS A;  4XUA A;  3O33 A;  5FE3 A;  5EPS A;  4MEQ A;  4PCE A;  4YY4 A;  5CQ3 A;  5E73 A;  3U5N A;  5FE6 A;  4YYJ A;  4DON A;  3JVM A;  4Q0O A;  4HXP A;  5EIS A;  2R0S A;  3UVX A;  4UYG A;  4CUT A;  4O76 A;  4XYA A;  5EV9 A;  4N4I A;  5CUB A;  4O77 A;  4Z93 A;  4QY4 A;  4CUQ A;  4IOO A;  3IU5 A;  4HXM A;  5D3J A;  5L98 A;  5LVR A;  5DYA A;  4ZW1 A;  5LJ0 A;  4J3I A;  5D3L A;  5ENH A;  5E9M A;  5K29 A;  4QEU A; 
#chains in the Genus database with same CATH topology
 5LUU A;  2R10 A;  3O36 A;  5A5N A;  3P1F A;  4MR6 A;  5A82 A;  4OUF A;  2L5E A;  4WHU A;  5LKZ A;  1E6I A;  3QZS A;  5CUC A;  3ZYU A;  3D1D A;  4QSR A;  5FE8 A;  3JVJ A;  5CP5 A;  3MUL A;  4UYD A;  4WHW A;  2WP1 A;  4ZC9 A;  4O72 A;  4YAX A;  3U5L A;  5HLS A;  5HQ6 A;  2RI7 A;  5G4S A;  5ENF A;  4NUD A;  5EWW A;  4CFL A;  5IGN A;  4CL9 A;  3MQM A;  4IR4 A;  2DVR A;  5D3H A;  4UYF B;  5FG4 A;  2I8N A;  5HEM A;  4UYH A;  3UVW A;  4HXK A;  4Y03 A;  2R0V A;  3HME A;  2YEL A;  4E96 A;  4QR5 A;  5ACY A;  3LJW A;  4GPJ A;  4O71 A;  4LR6 A;  4YYD A;  5FE2 A;  5CGP A;  3NXB A;  3JVL A;  2E7O A;  4UIZ A;  4YC9 A;  4NS5 A;  4F3I A;  5FG5 A;  4O78 A;  5DKC A;  4A9M A;  4CUU A;  3UW9 A;  5KTU A;  2RFJ A;  3QZT A;  4BW4 A;  5ETB A;  4A9E A;  4Z1Q A;  4NR6 A;  3MUK A;  5D3S A;  5I86 A;  5DFD A;  5C8G A;  5A7C A;  4YAT A;  4O7C A;  4UIW A;  3O37 A;  4LYI A;  4Z1S A;  5E7D A;  5DBM A;  3G0J A;  4NQN A;  4YYN A;  5CRZ A;  4A9O A;  3JVK A;  4TT6 A;  4TQN A;  2E3K A;  5FE4 A;  5FE5 A;  4IR3 A;  5CQ5 A;  5HRW A;  5AME A;  4LC2 A;  4QR4 A;  3U5K A;  2OSS A;  3DAI A;  4KCX A;  4PS5 A;  2D82 A;  3SVF A;  5IGM A;  3ONI A;  5FDZ A;  5HQ5 A;  5A83 A;  4PTB A;  4RVR A;  4YH4 A;  5ENC A;  5EPB A;  5DFB A;  2OUO A;  3HMH A;  3G0L A;  4O7F A;  4NUE A;  3UVY A;  2YEK A;  5I7Y A;  5EM3 A;  4O70 A;  5L96 A;  3P1E A;  2D9E A;  1JSP B;  4BHW A;  4J0R A;  5BT4 A;  3K2J A;  5CQA A;  5DY7 A;  5FFV A;  4N3W A;  4YYH A;  5HFQ A;  4TTE A;  3DWY A;  4HXN A;  5F25 A;  5LVQ A;  4QEW A;  5FBX A;  4BW2 A;  4LYS A;  5D3N A;  4QSP A;  4YBS A;  5DLX A;  4QST A;  1EQF A;  4MEP A;  4AKH A;  4HXL A;  4TS8 A;  2L84 A;  5E9K A;  2DAT A;  5H1V A;  5LKU A;  5ENE A;  5C87 A;  5HQ7 A;  4ALH A;  4QEV A;  2YYN A;  4Z6H A;  5CUA A;  4Z6I A;  5JWM A;  5COI A;  3QZV A;  4TU6 A;  4UIT A;  5E9V A;  5A5S A;  4QNS A;  5HEL A;  3Q2E A;  2RNW A;  5FFY A;  5D3R A;  4NRB A;  4LYW A;  4TU4 A;  3VKH A;  2N9G A;  5EWC A;  5E9I A;  4UIU A;  2LSP B;  4NR9 A;  4AKN A;  5LJ2 A;  4PKL A;  4YH3 A;  3RCW A;  2E7N A;  5A85 A;  5FE9 A;  4A9I A;  5EVA A;  5CUE A;  5CUD A;  1PUO A;  4O7E A;  4CLB A;  5D26 A;  5D24 A;  4TT2 A;  5EWV A;  4AKG A;  2EJN A;  5KTX A;  4YYK A;  5EQ1 A;  4NR5 A;  3IU6 A;  5D7X A;  5F62 A;  2DVQ A;  5ENB A;  3U5J A;  5HEN A;  5CRM A;  3SVG A;  4UIY A;  5C4Q A;  4IOR A;  4NR4 A;  5FE1 A;  4PCI A;  5ENG A;  5DYC A;  5A81 A;  4MR5 A;  4TZ2 A;  4N4F A;  4YAD A;  1WUG A;  5F2P A;  5DKD A;  5DW1 A;  4O74 A;  4ALG A;  3ERR A;  4NRC A;  4PY6 A;  4IR5 A;  5E9L A;  4XY9 A;  5HRV A;  4A9H A;  4ZQL A;  2YW5 A;  3SVH A;  5HM0 A;  4C66 A;  4NQM A;  4HBW A;  4QSQ A;  4NUC A;  4QSW A;  2NXB A;  5A5P A;  2MJV B;  3U5O A;  5LJ1 A;  5F63 A;  3Q2F A;  4TZ8 A;  5C7N A;  2DWW A;  2F6J A;  5D25 A;  5IGK A;  3O35 A;  4NYW A;  4Q0N A;  5I89 A;  5TB6 A;  4X2I A;  5JI8 A;  4CUR A;  5ENI A;  3D7C A;  5CFW A;  4IR6 A;  4NYV A;  5CQ4 A;  5D3P A;  4LZ2 A;  4A9K A;  5G4R A;  5KO4 A;  4J0S A;  3LQI A;  5EK9 A;  4YK0 A;  5L8U A;  3S92 A;  3LQJ A;  5EU1 A;  4UYE A;  4WIV A;  4A9L A;  4YYG A;  4O7A A;  5DX4 A;  4HBY A;  5F3A A;  4CUS A;  5AMF A;  5H1T A;  5FE7 A;  4A9F A;  1X0J A;  4KV1 A;  4LRG A;  4YY6 A;  4J1P A;  5L99 A;  3VKG A;  4QB3 A;  1ZS5 A;  3UV2 A;  5IGL A;  5DYX A;  2RNY A;  4QSS A;  4QUU A;  4OGI A;  5EIC A;  4HBV A;  3HMF A;  4TT4 A;  5F36 A;  5FB0 A;  5DLZ A;  5C85 A;  2OO1 A;  5CZG A;  3FKM X;  4NXJ A;  4O7B A;  4UIX A;  2FSA A;  5J0D A;  4YAB A;  5II2 A;  3UV4 A;  2RNX A;  4YYI A;  4YYM A;  3O34 A;  5FH6 A;  4CUP A;  2WP2 A;  5DYU A;  4XUB A;  5TCM A;  3TLP A;  4O75 A;  2RO1 A;  4MR3 A;  5DKH A;  3P1D A;  4AKI A;  3UVD A;  1WUM A;  5CY9 A;  4BW3 A;  5F60 A;  4QUT A;  4QYL A;  4UIV A;  4KV4 A;  4TYL A;  5F1L A;  4QC1 A;  5FB1 A;  5HFR A;  5EWD A;  5DFC A;  5CTL A;  5HCL A;  3U5P A;  4IOQ A;  5E74 A;  5EI4 A;  5L97 A;  5I88 A;  3AQA A;  4NYX A;  5IID A;  4MEN A;  5CQT A;  5EGU A;  4C67 A;  3AAD A;  5I80 A;  5I1Q A;  4BW1 A;  4QBM A;  5CU8 A;  4FLP A;  4QC3 A;  5A5Q A;  4HBX A;  5FG6 A;  2F6N A;  3GG3 A;  5H85 A;  2DKW A;  5L8T A;  5II1 A;  5ETD A;  5DW2 A;  3P5O A;  4OGJ A;  3UV5 A;  5KU3 A;  5CPE A;  4A9N A;  5EP7 A;  2DVV A;  4YBM A;  2G4A A;  4N4G A;  5C89 A;  5FE0 A;  4BJX A;  4HXO A;  4LZR A;  5CQ8 A;  5A5O A;  5E3D A;  5AD2 A;  5EWH A;  4CFK A;  5F5Z A;  4HXR A;  5CUG A;  5BT5 A;  3LXJ A;  4QYD A;  5KHM A;  4QSX A;  2KTB B;  2DVS A;  4NR7 A;  5I40 A;  5F1H A;  1JM4 B;  5BT3 A;  2L85 A;  5E3G A;  4LDF A;  2H60 A;  4QSV A;  1N72 A;  3S91 A;  5A5R A;  4MR4 A;  4N4H A;  5HJC A;  5E9Y A;  5EA1 A;  2R0Y A;  2RS9 B;  2YEM A;  5CQ6 A;  5E0R A;  4HXS A;  3P1C A;  5I7X A;  4YBT A;  5CQ7 A;  5KTW A;  5D0C A;  5LKX A;  5EPR A;  5IG6 A;  4NR8 A;  5I29 A;  5H1U A;  3MXF A;  5IBN A;  5FH7 A;  2I7K A;  5I83 A;  2YDW A;  4XY8 A;  5F61 A;  4QR3 A;  5LKT A;  5HRX A;  3MB3 A;  5D3T A;  5CS8 A;  4UYF A;  2YQD A;  4NRA A;  5FH8 A;  3MB4 A;  2GRC A;  4QZS A;  5AD3 A;  3LQH A;  3I3J A;  4AI6 A;  5FFW A;  4A9J A;  5ENJ A;  4QSU A;  3U5M A;  4MEO A;  3D1B A;  1F68 A;  4LZS A;  4XUA A;  3O33 A;  5FE3 A;  5EPS A;  4MEQ A;  4PCE A;  4YY4 A;  1ZKR A;  5CQ3 A;  5E73 A;  3U5N A;  5FE6 A;  4YYJ A;  4DON A;  3JVM A;  4Q0O A;  4HXP A;  5EIS A;  2R0S A;  3UVX A;  4UYG A;  4CUT A;  4O76 A;  4XYA A;  5EV9 A;  4N4I A;  5CUB A;  4O77 A;  4Z93 A;  4QY4 A;  4CUQ A;  4IOO A;  3IU5 A;  4HXM A;  5D3J A;  5L98 A;  5LVR A;  5DYA A;  4ZW1 A;  5LJ0 A;  4J3I A;  5D3L A;  5ENH A;  5E9M A;  5K29 A;  4QEU A; 
#chains in the Genus database with same CATH homology
 5LUU A;  2R10 A;  3O36 A;  5A5N A;  3P1F A;  4MR6 A;  5A82 A;  4OUF A;  2L5E A;  4WHU A;  5LKZ A;  1E6I A;  3QZS A;  5CUC A;  3ZYU A;  4QSR A;  5FE8 A;  3JVJ A;  5CP5 A;  3MUL A;  4UYD A;  4WHW A;  2WP1 A;  4ZC9 A;  4O72 A;  4YAX A;  3U5L A;  5HLS A;  5HQ6 A;  2RI7 A;  5G4S A;  5ENF A;  4NUD A;  5EWW A;  4CFL A;  5IGN A;  4CL9 A;  3MQM A;  4IR4 A;  2DVR A;  5D3H A;  4UYF B;  5FG4 A;  2I8N A;  5HEM A;  4UYH A;  3UVW A;  4HXK A;  4Y03 A;  2R0V A;  3HME A;  2YEL A;  4E96 A;  4QR5 A;  5ACY A;  3LJW A;  4GPJ A;  4O71 A;  4LR6 A;  4YYD A;  5FE2 A;  5CGP A;  3NXB A;  3JVL A;  2E7O A;  4UIZ A;  4YC9 A;  4NS5 A;  4F3I A;  5FG5 A;  4O78 A;  5DKC A;  4A9M A;  4CUU A;  3UW9 A;  5KTU A;  2RFJ A;  3QZT A;  4BW4 A;  5ETB A;  4A9E A;  4Z1Q A;  4NR6 A;  3MUK A;  5D3S A;  5I86 A;  5DFD A;  5C8G A;  5A7C A;  4YAT A;  4O7C A;  4UIW A;  3O37 A;  4LYI A;  4Z1S A;  5E7D A;  5DBM A;  3G0J A;  4NQN A;  4YYN A;  5CRZ A;  4A9O A;  3JVK A;  4TT6 A;  4TQN A;  2E3K A;  5FE4 A;  5FE5 A;  4IR3 A;  5CQ5 A;  5HRW A;  5AME A;  4LC2 A;  4QR4 A;  3U5K A;  2OSS A;  3DAI A;  4KCX A;  4PS5 A;  2D82 A;  3SVF A;  5IGM A;  3ONI A;  5FDZ A;  5HQ5 A;  5A83 A;  4PTB A;  4RVR A;  4YH4 A;  5ENC A;  5EPB A;  5DFB A;  2OUO A;  3HMH A;  3G0L A;  4O7F A;  4NUE A;  3UVY A;  2YEK A;  5I7Y A;  5EM3 A;  4O70 A;  5L96 A;  3P1E A;  2D9E A;  1JSP B;  4BHW A;  4J0R A;  5BT4 A;  3K2J A;  5CQA A;  5DY7 A;  5FFV A;  4N3W A;  4YYH A;  5HFQ A;  4TTE A;  3DWY A;  4HXN A;  5F25 A;  5LVQ A;  4QEW A;  5FBX A;  4BW2 A;  4LYS A;  5D3N A;  4QSP A;  4YBS A;  5DLX A;  4QST A;  1EQF A;  4MEP A;  4HXL A;  4TS8 A;  2L84 A;  5E9K A;  2DAT A;  5H1V A;  5LKU A;  5ENE A;  5C87 A;  5HQ7 A;  4ALH A;  4QEV A;  2YYN A;  4Z6H A;  5CUA A;  4Z6I A;  5JWM A;  5COI A;  3QZV A;  4TU6 A;  4UIT A;  5E9V A;  5A5S A;  4QNS A;  5HEL A;  3Q2E A;  2RNW A;  5FFY A;  5D3R A;  4NRB A;  4LYW A;  4TU4 A;  2N9G A;  5EWC A;  5E9I A;  4UIU A;  2LSP B;  4NR9 A;  4AKN A;  5LJ2 A;  4PKL A;  4YH3 A;  3RCW A;  2E7N A;  5A85 A;  5FE9 A;  4A9I A;  5EVA A;  5CUE A;  5CUD A;  4O7E A;  4CLB A;  5D26 A;  5D24 A;  4TT2 A;  5EWV A;  5KTX A;  4YYK A;  5EQ1 A;  4NR5 A;  3IU6 A;  5D7X A;  5F62 A;  2DVQ A;  5ENB A;  3U5J A;  5HEN A;  5CRM A;  3SVG A;  4UIY A;  5C4Q A;  4IOR A;  4NR4 A;  5FE1 A;  4PCI A;  5ENG A;  5DYC A;  5A81 A;  4MR5 A;  4TZ2 A;  4N4F A;  4YAD A;  1WUG A;  5F2P A;  5DKD A;  5DW1 A;  4O74 A;  4ALG A;  4NRC A;  4PY6 A;  4IR5 A;  5E9L A;  4XY9 A;  5HRV A;  4A9H A;  4ZQL A;  2YW5 A;  3SVH A;  5HM0 A;  4C66 A;  4NQM A;  4HBW A;  4QSQ A;  4NUC A;  4QSW A;  2NXB A;  5A5P A;  2MJV B;  3U5O A;  5LJ1 A;  5F63 A;  3Q2F A;  4TZ8 A;  5C7N A;  2DWW A;  2F6J A;  5D25 A;  5IGK A;  3O35 A;  4NYW A;  4Q0N A;  5I89 A;  5TB6 A;  4X2I A;  5JI8 A;  4CUR A;  5ENI A;  3D7C A;  5CFW A;  4IR6 A;  4NYV A;  5CQ4 A;  5D3P A;  4LZ2 A;  4A9K A;  5G4R A;  5KO4 A;  4J0S A;  3LQI A;  5EK9 A;  4YK0 A;  5L8U A;  3S92 A;  3LQJ A;  5EU1 A;  4UYE A;  4WIV A;  4A9L A;  4YYG A;  4O7A A;  5DX4 A;  4HBY A;  5F3A A;  4CUS A;  5AMF A;  5H1T A;  5FE7 A;  4A9F A;  1X0J A;  4KV1 A;  4LRG A;  4YY6 A;  4J1P A;  5L99 A;  4QB3 A;  1ZS5 A;  3UV2 A;  5IGL A;  5DYX A;  2RNY A;  4QSS A;  4QUU A;  4OGI A;  5EIC A;  4HBV A;  3HMF A;  4TT4 A;  5F36 A;  5FB0 A;  5DLZ A;  5C85 A;  2OO1 A;  5CZG A;  3FKM X;  4NXJ A;  4O7B A;  4UIX A;  2FSA A;  5J0D A;  4YAB A;  5II2 A;  3UV4 A;  2RNX A;  4YYI A;  4YYM A;  3O34 A;  5FH6 A;  4CUP A;  2WP2 A;  5DYU A;  4XUB A;  5TCM A;  3TLP A;  4O75 A;  2RO1 A;  4MR3 A;  5DKH A;  3P1D A;  3UVD A;  1WUM A;  5CY9 A;  4BW3 A;  5F60 A;  4QUT A;  4QYL A;  4UIV A;  4KV4 A;  4TYL A;  5F1L A;  4QC1 A;  5FB1 A;  5HFR A;  5EWD A;  5DFC A;  5CTL A;  5HCL A;  3U5P A;  4IOQ A;  5E74 A;  5EI4 A;  5L97 A;  5I88 A;  3AQA A;  4NYX A;  5IID A;  4MEN A;  5CQT A;  5EGU A;  4C67 A;  3AAD A;  5I80 A;  5I1Q A;  4BW1 A;  4QBM A;  5CU8 A;  4FLP A;  4QC3 A;  5A5Q A;  4HBX A;  5FG6 A;  2F6N A;  3GG3 A;  5H85 A;  2DKW A;  5L8T A;  5II1 A;  5ETD A;  5DW2 A;  3P5O A;  4OGJ A;  3UV5 A;  5KU3 A;  5CPE A;  4A9N A;  5EP7 A;  2DVV A;  4YBM A;  2G4A A;  4N4G A;  5C89 A;  5FE0 A;  4BJX A;  4HXO A;  4LZR A;  5CQ8 A;  5A5O A;  5E3D A;  5AD2 A;  5EWH A;  4CFK A;  5F5Z A;  4HXR A;  5CUG A;  5BT5 A;  3LXJ A;  4QYD A;  5KHM A;  4QSX A;  2KTB B;  2DVS A;  4NR7 A;  5I40 A;  5F1H A;  1JM4 B;  5BT3 A;  2L85 A;  5E3G A;  4LDF A;  2H60 A;  4QSV A;  1N72 A;  3S91 A;  5A5R A;  4MR4 A;  4N4H A;  5HJC A;  5E9Y A;  5EA1 A;  2R0Y A;  2RS9 B;  2YEM A;  5CQ6 A;  5E0R A;  4HXS A;  3P1C A;  5I7X A;  4YBT A;  5CQ7 A;  5KTW A;  5D0C A;  5LKX A;  5EPR A;  5IG6 A;  4NR8 A;  5I29 A;  5H1U A;  3MXF A;  5IBN A;  5FH7 A;  2I7K A;  5I83 A;  2YDW A;  4XY8 A;  5F61 A;  4QR3 A;  5LKT A;  5HRX A;  3MB3 A;  5D3T A;  5CS8 A;  4UYF A;  2YQD A;  4NRA A;  5FH8 A;  3MB4 A;  2GRC A;  4QZS A;  5AD3 A;  3LQH A;  3I3J A;  5FFW A;  4A9J A;  5ENJ A;  4QSU A;  3U5M A;  4MEO A;  1F68 A;  4LZS A;  4XUA A;  3O33 A;  5FE3 A;  5EPS A;  4MEQ A;  4PCE A;  4YY4 A;  5CQ3 A;  5E73 A;  3U5N A;  5FE6 A;  4YYJ A;  4DON A;  3JVM A;  4Q0O A;  4HXP A;  5EIS A;  2R0S A;  3UVX A;  4UYG A;  4CUT A;  4O76 A;  4XYA A;  5EV9 A;  4N4I A;  5CUB A;  4O77 A;  4Z93 A;  4QY4 A;  4CUQ A;  4IOO A;  3IU5 A;  4HXM A;  5D3J A;  5L98 A;  5LVR A;  5DYA A;  4ZW1 A;  5LJ0 A;  4J3I A;  5D3L A;  5ENH A;  5E9M A;  5K29 A;  4QEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...