1WUMA

Complex structure of pcaf bromodomain with small chemical ligand np2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase PCAF
publication title Selective small molecules blocking HIV-1 Tat and coactivator PCAF association
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 118
sequence length 118
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1wumA00
3O36A 4QYLA 5F36A 2YQDA 4UYGA 4O71A 3P1FA 4OGIA 4A9NA 4O75A 4NUDA 4J3IA 4WHWA 5E9KA 2WP2A 3UV5A 5H85A 3QZTA 4XYAA 4C67A 2F6JA 2D82A 5CPEA 5HFQA 4TU6A 3NXBA 3P5OA 5FE9A 4A9LA 5EI4A 3MXFA 4LDFA 5HQ6A 5L99A 5IGLA 2YELA 4E96A 2FSAA 3G0LA 4QUTA 4QSPA 5KTXA 5CU8A 5K29A 3IU5A 5HRXA 4QR3A 5C7NA 4A9EA 5C85A 4YYHA 4NR5A 5COIA 4NYWA 5IGMA 4QSQA 5LVQA 5HCLA 5HRVA 4XUBA 4QC3A 3HMHA 4MR4A 4TZ8A 5H1VA 4TYLA 5EK9A 4NR8A 5D3HA 4QSXA 5D3TA 5F5ZA 4CURA 2DVVA 4YY6A 4CFLA 1JSPB 5KTUA 5CS8A 3U5JA 4J0SA 3AADA 4IOQA 5DYXA 2DWWA 3LXJA 5BT4A 5E74A 4YC9A 5ENHA 5F3AA 2R0YA 5E9YA 3GG3A 2OUOA 5HFRA 5CGPA 3SVFA 1X0JA 4ALHA 4HXKA 3HMEA 4NS5A 2I8NA 5AMEA 2LSPB 5IGNA 2F6NA 5KTWA 5FE1A 4CFKA 2RI7A 5F1HA 4BHWA 4O72A 5IBNA 5EPRA 5DLZA 5JWMA 3O33A 5E7DA 5CUGA 5BT5A 5CP5A 4BW1A 5FG4A 5EWDA 3P1CA 2DVRA 5ENGA 4QSVA 2R0SA 4O77A 4BW4A 3O35A 4Z6IA 4Y03A 3S92A 4QZSA 3TLPA 4YBMA 4ZC9A 4BW2A 4OGJA 4O76A 2L84A 5C4QA 5E3GA 4UIYA 4PCIA 4IR3A 5CY9A 5EM3A 2RO1A 3D7CA 5E9IA 5FDZA 5H1TA 5CQTA 4QSWA 4O74A 4WHUA 4QSSA 4MR6A 4WIVA 4BW3A 4HBYA 5EVAA 3SVHA 5L97A 4NXJA 5HEMA 4PTBA 4O7BA 5E9VA 5AMFA 4TS8A 2E7OA 4NRAA 4KV4A 3LQIA 5EPBA 4O70A 4CL9A 4KV1A 5CUCA 3Q2FA 2R10A 4UITA 4A9FA 3RCWA 4LC2A 2DVSA 4BJXA 4AKNA 5CQ8A 2OSSA 4YYIA 5CUDA 5HRWA 5G4RA 3MULA 5A81A 5AD3A 4LZSA 4NYVA 5CQ5A 4UIZA 5EISA 5F25A 5EGUA 4J1PA 1N72A 1EQFA 5I29A 5FFYA 4Z93A 1E6IA 4Z1QA 5CZGA 4A9IA 2R0VA 5HQ7A 5I89A 4NUEA 3G0JA 5CRMA 4YH4A 4ZW1A 5C89A 4MEPA 4CUSA 4KCXA 5IGKA 5FE7A 4LZRA 4UIVA 3UV2A 4HXRA 5DFBA 4YYJA 3S91A 4LYWA 4XY8A 2YYNA 5TCMA 5DX4A 4NR4A 4QSUA 5LKXA 5F62A 5EQ1A 4RVRA 4O7EA 3MB4A 5FE4A 4HXNA 5D3PA 5FB1A 2E7NA 2YEMA 3MQMA 5D26A 4N4GA 4YYGA 4NUCA 5CUEA 2RNXA 5CQ6A 3LQJA 4LYSA 4MEOA 4QR5A 4UIXA 5FBXA 4TT4A 5II2A 5CQ4A 4NRBA 5A7CA 5LKTA 2GRCA 5TB6A 4LZ2A 3ZYUA 2OO1A 4N4HA 4UYDA 3U5KA 5EWHA 4MR3A 5FE2A 5EA1A 3UVYA 4TTEA 5FE6A 4CUUA 5E3DA 4F3IA 3LJWA 4IR5A 4HXPA 5H1UA 5I7XA 5FE0A 2KTBB 4Q0NA 3P1EA 5I40A 5AD2A 4QUUA 5CQ7A 5EWVA 5A5NA 2DVQA 4YK0A 5C8GA 4PY6A 5KU3A 5DFDA 5G4SA 5E9LA 4TT2A 5DY7A 5A5RA 4HXOA 5HQ5A 4YYMA 2RS9B 4XUAA 4YBSA 3U5MA 3LQHA 5JI8A 5DYAA 4OUFA 5HJCA 5C87A 5DYCA 4UYHA 3AQAA 5ENFA 4UYFA 4YABA 5LKZA 5L8TA 5LVRA 4HBVA 4NQNA 4QR4A 2H60A 4YATA 4PCEA 5E9MA 5EP7A 5LJ0A 4QSRA 2DKWA 4NR9A 2D9EA 2RNWA 5ENEA 4UYEA 5DKHA 2L5EA 2MJVB 4TT6A 5A83A 3HMFA 3U5NA 4PS5A 5FH7A 5I88A 4LRGA 4PKLA 4LR6A 5FG5A 5DW1A 5F61A 5DW2A 4IORA 2N9GA 1F68A 2WP1A 5A85A 5CUAA 5EWWA 4CUPA 5D25A 5CRZA 5EICA 4A9JA 5A82A 2G4AA 1JM4B 4NQMA 4O7AA 4CUQA 5FG6A 4J0RA 5J0DA 5BT3A 5LJ2A 3P1DA 4LYIA 5E0RA 4YBTA 5A5QA 4Z6HA 4MEQA 5D3LA 5F1LA 5I1QA 1ZS5A 4YH3A 5LUUA 5FE5A 4IOOA 5HENA 3UVXA 4N4FA 5FFVA 5I80A 4HXMA 4IR6A 5F63A 4N4IA 5D3JA 3ONIA 4NR6A 4MR5A 4O7FA 4FLPA 5KHMA 5L8UA 5CQ3A 3DAIA 4A9KA 2YDWA 3K2JA 4QNSA 3JVJA 5FH8A 5EU1A 3QZSA 3JVLA 3I3JA 5DKDA 5FE3A 3U5OA 2RFJA 5EPSA 5I7YA 4A9HA 4QB3A 3JVKA 5A5PA 5D3SA 4QEUA 4NRCA 4O7CA 5D3RA 1WUMA 4NYXA 3MUKA 5ETDA 5HM0A 4ZQLA 2NXBA 4IR4A 4YYKA 5L96A 4YYDA 4HXSA 4YADA 5HLSA 2YEKA 2RNYA 4O78A 5DYUA 4ALGA 4TZ2A 5D3NA 3U5PA 3QZVA 4A9MA 5L98A 5D7XA 3FKMX 5D0CA 3Q2EA 5ENCA 3O34A 4QC1A 5ENJA 4Q0OA 5ENIA 5A5SA 5DLXA 4QEVA 5DFCA 3UV4A 5I83A 3U5LA 5LJ1A 5LKUA 4HBXA 3DWYA 5DBMA 5IIDA 4CLBA 5HELA 5IG6A 4QEWA 4UIUA 4NR7A 3UW9A 4UIWA 5F2PA 4GPJA 4CUTA 4DONA 5A5OA 4C66A 3IU6A 3JVMA 4X2IA 3UVDA 5DKCA 4YYNA 2L85A 4UYFB 5EWCA 2I7KA 4QSTA 4N3WA 5FH6A 5CUBA 5F60A 4TQNA 4XY9A 4QBMA 5CTLA 5CFWA 4HBWA 3SVGA 3MB3A 5ACYA 5E73A 5FB0A 5EV9A 5KO4A 5CQAA 3UVWA 4YAXA 5ENBA 4A9OA 4HXLA 4QY4A 4TU4A 5ETBA 5I86A 4QYDA 2YW5A 4YY4A 2E3KA 2DATA 4MENA 5D24A 5FFWA 4Z1SA 5II1A 1WUGA 5FE8A 3O37A
chains in the Genus database with same CATH superfamily
3O36A 4QYLA 5F36A 2YQDA 4UYGA 4O71A 3P1FA 4OGIA 4A9NA 4O75A 4NUDA 4J3IA 3VKHA 4WHWA 5E9KA 2WP2A 3UV5A 5H85A 3QZTA 4XYAA 4C67A 2F6JA 2D82A 5CPEA 5HFQA 4TU6A 3D1DA 3NXBA 3P5OA 5FE9A 4A9LA 5EI4A 3MXFA 4LDFA 5HQ6A 5L99A 5IGLA 2YELA 4E96A 2FSAA 3G0LA 4QUTA 4QSPA 5KTXA 5CU8A 5K29A 3IU5A 5HRXA 4QR3A 5C7NA 4A9EA 5C85A 4YYHA 4NR5A 5COIA 4NYWA 5IGMA 4QSQA 5LVQA 5HCLA 5HRVA 4XUBA 4QC3A 3HMHA 4MR4A 4AKGA 4TZ8A 5H1VA 4TYLA 5EK9A 4NR8A 5D3HA 4QSXA 5D3TA 5F5ZA 4CURA 2DVVA 4YY6A 4CFLA 1JSPB 5KTUA 5CS8A 3U5JA 4J0SA 3AADA 4IOQA 5DYXA 2DWWA 3LXJA 5BT4A 5E74A 4YC9A 5ENHA 5F3AA 2R0YA 5E9YA 3VKGA 3GG3A 2OUOA 5HFRA 5CGPA 3SVFA 1X0JA 4ALHA 4HXKA 3HMEA 4NS5A 2I8NA 5AMEA 2LSPB 5IGNA 2F6NA 5KTWA 5FE1A 4CFKA 2RI7A 5F1HA 4BHWA 4O72A 5IBNA 5EPRA 5DLZA 5JWMA 3O33A 5E7DA 5CUGA 5BT5A 5CP5A 4BW1A 5FG4A 5EWDA 3P1CA 2DVRA 5ENGA 4QSVA 2R0SA 4O77A 4BW4A 3O35A 4Z6IA 4Y03A 3S92A 4QZSA 3TLPA 4YBMA 4ZC9A 4BW2A 4OGJA 4AI6A 4O76A 2L84A 5C4QA 5E3GA 4UIYA 4PCIA 4IR3A 3ERRA 5CY9A 5EM3A 2RO1A 3D7CA 5E9IA 5FDZA 5H1TA 5CQTA 4QSWA 4O74A 4WHUA 4QSSA 4MR6A 4WIVA 4BW3A 4HBYA 5EVAA 3SVHA 5L97A 4NXJA 5HEMA 4PTBA 4O7BA 5E9VA 5AMFA 4TS8A 2E7OA 4NRAA 4KV4A 3LQIA 5EPBA 4O70A 4CL9A 4AKIA 4KV1A 5CUCA 3Q2FA 2R10A 3D1BA 4UITA 4A9FA 3RCWA 4LC2A 2DVSA 4BJXA 4AKNA 5CQ8A 2OSSA 4YYIA 5CUDA 5HRWA 5G4RA 3MULA 5A81A 5AD3A 4LZSA 4NYVA 5CQ5A 4UIZA 5EISA 5F25A 5EGUA 4J1PA 1N72A 1EQFA 5I29A 5FFYA 4Z93A 1E6IA 4Z1QA 5CZGA 4A9IA 2R0VA 5HQ7A 5I89A 4NUEA 3G0JA 5CRMA 4YH4A 4ZW1A 5C89A 4MEPA 4CUSA 4KCXA 5IGKA 5FE7A 4LZRA 4UIVA 3UV2A 4HXRA 5DFBA 4YYJA 3S91A 4LYWA 4XY8A 2YYNA 5TCMA 5DX4A 4NR4A 4QSUA 5LKXA 5F62A 5EQ1A 4RVRA 4AKHA 4O7EA 3MB4A 5FE4A 4HXNA 5D3PA 5FB1A 2E7NA 2YEMA 3MQMA 5D26A 4N4GA 4YYGA 4NUCA 5CUEA 2RNXA 5CQ6A 3LQJA 4LYSA 4MEOA 4QR5A 4UIXA 5FBXA 4TT4A 5II2A 2EJNA 5CQ4A 4NRBA 5A7CA 5LKTA 2GRCA 5TB6A 4LZ2A 3ZYUA 2OO1A 4N4HA 4UYDA 3U5KA 5EWHA 4MR3A 5FE2A 5EA1A 3UVYA 4TTEA 5FE6A 4CUUA 5E3DA 4F3IA 3LJWA 4IR5A 4HXPA 5H1UA 5I7XA 5FE0A 2KTBB 4Q0NA 3P1EA 5I40A 5AD2A 4QUUA 5CQ7A 5EWVA 5A5NA 2DVQA 4YK0A 5C8GA 4PY6A 5KU3A 5DFDA 5G4SA 5E9LA 4TT2A 5DY7A 5A5RA 4HXOA 5HQ5A 4YYMA 2RS9B 4XUAA 4YBSA 3U5MA 3LQHA 5JI8A 5DYAA 4OUFA 5HJCA 5C87A 5DYCA 4UYHA 3AQAA 5ENFA 4UYFA 4YABA 5LKZA 5L8TA 5LVRA 4HBVA 4NQNA 4QR4A 2H60A 4YATA 4PCEA 5E9MA 5EP7A 5LJ0A 4QSRA 2DKWA 4NR9A 2D9EA 2RNWA 5ENEA 4UYEA 5DKHA 2L5EA 2MJVB 4TT6A 5A83A 3HMFA 3U5NA 4PS5A 5FH7A 5I88A 4LRGA 4PKLA 4LR6A 5FG5A 5DW1A 5F61A 5DW2A 4IORA 2N9GA 1F68A 2WP1A 5A85A 5CUAA 5EWWA 4CUPA 5D25A 5CRZA 5EICA 4A9JA 5A82A 2G4AA 1JM4B 4NQMA 4O7AA 4CUQA 5FG6A 4J0RA 5J0DA 5BT3A 5LJ2A 3P1DA 4LYIA 5E0RA 4YBTA 5A5QA 4Z6HA 4MEQA 5D3LA 5F1LA 5I1QA 1ZS5A 4YH3A 5LUUA 5FE5A 4IOOA 5HENA 3UVXA 4N4FA 5FFVA 5I80A 4HXMA 4IR6A 5F63A 4N4IA 5D3JA 3ONIA 4NR6A 1PUOA 4MR5A 4O7FA 4FLPA 5KHMA 5L8UA 5CQ3A 3DAIA 4A9KA 2YDWA 3K2JA 4QNSA 3JVJA 5FH8A 5EU1A 3QZSA 3JVLA 3I3JA 5DKDA 5FE3A 3U5OA 2RFJA 5EPSA 5I7YA 1ZKRA 4A9HA 4QB3A 3JVKA 5A5PA 5D3SA 4QEUA 4NRCA 4O7CA 5D3RA 1WUMA 4NYXA 3MUKA 5ETDA 5HM0A 4ZQLA 2NXBA 4IR4A 4YYKA 5L96A 4YYDA 4HXSA 4YADA 5HLSA 2YEKA 2RNYA 4O78A 5DYUA 4ALGA 4TZ2A 5D3NA 3U5PA 3QZVA 4A9MA 5L98A 5D7XA 3FKMX 5D0CA 3Q2EA 5ENCA 3O34A 4QC1A 5ENJA 4Q0OA 5ENIA 5A5SA 5DLXA 4QEVA 5DFCA 3UV4A 5I83A 3U5LA 5LJ1A 5LKUA 4HBXA 3DWYA 5DBMA 5IIDA 4CLBA 5HELA 5IG6A 4QEWA 4UIUA 4NR7A 3UW9A 4UIWA 5F2PA 4GPJA 4CUTA 4DONA 5A5OA 4C66A 3IU6A 3JVMA 4X2IA 3UVDA 5DKCA 4YYNA 2L85A 4UYFB 5EWCA 2I7KA 4QSTA 4N3WA 5FH6A 5CUBA 5F60A 4TQNA 4XY9A 4QBMA 5CTLA 5CFWA 4HBWA 3SVGA 3MB3A 5ACYA 5E73A 5FB0A 5EV9A 5KO4A 5CQAA 3UVWA 4YAXA 5ENBA 4A9OA 4HXLA 4QY4A 4TU4A 5ETBA 5I86A 4QYDA 2YW5A 4YY4A 2E3KA 2DATA 4MENA 5D24A 5FFWA 4Z1SA 5II1A 1WUGA 5FE8A 3O37A
chains in the Genus database with same CATH topology
3O36A 4QYLA 5F36A 2YQDA 4UYGA 4O71A 3P1FA 4OGIA 4A9NA 4O75A 4NUDA 4J3IA 4WHWA 5E9KA 2WP2A 3UV5A 5H85A 3QZTA 4XYAA 4C67A 2F6JA 2D82A 5CPEA 5HFQA 4TU6A 3NXBA 3P5OA 5FE9A 4A9LA 5EI4A 3MXFA 4LDFA 5HQ6A 5L99A 5IGLA 2YELA 4E96A 2FSAA 3G0LA 4QUTA 4QSPA 5KTXA 5CU8A 5K29A 3IU5A 5HRXA 4QR3A 5C7NA 4A9EA 5C85A 4YYHA 4NR5A 5COIA 4NYWA 5IGMA 4QSQA 5LVQA 5HCLA 5HRVA 4XUBA 4QC3A 3HMHA 4MR4A 4TZ8A 5H1VA 4TYLA 5EK9A 4NR8A 5D3HA 4QSXA 5D3TA 5F5ZA 4CURA 2DVVA 4YY6A 4CFLA 1JSPB 5KTUA 5CS8A 3U5JA 4J0SA 3AADA 4IOQA 5DYXA 2DWWA 3LXJA 5BT4A 5E74A 4YC9A 5ENHA 5F3AA 2R0YA 5E9YA 3GG3A 2OUOA 5HFRA 5CGPA 3SVFA 1X0JA 4ALHA 4HXKA 3HMEA 4NS5A 2I8NA 5AMEA 2LSPB 5IGNA 2F6NA 5KTWA 5FE1A 4CFKA 2RI7A 5F1HA 4BHWA 4O72A 5IBNA 5EPRA 5DLZA 5JWMA 3O33A 5E7DA 5CUGA 5BT5A 5CP5A 4BW1A 5FG4A 5EWDA 3P1CA 2DVRA 5ENGA 4QSVA 2R0SA 4O77A 4BW4A 3O35A 4Z6IA 4Y03A 3S92A 4QZSA 3TLPA 4YBMA 4ZC9A 4BW2A 4OGJA 4O76A 2L84A 5C4QA 5E3GA 4UIYA 4PCIA 4IR3A 5CY9A 5EM3A 2RO1A 3D7CA 5E9IA 5FDZA 5H1TA 5CQTA 4QSWA 4O74A 4WHUA 4QSSA 4MR6A 4WIVA 4BW3A 4HBYA 5EVAA 3SVHA 5L97A 4NXJA 5HEMA 4PTBA 4O7BA 5E9VA 5AMFA 4TS8A 2E7OA 4NRAA 4KV4A 3LQIA 5EPBA 4O70A 4CL9A 4KV1A 5CUCA 3Q2FA 2R10A 4UITA 4A9FA 3RCWA 4LC2A 2DVSA 4BJXA 4AKNA 5CQ8A 2OSSA 4YYIA 5CUDA 5HRWA 5G4RA 3MULA 5A81A 5AD3A 4LZSA 4NYVA 5CQ5A 4UIZA 5EISA 5F25A 5EGUA 4J1PA 1N72A 1EQFA 5I29A 5FFYA 4Z93A 1E6IA 4Z1QA 5CZGA 4A9IA 2R0VA 5HQ7A 5I89A 4NUEA 3G0JA 5CRMA 4YH4A 4ZW1A 5C89A 4MEPA 4CUSA 4KCXA 5IGKA 5FE7A 4LZRA 4UIVA 3UV2A 4HXRA 5DFBA 4YYJA 3S91A 4LYWA 4XY8A 2YYNA 5TCMA 5DX4A 4NR4A 4QSUA 5LKXA 5F62A 5EQ1A 4RVRA 4O7EA 3MB4A 5FE4A 4HXNA 5D3PA 5FB1A 2E7NA 2YEMA 3MQMA 5D26A 4N4GA 4YYGA 4NUCA 5CUEA 2RNXA 5CQ6A 3LQJA 4LYSA 4MEOA 4QR5A 4UIXA 5FBXA 4TT4A 5II2A 5CQ4A 4NRBA 5A7CA 5LKTA 2GRCA 5TB6A 4LZ2A 3ZYUA 2OO1A 4N4HA 4UYDA 3U5KA 5EWHA 4MR3A 5FE2A 5EA1A 3UVYA 4TTEA 5FE6A 4CUUA 5E3DA 4F3IA 3LJWA 4IR5A 4HXPA 5H1UA 5I7XA 5FE0A 2KTBB 4Q0NA 3P1EA 5I40A 5AD2A 4QUUA 5CQ7A 5EWVA 5A5NA 2DVQA 4YK0A 5C8GA 4PY6A 5KU3A 5DFDA 5G4SA 5E9LA 4TT2A 5DY7A 5A5RA 4HXOA 5HQ5A 4YYMA 2RS9B 4XUAA 4YBSA 3U5MA 3LQHA 5JI8A 5DYAA 4OUFA 5HJCA 5C87A 5DYCA 4UYHA 3AQAA 5ENFA 4UYFA 4YABA 5LKZA 5L8TA 5LVRA 4HBVA 4NQNA 4QR4A 2H60A 4YATA 4PCEA 5E9MA 5EP7A 5LJ0A 4QSRA 2DKWA 4NR9A 2D9EA 2RNWA 5ENEA 4UYEA 5DKHA 2L5EA 2MJVB 4TT6A 5A83A 3HMFA 3U5NA 4PS5A 5FH7A 5I88A 4LRGA 4PKLA 4LR6A 5FG5A 5DW1A 5F61A 5DW2A 4IORA 2N9GA 1F68A 2WP1A 5A85A 5CUAA 5EWWA 4CUPA 5D25A 5CRZA 5EICA 4A9JA 5A82A 2G4AA 1JM4B 4NQMA 4O7AA 4CUQA 5FG6A 4J0RA 5J0DA 5BT3A 5LJ2A 3P1DA 4LYIA 5E0RA 4YBTA 5A5QA 4Z6HA 4MEQA 5D3LA 5F1LA 5I1QA 1ZS5A 4YH3A 5LUUA 5FE5A 4IOOA 5HENA 3UVXA 4N4FA 5FFVA 5I80A 4HXMA 4IR6A 5F63A 4N4IA 5D3JA 3ONIA 4NR6A 4MR5A 4O7FA 4FLPA 5KHMA 5L8UA 5CQ3A 3DAIA 4A9KA 2YDWA 3K2JA 4QNSA 3JVJA 5FH8A 5EU1A 3QZSA 3JVLA 3I3JA 5DKDA 5FE3A 3U5OA 2RFJA 5EPSA 5I7YA 4A9HA 4QB3A 3JVKA 5A5PA 5D3SA 4QEUA 4NRCA 4O7CA 5D3RA 1WUMA 4NYXA 3MUKA 5ETDA 5HM0A 4ZQLA 2NXBA 4IR4A 4YYKA 5L96A 4YYDA 4HXSA 4YADA 5HLSA 2YEKA 2RNYA 4O78A 5DYUA 4ALGA 4TZ2A 5D3NA 3U5PA 3QZVA 4A9MA 5L98A 5D7XA 3FKMX 5D0CA 3Q2EA 5ENCA 3O34A 4QC1A 5ENJA 4Q0OA 5ENIA 5A5SA 5DLXA 4QEVA 5DFCA 3UV4A 5I83A 3U5LA 5LJ1A 5LKUA 4HBXA 3DWYA 5DBMA 5IIDA 4CLBA 5HELA 5IG6A 4QEWA 4UIUA 4NR7A 3UW9A 4UIWA 5F2PA 4GPJA 4CUTA 4DONA 5A5OA 4C66A 3IU6A 3JVMA 4X2IA 3UVDA 5DKCA 4YYNA 2L85A 4UYFB 5EWCA 2I7KA 4QSTA 4N3WA 5FH6A 5CUBA 5F60A 4TQNA 4XY9A 4QBMA 5CTLA 5CFWA 4HBWA 3SVGA 3MB3A 5ACYA 5E73A 5FB0A 5EV9A 5KO4A 5CQAA 3UVWA 4YAXA 5ENBA 4A9OA 4HXLA 4QY4A 4TU4A 5ETBA 5I86A 4QYDA 2YW5A 4YY4A 2E3KA 2DATA 4MENA 5D24A 5FFWA 4Z1SA 5II1A 1WUGA 5FE8A 3O37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O36 A;  4QYL A;  5F36 A;  2YQD A;  4UYG A;  4O71 A;  3P1F A;  4OGI A;  4A9N A;  4O75 A;  4NUD A;  4J3I A;  4WHW A;  5E9K A;  2WP2 A;  3UV5 A;  5H85 A;  3QZT A;  4XYA A;  4C67 A;  2F6J A;  2D82 A;  5CPE A;  5HFQ A;  4TU6 A;  3NXB A;  3P5O A;  5FE9 A;  4A9L A;  5EI4 A;  3MXF A;  4LDF A;  5HQ6 A;  5L99 A;  5IGL A;  2YEL A;  4E96 A;  2FSA A;  3G0L A;  4QUT A;  4QSP A;  5KTX A;  5CU8 A;  5K29 A;  3IU5 A;  5HRX A;  4QR3 A;  5C7N A;  4A9E A;  5C85 A;  4YYH A;  4NR5 A;  5COI A;  4NYW A;  5IGM A;  4QSQ A;  5LVQ A;  5HCL A;  5HRV A;  4XUB A;  4QC3 A;  3HMH A;  4MR4 A;  4TZ8 A;  5H1V A;  4TYL A;  5EK9 A;  4NR8 A;  5D3H A;  4QSX A;  5D3T A;  5F5Z A;  4CUR A;  2DVV A;  4YY6 A;  4CFL A;  1JSP B;  5KTU A;  5CS8 A;  3U5J A;  4J0S A;  3AAD A;  4IOQ A;  5DYX A;  2DWW A;  3LXJ A;  5BT4 A;  5E74 A;  4YC9 A;  5ENH A;  5F3A A;  2R0Y A;  5E9Y A;  3GG3 A;  2OUO A;  5HFR A;  5CGP A;  3SVF A;  1X0J A;  4ALH A;  4HXK A;  3HME A;  4NS5 A;  2I8N A;  5AME A;  2LSP B;  5IGN A;  2F6N A;  5KTW A;  5FE1 A;  4CFK A;  2RI7 A;  5F1H A;  4BHW A;  4O72 A;  5IBN A;  5EPR A;  5DLZ A;  5JWM A;  3O33 A;  5E7D A;  5CUG A;  5BT5 A;  5CP5 A;  4BW1 A;  5FG4 A;  5EWD A;  3P1C A;  2DVR A;  5ENG A;  4QSV A;  2R0S A;  4O77 A;  4BW4 A;  3O35 A;  4Z6I A;  4Y03 A;  3S92 A;  4QZS A;  3TLP A;  4YBM A;  4ZC9 A;  4BW2 A;  4OGJ A;  4O76 A;  2L84 A;  5C4Q A;  5E3G A;  4UIY A;  4PCI A;  4IR3 A;  5CY9 A;  5EM3 A;  2RO1 A;  3D7C A;  5E9I A;  5FDZ A;  5H1T A;  5CQT A;  4QSW A;  4O74 A;  4WHU A;  4QSS A;  4MR6 A;  4WIV A;  4BW3 A;  4HBY A;  5EVA A;  3SVH A;  5L97 A;  4NXJ A;  5HEM A;  4PTB A;  4O7B A;  5E9V A;  5AMF A;  4TS8 A;  2E7O A;  4NRA A;  4KV4 A;  3LQI A;  5EPB A;  4O70 A;  4CL9 A;  4KV1 A;  5CUC A;  3Q2F A;  2R10 A;  4UIT A;  4A9F A;  3RCW A;  4LC2 A;  2DVS A;  4BJX A;  4AKN A;  5CQ8 A;  2OSS A;  4YYI A;  5CUD A;  5HRW A;  5G4R A;  3MUL A;  5A81 A;  5AD3 A;  4LZS A;  4NYV A;  5CQ5 A;  4UIZ A;  5EIS A;  5F25 A;  5EGU A;  4J1P A;  1N72 A;  1EQF A;  5I29 A;  5FFY A;  4Z93 A;  1E6I A;  4Z1Q A;  5CZG A;  4A9I A;  2R0V A;  5HQ7 A;  5I89 A;  4NUE A;  3G0J A;  5CRM A;  4YH4 A;  4ZW1 A;  5C89 A;  4MEP A;  4CUS A;  4KCX A;  5IGK A;  5FE7 A;  4LZR A;  4UIV A;  3UV2 A;  4HXR A;  5DFB A;  4YYJ A;  3S91 A;  4LYW A;  4XY8 A;  2YYN A;  5TCM A;  5DX4 A;  4NR4 A;  4QSU A;  5LKX A;  5F62 A;  5EQ1 A;  4RVR A;  4O7E A;  3MB4 A;  5FE4 A;  4HXN A;  5D3P A;  5FB1 A;  2E7N A;  2YEM A;  3MQM A;  5D26 A;  4N4G A;  4YYG A;  4NUC A;  5CUE A;  2RNX A;  5CQ6 A;  3LQJ A;  4LYS A;  4MEO A;  4QR5 A;  4UIX A;  5FBX A;  4TT4 A;  5II2 A;  5CQ4 A;  4NRB A;  5A7C A;  5LKT A;  2GRC A;  5TB6 A;  4LZ2 A;  3ZYU A;  2OO1 A;  4N4H A;  4UYD A;  3U5K A;  5EWH A;  4MR3 A;  5FE2 A;  5EA1 A;  3UVY A;  4TTE A;  5FE6 A;  4CUU A;  5E3D A;  4F3I A;  3LJW A;  4IR5 A;  4HXP A;  5H1U A;  5I7X A;  5FE0 A;  2KTB B;  4Q0N A;  3P1E A;  5I40 A;  5AD2 A;  4QUU A;  5CQ7 A;  5EWV A;  5A5N A;  2DVQ A;  4YK0 A;  5C8G A;  4PY6 A;  5KU3 A;  5DFD A;  5G4S A;  5E9L A;  4TT2 A;  5DY7 A;  5A5R A;  4HXO A;  5HQ5 A;  4YYM A;  2RS9 B;  4XUA A;  4YBS A;  3U5M A;  3LQH A;  5JI8 A;  5DYA A;  4OUF A;  5HJC A;  5C87 A;  5DYC A;  4UYH A;  3AQA A;  5ENF A;  4UYF A;  4YAB A;  5LKZ A;  5L8T A;  5LVR A;  4HBV A;  4NQN A;  4QR4 A;  2H60 A;  4YAT A;  4PCE A;  5E9M A;  5EP7 A;  5LJ0 A;  4QSR A;  2DKW A;  4NR9 A;  2D9E A;  2RNW A;  5ENE A;  4UYE A;  5DKH A;  2L5E A;  2MJV B;  4TT6 A;  5A83 A;  3HMF A;  3U5N A;  4PS5 A;  5FH7 A;  5I88 A;  4LRG A;  4PKL A;  4LR6 A;  5FG5 A;  5DW1 A;  5F61 A;  5DW2 A;  4IOR A;  2N9G A;  1F68 A;  2WP1 A;  5A85 A;  5CUA A;  5EWW A;  4CUP A;  5D25 A;  5CRZ A;  5EIC A;  4A9J A;  5A82 A;  2G4A A;  1JM4 B;  4NQM A;  4O7A A;  4CUQ A;  5FG6 A;  4J0R A;  5J0D A;  5BT3 A;  5LJ2 A;  3P1D A;  4LYI A;  5E0R A;  4YBT A;  5A5Q A;  4Z6H A;  4MEQ A;  5D3L A;  5F1L A;  5I1Q A;  1ZS5 A;  4YH3 A;  5LUU A;  5FE5 A;  4IOO A;  5HEN A;  3UVX A;  4N4F A;  5FFV A;  5I80 A;  4HXM A;  4IR6 A;  5F63 A;  4N4I A;  5D3J A;  3ONI A;  4NR6 A;  4MR5 A;  4O7F A;  4FLP A;  5KHM A;  5L8U A;  5CQ3 A;  3DAI A;  4A9K A;  2YDW A;  3K2J A;  4QNS A;  3JVJ A;  5FH8 A;  5EU1 A;  3QZS A;  3JVL A;  3I3J A;  5DKD A;  5FE3 A;  3U5O A;  2RFJ A;  5EPS A;  5I7Y A;  4A9H A;  4QB3 A;  3JVK A;  5A5P A;  5D3S A;  4QEU A;  4NRC A;  4O7C A;  5D3R A;  1WUM A;  4NYX A;  3MUK A;  5ETD A;  5HM0 A;  4ZQL A;  2NXB A;  4IR4 A;  4YYK A;  5L96 A;  4YYD A;  4HXS A;  4YAD A;  5HLS A;  2YEK A;  2RNY A;  4O78 A;  5DYU A;  4ALG A;  4TZ2 A;  5D3N A;  3U5P A;  3QZV A;  4A9M A;  5L98 A;  5D7X A;  3FKM X;  5D0C A;  3Q2E A;  5ENC A;  3O34 A;  4QC1 A;  5ENJ A;  4Q0O A;  5ENI A;  5A5S A;  5DLX A;  4QEV A;  5DFC A;  3UV4 A;  5I83 A;  3U5L A;  5LJ1 A;  5LKU A;  4HBX A;  3DWY A;  5DBM A;  5IID A;  4CLB A;  5HEL A;  5IG6 A;  4QEW A;  4UIU A;  4NR7 A;  3UW9 A;  4UIW A;  5F2P A;  4GPJ A;  4CUT A;  4DON A;  5A5O A;  4C66 A;  3IU6 A;  3JVM A;  4X2I A;  3UVD A;  5DKC A;  4YYN A;  2L85 A;  4UYF B;  5EWC A;  2I7K A;  4QST A;  4N3W A;  5FH6 A;  5CUB A;  5F60 A;  4TQN A;  4XY9 A;  4QBM A;  5CTL A;  5CFW A;  4HBW A;  3SVG A;  3MB3 A;  5ACY A;  5E73 A;  5FB0 A;  5EV9 A;  5KO4 A;  5CQA A;  3UVW A;  4YAX A;  5ENB A;  4A9O A;  4HXL A;  4QY4 A;  4TU4 A;  5ETB A;  5I86 A;  4QYD A;  2YW5 A;  4YY4 A;  2E3K A;  2DAT A;  4MEN A;  5D24 A;  5FFW A;  4Z1S A;  5II1 A;  1WUG A;  5FE8 A;  3O37 A; 
#chains in the Genus database with same CATH topology
 3O36 A;  4QYL A;  5F36 A;  2YQD A;  4UYG A;  4O71 A;  3P1F A;  4OGI A;  4A9N A;  4O75 A;  4NUD A;  4J3I A;  3VKH A;  4WHW A;  5E9K A;  2WP2 A;  3UV5 A;  5H85 A;  3QZT A;  4XYA A;  4C67 A;  2F6J A;  2D82 A;  5CPE A;  5HFQ A;  4TU6 A;  3D1D A;  3NXB A;  3P5O A;  5FE9 A;  4A9L A;  5EI4 A;  3MXF A;  4LDF A;  5HQ6 A;  5L99 A;  5IGL A;  2YEL A;  4E96 A;  2FSA A;  3G0L A;  4QUT A;  4QSP A;  5KTX A;  5CU8 A;  5K29 A;  3IU5 A;  5HRX A;  4QR3 A;  5C7N A;  4A9E A;  5C85 A;  4YYH A;  4NR5 A;  5COI A;  4NYW A;  5IGM A;  4QSQ A;  5LVQ A;  5HCL A;  5HRV A;  4XUB A;  4QC3 A;  3HMH A;  4MR4 A;  4AKG A;  4TZ8 A;  5H1V A;  4TYL A;  5EK9 A;  4NR8 A;  5D3H A;  4QSX A;  5D3T A;  5F5Z A;  4CUR A;  2DVV A;  4YY6 A;  4CFL A;  1JSP B;  5KTU A;  5CS8 A;  3U5J A;  4J0S A;  3AAD A;  4IOQ A;  5DYX A;  2DWW A;  3LXJ A;  5BT4 A;  5E74 A;  4YC9 A;  5ENH A;  5F3A A;  2R0Y A;  5E9Y A;  3VKG A;  3GG3 A;  2OUO A;  5HFR A;  5CGP A;  3SVF A;  1X0J A;  4ALH A;  4HXK A;  3HME A;  4NS5 A;  2I8N A;  5AME A;  2LSP B;  5IGN A;  2F6N A;  5KTW A;  5FE1 A;  4CFK A;  2RI7 A;  5F1H A;  4BHW A;  4O72 A;  5IBN A;  5EPR A;  5DLZ A;  5JWM A;  3O33 A;  5E7D A;  5CUG A;  5BT5 A;  5CP5 A;  4BW1 A;  5FG4 A;  5EWD A;  3P1C A;  2DVR A;  5ENG A;  4QSV A;  2R0S A;  4O77 A;  4BW4 A;  3O35 A;  4Z6I A;  4Y03 A;  3S92 A;  4QZS A;  3TLP A;  4YBM A;  4ZC9 A;  4BW2 A;  4OGJ A;  4AI6 A;  4O76 A;  2L84 A;  5C4Q A;  5E3G A;  4UIY A;  4PCI A;  4IR3 A;  3ERR A;  5CY9 A;  5EM3 A;  2RO1 A;  3D7C A;  5E9I A;  5FDZ A;  5H1T A;  5CQT A;  4QSW A;  4O74 A;  4WHU A;  4QSS A;  4MR6 A;  4WIV A;  4BW3 A;  4HBY A;  5EVA A;  3SVH A;  5L97 A;  4NXJ A;  5HEM A;  4PTB A;  4O7B A;  5E9V A;  5AMF A;  4TS8 A;  2E7O A;  4NRA A;  4KV4 A;  3LQI A;  5EPB A;  4O70 A;  4CL9 A;  4AKI A;  4KV1 A;  5CUC A;  3Q2F A;  2R10 A;  3D1B A;  4UIT A;  4A9F A;  3RCW A;  4LC2 A;  2DVS A;  4BJX A;  4AKN A;  5CQ8 A;  2OSS A;  4YYI A;  5CUD A;  5HRW A;  5G4R A;  3MUL A;  5A81 A;  5AD3 A;  4LZS A;  4NYV A;  5CQ5 A;  4UIZ A;  5EIS A;  5F25 A;  5EGU A;  4J1P A;  1N72 A;  1EQF A;  5I29 A;  5FFY A;  4Z93 A;  1E6I A;  4Z1Q A;  5CZG A;  4A9I A;  2R0V A;  5HQ7 A;  5I89 A;  4NUE A;  3G0J A;  5CRM A;  4YH4 A;  4ZW1 A;  5C89 A;  4MEP A;  4CUS A;  4KCX A;  5IGK A;  5FE7 A;  4LZR A;  4UIV A;  3UV2 A;  4HXR A;  5DFB A;  4YYJ A;  3S91 A;  4LYW A;  4XY8 A;  2YYN A;  5TCM A;  5DX4 A;  4NR4 A;  4QSU A;  5LKX A;  5F62 A;  5EQ1 A;  4RVR A;  4AKH A;  4O7E A;  3MB4 A;  5FE4 A;  4HXN A;  5D3P A;  5FB1 A;  2E7N A;  2YEM A;  3MQM A;  5D26 A;  4N4G A;  4YYG A;  4NUC A;  5CUE A;  2RNX A;  5CQ6 A;  3LQJ A;  4LYS A;  4MEO A;  4QR5 A;  4UIX A;  5FBX A;  4TT4 A;  5II2 A;  2EJN A;  5CQ4 A;  4NRB A;  5A7C A;  5LKT A;  2GRC A;  5TB6 A;  4LZ2 A;  3ZYU A;  2OO1 A;  4N4H A;  4UYD A;  3U5K A;  5EWH A;  4MR3 A;  5FE2 A;  5EA1 A;  3UVY A;  4TTE A;  5FE6 A;  4CUU A;  5E3D A;  4F3I A;  3LJW A;  4IR5 A;  4HXP A;  5H1U A;  5I7X A;  5FE0 A;  2KTB B;  4Q0N A;  3P1E A;  5I40 A;  5AD2 A;  4QUU A;  5CQ7 A;  5EWV A;  5A5N A;  2DVQ A;  4YK0 A;  5C8G A;  4PY6 A;  5KU3 A;  5DFD A;  5G4S A;  5E9L A;  4TT2 A;  5DY7 A;  5A5R A;  4HXO A;  5HQ5 A;  4YYM A;  2RS9 B;  4XUA A;  4YBS A;  3U5M A;  3LQH A;  5JI8 A;  5DYA A;  4OUF A;  5HJC A;  5C87 A;  5DYC A;  4UYH A;  3AQA A;  5ENF A;  4UYF A;  4YAB A;  5LKZ A;  5L8T A;  5LVR A;  4HBV A;  4NQN A;  4QR4 A;  2H60 A;  4YAT A;  4PCE A;  5E9M A;  5EP7 A;  5LJ0 A;  4QSR A;  2DKW A;  4NR9 A;  2D9E A;  2RNW A;  5ENE A;  4UYE A;  5DKH A;  2L5E A;  2MJV B;  4TT6 A;  5A83 A;  3HMF A;  3U5N A;  4PS5 A;  5FH7 A;  5I88 A;  4LRG A;  4PKL A;  4LR6 A;  5FG5 A;  5DW1 A;  5F61 A;  5DW2 A;  4IOR A;  2N9G A;  1F68 A;  2WP1 A;  5A85 A;  5CUA A;  5EWW A;  4CUP A;  5D25 A;  5CRZ A;  5EIC A;  4A9J A;  5A82 A;  2G4A A;  1JM4 B;  4NQM A;  4O7A A;  4CUQ A;  5FG6 A;  4J0R A;  5J0D A;  5BT3 A;  5LJ2 A;  3P1D A;  4LYI A;  5E0R A;  4YBT A;  5A5Q A;  4Z6H A;  4MEQ A;  5D3L A;  5F1L A;  5I1Q A;  1ZS5 A;  4YH3 A;  5LUU A;  5FE5 A;  4IOO A;  5HEN A;  3UVX A;  4N4F A;  5FFV A;  5I80 A;  4HXM A;  4IR6 A;  5F63 A;  4N4I A;  5D3J A;  3ONI A;  4NR6 A;  1PUO A;  4MR5 A;  4O7F A;  4FLP A;  5KHM A;  5L8U A;  5CQ3 A;  3DAI A;  4A9K A;  2YDW A;  3K2J A;  4QNS A;  3JVJ A;  5FH8 A;  5EU1 A;  3QZS A;  3JVL A;  3I3J A;  5DKD A;  5FE3 A;  3U5O A;  2RFJ A;  5EPS A;  5I7Y A;  1ZKR A;  4A9H A;  4QB3 A;  3JVK A;  5A5P A;  5D3S A;  4QEU A;  4NRC A;  4O7C A;  5D3R A;  1WUM A;  4NYX A;  3MUK A;  5ETD A;  5HM0 A;  4ZQL A;  2NXB A;  4IR4 A;  4YYK A;  5L96 A;  4YYD A;  4HXS A;  4YAD A;  5HLS A;  2YEK A;  2RNY A;  4O78 A;  5DYU A;  4ALG A;  4TZ2 A;  5D3N A;  3U5P A;  3QZV A;  4A9M A;  5L98 A;  5D7X A;  3FKM X;  5D0C A;  3Q2E A;  5ENC A;  3O34 A;  4QC1 A;  5ENJ A;  4Q0O A;  5ENI A;  5A5S A;  5DLX A;  4QEV A;  5DFC A;  3UV4 A;  5I83 A;  3U5L A;  5LJ1 A;  5LKU A;  4HBX A;  3DWY A;  5DBM A;  5IID A;  4CLB A;  5HEL A;  5IG6 A;  4QEW A;  4UIU A;  4NR7 A;  3UW9 A;  4UIW A;  5F2P A;  4GPJ A;  4CUT A;  4DON A;  5A5O A;  4C66 A;  3IU6 A;  3JVM A;  4X2I A;  3UVD A;  5DKC A;  4YYN A;  2L85 A;  4UYF B;  5EWC A;  2I7K A;  4QST A;  4N3W A;  5FH6 A;  5CUB A;  5F60 A;  4TQN A;  4XY9 A;  4QBM A;  5CTL A;  5CFW A;  4HBW A;  3SVG A;  3MB3 A;  5ACY A;  5E73 A;  5FB0 A;  5EV9 A;  5KO4 A;  5CQA A;  3UVW A;  4YAX A;  5ENB A;  4A9O A;  4HXL A;  4QY4 A;  4TU4 A;  5ETB A;  5I86 A;  4QYD A;  2YW5 A;  4YY4 A;  2E3K A;  2DAT A;  4MEN A;  5D24 A;  5FFW A;  4Z1S A;  5II1 A;  1WUG A;  5FE8 A;  3O37 A; 
#chains in the Genus database with same CATH homology
 3O36 A;  4QYL A;  5F36 A;  2YQD A;  4UYG A;  4O71 A;  3P1F A;  4OGI A;  4A9N A;  4O75 A;  4NUD A;  4J3I A;  4WHW A;  5E9K A;  2WP2 A;  3UV5 A;  5H85 A;  3QZT A;  4XYA A;  4C67 A;  2F6J A;  2D82 A;  5CPE A;  5HFQ A;  4TU6 A;  3NXB A;  3P5O A;  5FE9 A;  4A9L A;  5EI4 A;  3MXF A;  4LDF A;  5HQ6 A;  5L99 A;  5IGL A;  2YEL A;  4E96 A;  2FSA A;  3G0L A;  4QUT A;  4QSP A;  5KTX A;  5CU8 A;  5K29 A;  3IU5 A;  5HRX A;  4QR3 A;  5C7N A;  4A9E A;  5C85 A;  4YYH A;  4NR5 A;  5COI A;  4NYW A;  5IGM A;  4QSQ A;  5LVQ A;  5HCL A;  5HRV A;  4XUB A;  4QC3 A;  3HMH A;  4MR4 A;  4TZ8 A;  5H1V A;  4TYL A;  5EK9 A;  4NR8 A;  5D3H A;  4QSX A;  5D3T A;  5F5Z A;  4CUR A;  2DVV A;  4YY6 A;  4CFL A;  1JSP B;  5KTU A;  5CS8 A;  3U5J A;  4J0S A;  3AAD A;  4IOQ A;  5DYX A;  2DWW A;  3LXJ A;  5BT4 A;  5E74 A;  4YC9 A;  5ENH A;  5F3A A;  2R0Y A;  5E9Y A;  3GG3 A;  2OUO A;  5HFR A;  5CGP A;  3SVF A;  1X0J A;  4ALH A;  4HXK A;  3HME A;  4NS5 A;  2I8N A;  5AME A;  2LSP B;  5IGN A;  2F6N A;  5KTW A;  5FE1 A;  4CFK A;  2RI7 A;  5F1H A;  4BHW A;  4O72 A;  5IBN A;  5EPR A;  5DLZ A;  5JWM A;  3O33 A;  5E7D A;  5CUG A;  5BT5 A;  5CP5 A;  4BW1 A;  5FG4 A;  5EWD A;  3P1C A;  2DVR A;  5ENG A;  4QSV A;  2R0S A;  4O77 A;  4BW4 A;  3O35 A;  4Z6I A;  4Y03 A;  3S92 A;  4QZS A;  3TLP A;  4YBM A;  4ZC9 A;  4BW2 A;  4OGJ A;  4O76 A;  2L84 A;  5C4Q A;  5E3G A;  4UIY A;  4PCI A;  4IR3 A;  5CY9 A;  5EM3 A;  2RO1 A;  3D7C A;  5E9I A;  5FDZ A;  5H1T A;  5CQT A;  4QSW A;  4O74 A;  4WHU A;  4QSS A;  4MR6 A;  4WIV A;  4BW3 A;  4HBY A;  5EVA A;  3SVH A;  5L97 A;  4NXJ A;  5HEM A;  4PTB A;  4O7B A;  5E9V A;  5AMF A;  4TS8 A;  2E7O A;  4NRA A;  4KV4 A;  3LQI A;  5EPB A;  4O70 A;  4CL9 A;  4KV1 A;  5CUC A;  3Q2F A;  2R10 A;  4UIT A;  4A9F A;  3RCW A;  4LC2 A;  2DVS A;  4BJX A;  4AKN A;  5CQ8 A;  2OSS A;  4YYI A;  5CUD A;  5HRW A;  5G4R A;  3MUL A;  5A81 A;  5AD3 A;  4LZS A;  4NYV A;  5CQ5 A;  4UIZ A;  5EIS A;  5F25 A;  5EGU A;  4J1P A;  1N72 A;  1EQF A;  5I29 A;  5FFY A;  4Z93 A;  1E6I A;  4Z1Q A;  5CZG A;  4A9I A;  2R0V A;  5HQ7 A;  5I89 A;  4NUE A;  3G0J A;  5CRM A;  4YH4 A;  4ZW1 A;  5C89 A;  4MEP A;  4CUS A;  4KCX A;  5IGK A;  5FE7 A;  4LZR A;  4UIV A;  3UV2 A;  4HXR A;  5DFB A;  4YYJ A;  3S91 A;  4LYW A;  4XY8 A;  2YYN A;  5TCM A;  5DX4 A;  4NR4 A;  4QSU A;  5LKX A;  5F62 A;  5EQ1 A;  4RVR A;  4O7E A;  3MB4 A;  5FE4 A;  4HXN A;  5D3P A;  5FB1 A;  2E7N A;  2YEM A;  3MQM A;  5D26 A;  4N4G A;  4YYG A;  4NUC A;  5CUE A;  2RNX A;  5CQ6 A;  3LQJ A;  4LYS A;  4MEO A;  4QR5 A;  4UIX A;  5FBX A;  4TT4 A;  5II2 A;  5CQ4 A;  4NRB A;  5A7C A;  5LKT A;  2GRC A;  5TB6 A;  4LZ2 A;  3ZYU A;  2OO1 A;  4N4H A;  4UYD A;  3U5K A;  5EWH A;  4MR3 A;  5FE2 A;  5EA1 A;  3UVY A;  4TTE A;  5FE6 A;  4CUU A;  5E3D A;  4F3I A;  3LJW A;  4IR5 A;  4HXP A;  5H1U A;  5I7X A;  5FE0 A;  2KTB B;  4Q0N A;  3P1E A;  5I40 A;  5AD2 A;  4QUU A;  5CQ7 A;  5EWV A;  5A5N A;  2DVQ A;  4YK0 A;  5C8G A;  4PY6 A;  5KU3 A;  5DFD A;  5G4S A;  5E9L A;  4TT2 A;  5DY7 A;  5A5R A;  4HXO A;  5HQ5 A;  4YYM A;  2RS9 B;  4XUA A;  4YBS A;  3U5M A;  3LQH A;  5JI8 A;  5DYA A;  4OUF A;  5HJC A;  5C87 A;  5DYC A;  4UYH A;  3AQA A;  5ENF A;  4UYF A;  4YAB A;  5LKZ A;  5L8T A;  5LVR A;  4HBV A;  4NQN A;  4QR4 A;  2H60 A;  4YAT A;  4PCE A;  5E9M A;  5EP7 A;  5LJ0 A;  4QSR A;  2DKW A;  4NR9 A;  2D9E A;  2RNW A;  5ENE A;  4UYE A;  5DKH A;  2L5E A;  2MJV B;  4TT6 A;  5A83 A;  3HMF A;  3U5N A;  4PS5 A;  5FH7 A;  5I88 A;  4LRG A;  4PKL A;  4LR6 A;  5FG5 A;  5DW1 A;  5F61 A;  5DW2 A;  4IOR A;  2N9G A;  1F68 A;  2WP1 A;  5A85 A;  5CUA A;  5EWW A;  4CUP A;  5D25 A;  5CRZ A;  5EIC A;  4A9J A;  5A82 A;  2G4A A;  1JM4 B;  4NQM A;  4O7A A;  4CUQ A;  5FG6 A;  4J0R A;  5J0D A;  5BT3 A;  5LJ2 A;  3P1D A;  4LYI A;  5E0R A;  4YBT A;  5A5Q A;  4Z6H A;  4MEQ A;  5D3L A;  5F1L A;  5I1Q A;  1ZS5 A;  4YH3 A;  5LUU A;  5FE5 A;  4IOO A;  5HEN A;  3UVX A;  4N4F A;  5FFV A;  5I80 A;  4HXM A;  4IR6 A;  5F63 A;  4N4I A;  5D3J A;  3ONI A;  4NR6 A;  4MR5 A;  4O7F A;  4FLP A;  5KHM A;  5L8U A;  5CQ3 A;  3DAI A;  4A9K A;  2YDW A;  3K2J A;  4QNS A;  3JVJ A;  5FH8 A;  5EU1 A;  3QZS A;  3JVL A;  3I3J A;  5DKD A;  5FE3 A;  3U5O A;  2RFJ A;  5EPS A;  5I7Y A;  4A9H A;  4QB3 A;  3JVK A;  5A5P A;  5D3S A;  4QEU A;  4NRC A;  4O7C A;  5D3R A;  1WUM A;  4NYX A;  3MUK A;  5ETD A;  5HM0 A;  4ZQL A;  2NXB A;  4IR4 A;  4YYK A;  5L96 A;  4YYD A;  4HXS A;  4YAD A;  5HLS A;  2YEK A;  2RNY A;  4O78 A;  5DYU A;  4ALG A;  4TZ2 A;  5D3N A;  3U5P A;  3QZV A;  4A9M A;  5L98 A;  5D7X A;  3FKM X;  5D0C A;  3Q2E A;  5ENC A;  3O34 A;  4QC1 A;  5ENJ A;  4Q0O A;  5ENI A;  5A5S A;  5DLX A;  4QEV A;  5DFC A;  3UV4 A;  5I83 A;  3U5L A;  5LJ1 A;  5LKU A;  4HBX A;  3DWY A;  5DBM A;  5IID A;  4CLB A;  5HEL A;  5IG6 A;  4QEW A;  4UIU A;  4NR7 A;  3UW9 A;  4UIW A;  5F2P A;  4GPJ A;  4CUT A;  4DON A;  5A5O A;  4C66 A;  3IU6 A;  3JVM A;  4X2I A;  3UVD A;  5DKC A;  4YYN A;  2L85 A;  4UYF B;  5EWC A;  2I7K A;  4QST A;  4N3W A;  5FH6 A;  5CUB A;  5F60 A;  4TQN A;  4XY9 A;  4QBM A;  5CTL A;  5CFW A;  4HBW A;  3SVG A;  3MB3 A;  5ACY A;  5E73 A;  5FB0 A;  5EV9 A;  5KO4 A;  5CQA A;  3UVW A;  4YAX A;  5ENB A;  4A9O A;  4HXL A;  4QY4 A;  4TU4 A;  5ETB A;  5I86 A;  4QYD A;  2YW5 A;  4YY4 A;  2E3K A;  2DAT A;  4MEN A;  5D24 A;  5FFW A;  4Z1S A;  5II1 A;  1WUG A;  5FE8 A;  3O37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...