1WUMA

Complex structure of pcaf bromodomain with small chemical ligand np2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
b'GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase PCAF
publication title Selective small molecules blocking HIV-1 Tat and coactivator PCAF association
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 118
sequence length 118
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1wumA00
4J0RA 3HMEA 4YYHA 5CQ8A 5D3HA 5C4QA 5D3TA 4LZSA 5HRXA 4WHWA 4CUSA 5H85A 3U5KA 4QUTA 4TZ2A 5F61A 2DVSA 5ACYA 3JVMA 5HQ7A 4O7BA 4O75A 4O7AA 4UITA 2YEMA 4HXSA 4O71A 4O70A 5DKCA 5LJ1A 4UIUA 2WP1A 4NR8A 4QC3A 5E73A 3HMFA 4CFKA 4NYWA 4J1PA 3U5OA 4UYFB 3MULA 4YADA 1X0JA 4OGJA 3S91A 5FH7A 5EQ1A 5A5NA 3ONIA 5D3NA 5F60A 4YBSA 4UYFA 3MB4A 5JI8A 5ENGA 4XUBA 4A9HA 5CUGA 4TT4A 2OO1A 4NYXA 4O7FA 5CQ7A 2R10A 4C67A 4IR4A 5ENJA 5DFCA 5FB0A 4LDFA 5IGKA 5HJCA 5L96A 5F25A 4QSVA 2KTBB 5D3LA 5D3RA 5EWVA 1WUGA 4IR5A 2F6NA 4QBMA 5DYCA 5I86A 4YYNA 5F62A 3UVXA 2E3KA 4QY4A 5FE1A 4QSWA 4A9KA 4MR3A 5FFWA 4HXRA 4CUUA 5HQ5A 2NXBA 5E9LA 5F3AA 5CQ5A 4NYVA 4MR4A 5H1TA 5A5OA 2R0YA 2GRCA 3O34A 4OGIA 5TB6A 5ENBA 4AKNA 5E9KA 5LKZA 4TS8A 5KTWA 5KTUA 5DFDA 4C66A 3P1FA 5ENFA 3MUKA 5TCMA 4UIWA 5FE2A 5EWDA 5LKUA 2MJVB 4QZSA 5C89A 4YAXA 5D24A 5E9YA 4TT6A 5BT5A 5C7NA 4ZC9A 3MB3A 5FH8A 2R0SA 4NUEA 5DLZA 5CUCA 4TU4A 4TYLA 5CUAA 4YY6A 5EA1A 5H1VA 4QSTA 4CFLA 4GPJA 4NRBA 4QYDA 5DFBA 3LQHA 5CTLA 5ENCA 5FFVA 5C8GA 1WUMA 4YYKA 4QR5A 4LC2A 5CQ6A 5FE3A 5FG5A 2I8NA 4NXJA 4XY9A 4QEWA 4YC9A 4NR7A 4NS5A 4HBYA 2YW5A 3UW9A 5I80A 3UVYA 5LKXA 5HCLA 5IBNA 3P1EA 3GG3A 4QC1A 4PKLA 3P1CA 4BW2A 5A5SA 4QSXA 4OUFA 4PS5A 2RFJA 5DW1A 5LVQA 5D26A 4Z6IA 5KO4A 5D3PA 4UIYA 2RS9B 2LSPB 5AD2A 4UIVA 2YEKA 5CS8A 5HELA 5BT4A 4NR5A 4TTEA 4CLBA 4NR6A 5FE4A 4PTBA 2WP2A 5ENHA 4IORA 4UYHA 4TZ8A 5CQAA 5FDZA 5KHMA 5I1QA 5A82A 2DWWA 4LYSA 4YK0A 4YYDA 3HMHA 3UV4A 5E3DA 5FE8A 4YABA 4HXOA 4RVRA 5EVAA 4A9IA 4QR3A 5HQ6A 5E9MA 5CFWA 4QSUA 4DONA 5FG4A 5FBXA 5A5RA 4XUAA 4YH3A 5A5QA 5EWWA 4BJXA 4CURA 5JWMA 3AQAA 5ETBA 1F68A 3LXJA 5CRZA 2G4AA 4QEUA 2RNXA 2R0VA 2F6JA 5E9VA 5EISA 3SVFA 4IR3A 4CL9A 4QSSA 5L97A 4NR4A 4X2IA 3JVJA 4QUUA 5AMFA 4E96A 4O76A 5EV9A 2DVQA 4O77A 3IU5A 5EICA 2YQDA 4A9LA 4O78A 5F1HA 3AADA 4O7CA 5DX4A 5D3JA 4HBWA 5C85A 5CGPA 5IGNA 3G0JA 4LRGA 4N4GA 4UIZA 5KTXA 4Z93A 5DYAA 4UYDA 5IGMA 4TQNA 2RI7A 4QSPA 5FE6A 4LZ2A 5HENA 2RNYA 5EPRA 4Z1QA 5FH6A 2YELA 4BHWA 5AMEA 5IG6A 3JVLA 3O35A 4N4HA 3QZSA 4F3IA 5I88A 4WHUA 2YDWA 5CP5A 4YYJA 4HXNA 1ZS5A 3RCWA 3ZYUA 5AD3A 4QNSA 4CUPA 4QSRA 5HLSA 5ENEA 5DYXA 1N72A 3O36A 4NUCA 5F1LA 5E0RA 5LUUA 4MENA 5DYUA 5EGUA 5BT3A 5E3GA 5EP7A 3SVHA 4Q0NA 4FLPA 5DLXA 2DKWA 5I7XA 3Q2EA 5IGLA 3UV2A 3SVGA 4MR5A 3D7CA 5CQ3A 4PCEA 5I83A 5CRMA 5A81A 2OSSA 5HRVA 4CUTA 1EQFA 4KCXA 5D7XA 4QEVA 5I29A 5CPEA 5II1A 2L84A 5F5ZA 5FB1A 4UYGA 5H1UA 2L5EA 5II2A 4IOOA 4MEOA 4QB3A 4N4FA 4HBXA 5J0DA 4NUDA 5G4RA 4UIXA 5CY9A 5L8UA 3QZVA 5DKDA 3UVWA 2I7KA 5CZGA 4QR4A 5E9IA 3LJWA 2D9EA 4N3WA 4A9NA 4TU6A 2RNWA 5HFQA 5A85A 4MEQA 3MXFA 4YATA 4Z1SA 5FE5A 4CUQA 4A9OA 5A5PA 1JM4B 4BW1A 4O7EA 5FFYA 4YH4A 3TLPA 4J3IA 5IIDA 5HM0A 5CU8A 5DKHA 2RO1A 4NRAA 4WIVA 5EWHA 3DAIA 3LQIA 3U5PA 3U5MA 5CQTA 4J0SA 1JSPB 3U5JA 5DBMA 3O37A 5FE0A 4A9JA 3Q2FA 4O72A 4YYIA 4NQMA 3S92A 5HEMA 2D82A 4A9FA 5EI4A 5EPSA 5COIA 5CQ4A 3NXBA 4MEPA 5LVRA 4PY6A 5DW2A 4TT2A 5A83A 5D0CA 3FKMX 2DVRA 4XY8A 5G4SA 4ALGA 5LJ0A 5I7YA 4IOQA 3QZTA 3LQJA 2DVVA 4KV4A 4NR9A 4O74A 4A9MA 5FE7A 5D3SA 3K2JA 4ZW1A 5C87A 5EU1A 3U5NA 4PCIA 5E74A 5FE9A 4YYGA 5D25A 5EK9A 2DATA 5F2PA 5KU3A 4HXMA 1E6IA 4QSQA 2YYNA 5F63A 5EWCA 4LYIA 2H60A 4LZRA 5A7CA 5CUBA 4LYWA 3P1DA 5CUDA 4YBMA 4XYAA 5EM3A 4HXLA 4UYEA 2FSAA 4YYMA 5LKTA 2L85A 3JVKA 5E7DA 3I3JA 4Q0OA 4Z6HA 3G0LA 3O33A 4N4IA 4BW3A 4YY4A 5F36A 2E7OA 5ETDA 4ALHA 4YBTA 4KV1A 3DWYA 4QYLA 4Y03A 4HXKA 4HBVA 3MQMA 3IU6A 5I40A 5FG6A 4BW4A 3P5OA 4ZQLA 3UVDA 3UV5A 4NQNA 5CUEA 4A9EA 5L99A 4IR6A 4NRCA 5L98A 5DY7A 5K29A 2N9GA 5EPBA 5L8TA 5LJ2A 5HFRA 4MR6A 4HXPA 5ENIA 5I89A 5HRWA 4LR6A 2OUOA 3U5LA 2E7NA
chains in the Genus database with same CATH superfamily
4J0RA 3HMEA 4YYHA 5CQ8A 5D3HA 5C4QA 5D3TA 4LZSA 5HRXA 4WHWA 4CUSA 5H85A 3U5KA 4QUTA 4TZ2A 5F61A 2DVSA 5ACYA 3JVMA 5HQ7A 4O7BA 4O75A 4O7AA 4UITA 2YEMA 4HXSA 4O71A 4O70A 5DKCA 5LJ1A 4UIUA 2WP1A 4NR8A 4QC3A 5E73A 3HMFA 4CFKA 4NYWA 4J1PA 3U5OA 4UYFB 3MULA 4YADA 1X0JA 4OGJA 3S91A 5FH7A 5EQ1A 5A5NA 3ONIA 5D3NA 5F60A 4YBSA 4UYFA 3MB4A 5JI8A 5ENGA 4XUBA 4A9HA 5CUGA 4TT4A 2OO1A 4NYXA 4O7FA 5CQ7A 2R10A 4C67A 4IR4A 5ENJA 5DFCA 5FB0A 4LDFA 5IGKA 5HJCA 5L96A 5F25A 4QSVA 2KTBB 5D3LA 5D3RA 5EWVA 1WUGA 4IR5A 2F6NA 4QBMA 5DYCA 5I86A 4YYNA 5F62A 3UVXA 2E3KA 4QY4A 5FE1A 4QSWA 4A9KA 4MR3A 5FFWA 4HXRA 4CUUA 5HQ5A 2NXBA 5E9LA 5F3AA 5CQ5A 4NYVA 4MR4A 5H1TA 5A5OA 2R0YA 2GRCA 3O34A 4OGIA 5TB6A 5ENBA 4AKNA 5E9KA 5LKZA 4TS8A 5KTWA 5KTUA 5DFDA 4C66A 3P1FA 5ENFA 3MUKA 5TCMA 4UIWA 5FE2A 5EWDA 5LKUA 2MJVB 4QZSA 5C89A 4YAXA 5D24A 5E9YA 4TT6A 5BT5A 5C7NA 4ZC9A 3MB3A 5FH8A 2R0SA 4NUEA 5DLZA 5CUCA 4TU4A 4TYLA 5CUAA 4YY6A 5EA1A 5H1VA 4QSTA 4CFLA 4GPJA 4NRBA 4QYDA 5DFBA 3LQHA 5CTLA 5ENCA 5FFVA 5C8GA 1WUMA 4YYKA 4QR5A 4LC2A 5CQ6A 5FE3A 5FG5A 2I8NA 4NXJA 4XY9A 4QEWA 4YC9A 4NR7A 4NS5A 4AKIA 4HBYA 2YW5A 3UW9A 5I80A 3UVYA 5LKXA 5HCLA 5IBNA 3P1EA 3GG3A 4QC1A 4PKLA 3P1CA 4BW2A 5A5SA 4QSXA 4OUFA 4PS5A 2RFJA 5DW1A 5LVQA 5D26A 4Z6IA 5KO4A 5D3PA 4UIYA 2RS9B 2LSPB 5AD2A 4UIVA 3VKHA 2YEKA 5CS8A 5HELA 5BT4A 4NR5A 2EJNA 4TTEA 3D1DA 4CLBA 4NR6A 5FE4A 4PTBA 2WP2A 5ENHA 4IORA 4UYHA 4TZ8A 5CQAA 5FDZA 5KHMA 5I1QA 5A82A 2DWWA 4LYSA 4YK0A 4YYDA 3HMHA 3UV4A 5E3DA 5FE8A 4YABA 4HXOA 4RVRA 5EVAA 4A9IA 4QR3A 5HQ6A 5E9MA 5CFWA 4QSUA 4DONA 4AI6A 5FG4A 5FBXA 5A5RA 4XUAA 4YH3A 5A5QA 5EWWA 4BJXA 4CURA 5JWMA 3AQAA 5ETBA 1F68A 3LXJA 5CRZA 2G4AA 4QEUA 2RNXA 2R0VA 2F6JA 5E9VA 5EISA 3SVFA 4IR3A 4CL9A 4QSSA 5L97A 4NR4A 4X2IA 3JVJA 4QUUA 5AMFA 4E96A 4O76A 5EV9A 2DVQA 4O77A 3IU5A 5EICA 2YQDA 4A9LA 4O78A 5F1HA 3AADA 4O7CA 5DX4A 5D3JA 4HBWA 5C85A 5CGPA 5IGNA 3G0JA 4LRGA 4N4GA 4UIZA 5KTXA 4AKHA 4Z93A 5DYAA 4UYDA 5IGMA 4TQNA 2RI7A 4QSPA 5FE6A 4LZ2A 5HENA 2RNYA 5EPRA 4Z1QA 5FH6A 2YELA 4BHWA 1ZKRA 5AMEA 5IG6A 3JVLA 3O35A 4N4HA 3QZSA 4F3IA 5I88A 4WHUA 2YDWA 5CP5A 4YYJA 4HXNA 1ZS5A 3RCWA 3ZYUA 5AD3A 4QNSA 4CUPA 4QSRA 5HLSA 5ENEA 5DYXA 1N72A 3O36A 4NUCA 5F1LA 5E0RA 5LUUA 4MENA 5DYUA 5EGUA 5BT3A 5E3GA 5EP7A 3SVHA 4Q0NA 4FLPA 5DLXA 2DKWA 5I7XA 3Q2EA 5IGLA 3UV2A 3SVGA 4MR5A 3D7CA 5CQ3A 4PCEA 5I83A 5CRMA 5A81A 2OSSA 5HRVA 4CUTA 1EQFA 4KCXA 5D7XA 4QEVA 5I29A 3VKGA 5CPEA 5II1A 2L84A 5F5ZA 5FB1A 4UYGA 5H1UA 2L5EA 5II2A 4IOOA 4MEOA 4QB3A 4N4FA 4HBXA 5J0DA 4NUDA 5G4RA 4UIXA 5CY9A 5L8UA 3QZVA 5DKDA 3UVWA 2I7KA 5CZGA 4QR4A 5E9IA 3LJWA 2D9EA 4N3WA 4A9NA 4TU6A 2RNWA 5HFQA 5A85A 4MEQA 3MXFA 4YATA 4Z1SA 5FE5A 4CUQA 4A9OA 5A5PA 1JM4B 4BW1A 4O7EA 5FFYA 4YH4A 3TLPA 4J3IA 5IIDA 5HM0A 5CU8A 5DKHA 2RO1A 4NRAA 4WIVA 5EWHA 3DAIA 3LQIA 3U5PA 3U5MA 5CQTA 4J0SA 3D1BA 1JSPB 3U5JA 5DBMA 3O37A 5FE0A 4A9JA 3Q2FA 4O72A 4YYIA 4NQMA 3S92A 5HEMA 2D82A 4A9FA 4AKGA 5EI4A 5EPSA 5COIA 5CQ4A 3NXBA 4MEPA 5LVRA 4PY6A 5DW2A 4TT2A 5A83A 5D0CA 3FKMX 2DVRA 4XY8A 5G4SA 4ALGA 5LJ0A 5I7YA 4IOQA 3QZTA 3LQJA 2DVVA 4KV4A 4NR9A 4O74A 4A9MA 5FE7A 5D3SA 3K2JA 4ZW1A 5C87A 5EU1A 3U5NA 4PCIA 5E74A 5FE9A 4YYGA 5D25A 5EK9A 2DATA 5F2PA 5KU3A 4HXMA 1E6IA 4QSQA 2YYNA 5F63A 5EWCA 4LYIA 2H60A 3ERRA 4LZRA 5A7CA 5CUBA 4LYWA 3P1DA 5CUDA 4YBMA 4XYAA 5EM3A 4HXLA 4UYEA 2FSAA 4YYMA 5LKTA 2L85A 3JVKA 5E7DA 3I3JA 4Q0OA 4Z6HA 3G0LA 3O33A 4N4IA 4BW3A 4YY4A 5F36A 2E7OA 5ETDA 4ALHA 4YBTA 4KV1A 3DWYA 4QYLA 4Y03A 4HXKA 4HBVA 3MQMA 3IU6A 5I40A 5FG6A 4BW4A 3P5OA 4ZQLA 3UVDA 3UV5A 4NQNA 5CUEA 4A9EA 5L99A 4IR6A 4NRCA 5L98A 5DY7A 5K29A 2N9GA 5EPBA 5L8TA 5LJ2A 5HFRA 4MR6A 4HXPA 5ENIA 5I89A 5HRWA 4LR6A 2OUOA 3U5LA 2E7NA 1PUOA
chains in the Genus database with same CATH topology
4J0RA 3HMEA 4YYHA 5CQ8A 5D3HA 5C4QA 5D3TA 4LZSA 5HRXA 4WHWA 4CUSA 5H85A 3U5KA 4QUTA 4TZ2A 5F61A 2DVSA 5ACYA 3JVMA 5HQ7A 4O7BA 4O75A 4O7AA 4UITA 2YEMA 4HXSA 4O71A 4O70A 5DKCA 5LJ1A 4UIUA 2WP1A 4NR8A 4QC3A 5E73A 3HMFA 4CFKA 4NYWA 4J1PA 3U5OA 4UYFB 3MULA 4YADA 1X0JA 4OGJA 3S91A 5FH7A 5EQ1A 5A5NA 3ONIA 5D3NA 5F60A 4YBSA 4UYFA 3MB4A 5JI8A 5ENGA 4XUBA 4A9HA 5CUGA 4TT4A 2OO1A 4NYXA 4O7FA 5CQ7A 2R10A 4C67A 4IR4A 5ENJA 5DFCA 5FB0A 4LDFA 5IGKA 5HJCA 5L96A 5F25A 4QSVA 2KTBB 5D3LA 5D3RA 5EWVA 1WUGA 4IR5A 2F6NA 4QBMA 5DYCA 5I86A 4YYNA 5F62A 3UVXA 2E3KA 4QY4A 5FE1A 4QSWA 4A9KA 4MR3A 5FFWA 4HXRA 4CUUA 5HQ5A 2NXBA 5E9LA 5F3AA 5CQ5A 4NYVA 4MR4A 5H1TA 5A5OA 2R0YA 2GRCA 3O34A 4OGIA 5TB6A 5ENBA 4AKNA 5E9KA 5LKZA 4TS8A 5KTWA 5KTUA 5DFDA 4C66A 3P1FA 5ENFA 3MUKA 5TCMA 4UIWA 5FE2A 5EWDA 5LKUA 2MJVB 4QZSA 5C89A 4YAXA 5D24A 5E9YA 4TT6A 5BT5A 5C7NA 4ZC9A 3MB3A 5FH8A 2R0SA 4NUEA 5DLZA 5CUCA 4TU4A 4TYLA 5CUAA 4YY6A 5EA1A 5H1VA 4QSTA 4CFLA 4GPJA 4NRBA 4QYDA 5DFBA 3LQHA 5CTLA 5ENCA 5FFVA 5C8GA 1WUMA 4YYKA 4QR5A 4LC2A 5CQ6A 5FE3A 5FG5A 2I8NA 4NXJA 4XY9A 4QEWA 4YC9A 4NR7A 4NS5A 4HBYA 2YW5A 3UW9A 5I80A 3UVYA 5LKXA 5HCLA 5IBNA 3P1EA 3GG3A 4QC1A 4PKLA 3P1CA 4BW2A 5A5SA 4QSXA 4OUFA 4PS5A 2RFJA 5DW1A 5LVQA 5D26A 4Z6IA 5KO4A 5D3PA 4UIYA 2RS9B 2LSPB 5AD2A 4UIVA 2YEKA 5CS8A 5HELA 5BT4A 4NR5A 4TTEA 4CLBA 4NR6A 5FE4A 4PTBA 2WP2A 5ENHA 4IORA 4UYHA 4TZ8A 5CQAA 5FDZA 5KHMA 5I1QA 5A82A 2DWWA 4LYSA 4YK0A 4YYDA 3HMHA 3UV4A 5E3DA 5FE8A 4YABA 4HXOA 4RVRA 5EVAA 4A9IA 4QR3A 5HQ6A 5E9MA 5CFWA 4QSUA 4DONA 5FG4A 5FBXA 5A5RA 4XUAA 4YH3A 5A5QA 5EWWA 4BJXA 4CURA 5JWMA 3AQAA 5ETBA 1F68A 3LXJA 5CRZA 2G4AA 4QEUA 2RNXA 2R0VA 2F6JA 5E9VA 5EISA 3SVFA 4IR3A 4CL9A 4QSSA 5L97A 4NR4A 4X2IA 3JVJA 4QUUA 5AMFA 4E96A 4O76A 5EV9A 2DVQA 4O77A 3IU5A 5EICA 2YQDA 4A9LA 4O78A 5F1HA 3AADA 4O7CA 5DX4A 5D3JA 4HBWA 5C85A 5CGPA 5IGNA 3G0JA 4LRGA 4N4GA 4UIZA 5KTXA 4Z93A 5DYAA 4UYDA 5IGMA 4TQNA 2RI7A 4QSPA 5FE6A 4LZ2A 5HENA 2RNYA 5EPRA 4Z1QA 5FH6A 2YELA 4BHWA 5AMEA 5IG6A 3JVLA 3O35A 4N4HA 3QZSA 4F3IA 5I88A 4WHUA 2YDWA 5CP5A 4YYJA 4HXNA 1ZS5A 3RCWA 3ZYUA 5AD3A 4QNSA 4CUPA 4QSRA 5HLSA 5ENEA 5DYXA 1N72A 3O36A 4NUCA 5F1LA 5E0RA 5LUUA 4MENA 5DYUA 5EGUA 5BT3A 5E3GA 5EP7A 3SVHA 4Q0NA 4FLPA 5DLXA 2DKWA 5I7XA 3Q2EA 5IGLA 3UV2A 3SVGA 4MR5A 3D7CA 5CQ3A 4PCEA 5I83A 5CRMA 5A81A 2OSSA 5HRVA 4CUTA 1EQFA 4KCXA 5D7XA 4QEVA 5I29A 5CPEA 5II1A 2L84A 5F5ZA 5FB1A 4UYGA 5H1UA 2L5EA 5II2A 4IOOA 4MEOA 4QB3A 4N4FA 4HBXA 5J0DA 4NUDA 5G4RA 4UIXA 5CY9A 5L8UA 3QZVA 5DKDA 3UVWA 2I7KA 5CZGA 4QR4A 5E9IA 3LJWA 2D9EA 4N3WA 4A9NA 4TU6A 2RNWA 5HFQA 5A85A 4MEQA 3MXFA 4YATA 4Z1SA 5FE5A 4CUQA 4A9OA 5A5PA 1JM4B 4BW1A 4O7EA 5FFYA 4YH4A 3TLPA 4J3IA 5IIDA 5HM0A 5CU8A 5DKHA 2RO1A 4NRAA 4WIVA 5EWHA 3DAIA 3LQIA 3U5PA 3U5MA 5CQTA 4J0SA 1JSPB 3U5JA 5DBMA 3O37A 5FE0A 4A9JA 3Q2FA 4O72A 4YYIA 4NQMA 3S92A 5HEMA 2D82A 4A9FA 5EI4A 5EPSA 5COIA 5CQ4A 3NXBA 4MEPA 5LVRA 4PY6A 5DW2A 4TT2A 5A83A 5D0CA 3FKMX 2DVRA 4XY8A 5G4SA 4ALGA 5LJ0A 5I7YA 4IOQA 3QZTA 3LQJA 2DVVA 4KV4A 4NR9A 4O74A 4A9MA 5FE7A 5D3SA 3K2JA 4ZW1A 5C87A 5EU1A 3U5NA 4PCIA 5E74A 5FE9A 4YYGA 5D25A 5EK9A 2DATA 5F2PA 5KU3A 4HXMA 1E6IA 4QSQA 2YYNA 5F63A 5EWCA 4LYIA 2H60A 4LZRA 5A7CA 5CUBA 4LYWA 3P1DA 5CUDA 4YBMA 4XYAA 5EM3A 4HXLA 4UYEA 2FSAA 4YYMA 5LKTA 2L85A 3JVKA 5E7DA 3I3JA 4Q0OA 4Z6HA 3G0LA 3O33A 4N4IA 4BW3A 4YY4A 5F36A 2E7OA 5ETDA 4ALHA 4YBTA 4KV1A 3DWYA 4QYLA 4Y03A 4HXKA 4HBVA 3MQMA 3IU6A 5I40A 5FG6A 4BW4A 3P5OA 4ZQLA 3UVDA 3UV5A 4NQNA 5CUEA 4A9EA 5L99A 4IR6A 4NRCA 5L98A 5DY7A 5K29A 2N9GA 5EPBA 5L8TA 5LJ2A 5HFRA 4MR6A 4HXPA 5ENIA 5I89A 5HRWA 4LR6A 2OUOA 3U5LA 2E7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0R A;  3HME A;  4YYH A;  5CQ8 A;  5D3H A;  5C4Q A;  5D3T A;  4LZS A;  5HRX A;  4WHW A;  4CUS A;  5H85 A;  3U5K A;  4QUT A;  4TZ2 A;  5F61 A;  2DVS A;  5ACY A;  3JVM A;  5HQ7 A;  4O7B A;  4O75 A;  4O7A A;  4UIT A;  2YEM A;  4HXS A;  4O71 A;  4O70 A;  5DKC A;  5LJ1 A;  4UIU A;  2WP1 A;  4NR8 A;  4QC3 A;  5E73 A;  3HMF A;  4CFK A;  4NYW A;  4J1P A;  3U5O A;  4UYF B;  3MUL A;  4YAD A;  1X0J A;  4OGJ A;  3S91 A;  5FH7 A;  5EQ1 A;  5A5N A;  3ONI A;  5D3N A;  5F60 A;  4YBS A;  4UYF A;  3MB4 A;  5JI8 A;  5ENG A;  4XUB A;  4A9H A;  5CUG A;  4TT4 A;  2OO1 A;  4NYX A;  4O7F A;  5CQ7 A;  2R10 A;  4C67 A;  4IR4 A;  5ENJ A;  5DFC A;  5FB0 A;  4LDF A;  5IGK A;  5HJC A;  5L96 A;  5F25 A;  4QSV A;  2KTB B;  5D3L A;  5D3R A;  5EWV A;  1WUG A;  4IR5 A;  2F6N A;  4QBM A;  5DYC A;  5I86 A;  4YYN A;  5F62 A;  3UVX A;  2E3K A;  4QY4 A;  5FE1 A;  4QSW A;  4A9K A;  4MR3 A;  5FFW A;  4HXR A;  4CUU A;  5HQ5 A;  2NXB A;  5E9L A;  5F3A A;  5CQ5 A;  4NYV A;  4MR4 A;  5H1T A;  5A5O A;  2R0Y A;  2GRC A;  3O34 A;  4OGI A;  5TB6 A;  5ENB A;  4AKN A;  5E9K A;  5LKZ A;  4TS8 A;  5KTW A;  5KTU A;  5DFD A;  4C66 A;  3P1F A;  5ENF A;  3MUK A;  5TCM A;  4UIW A;  5FE2 A;  5EWD A;  5LKU A;  2MJV B;  4QZS A;  5C89 A;  4YAX A;  5D24 A;  5E9Y A;  4TT6 A;  5BT5 A;  5C7N A;  4ZC9 A;  3MB3 A;  5FH8 A;  2R0S A;  4NUE A;  5DLZ A;  5CUC A;  4TU4 A;  4TYL A;  5CUA A;  4YY6 A;  5EA1 A;  5H1V A;  4QST A;  4CFL A;  4GPJ A;  4NRB A;  4QYD A;  5DFB A;  3LQH A;  5CTL A;  5ENC A;  5FFV A;  5C8G A;  1WUM A;  4YYK A;  4QR5 A;  4LC2 A;  5CQ6 A;  5FE3 A;  5FG5 A;  2I8N A;  4NXJ A;  4XY9 A;  4QEW A;  4YC9 A;  4NR7 A;  4NS5 A;  4HBY A;  2YW5 A;  3UW9 A;  5I80 A;  3UVY A;  5LKX A;  5HCL A;  5IBN A;  3P1E A;  3GG3 A;  4QC1 A;  4PKL A;  3P1C A;  4BW2 A;  5A5S A;  4QSX A;  4OUF A;  4PS5 A;  2RFJ A;  5DW1 A;  5LVQ A;  5D26 A;  4Z6I A;  5KO4 A;  5D3P A;  4UIY A;  2RS9 B;  2LSP B;  5AD2 A;  4UIV A;  2YEK A;  5CS8 A;  5HEL A;  5BT4 A;  4NR5 A;  4TTE A;  4CLB A;  4NR6 A;  5FE4 A;  4PTB A;  2WP2 A;  5ENH A;  4IOR A;  4UYH A;  4TZ8 A;  5CQA A;  5FDZ A;  5KHM A;  5I1Q A;  5A82 A;  2DWW A;  4LYS A;  4YK0 A;  4YYD A;  3HMH A;  3UV4 A;  5E3D A;  5FE8 A;  4YAB A;  4HXO A;  4RVR A;  5EVA A;  4A9I A;  4QR3 A;  5HQ6 A;  5E9M A;  5CFW A;  4QSU A;  4DON A;  5FG4 A;  5FBX A;  5A5R A;  4XUA A;  4YH3 A;  5A5Q A;  5EWW A;  4BJX A;  4CUR A;  5JWM A;  3AQA A;  5ETB A;  1F68 A;  3LXJ A;  5CRZ A;  2G4A A;  4QEU A;  2RNX A;  2R0V A;  2F6J A;  5E9V A;  5EIS A;  3SVF A;  4IR3 A;  4CL9 A;  4QSS A;  5L97 A;  4NR4 A;  4X2I A;  3JVJ A;  4QUU A;  5AMF A;  4E96 A;  4O76 A;  5EV9 A;  2DVQ A;  4O77 A;  3IU5 A;  5EIC A;  2YQD A;  4A9L A;  4O78 A;  5F1H A;  3AAD A;  4O7C A;  5DX4 A;  5D3J A;  4HBW A;  5C85 A;  5CGP A;  5IGN A;  3G0J A;  4LRG A;  4N4G A;  4UIZ A;  5KTX A;  4Z93 A;  5DYA A;  4UYD A;  5IGM A;  4TQN A;  2RI7 A;  4QSP A;  5FE6 A;  4LZ2 A;  5HEN A;  2RNY A;  5EPR A;  4Z1Q A;  5FH6 A;  2YEL A;  4BHW A;  5AME A;  5IG6 A;  3JVL A;  3O35 A;  4N4H A;  3QZS A;  4F3I A;  5I88 A;  4WHU A;  2YDW A;  5CP5 A;  4YYJ A;  4HXN A;  1ZS5 A;  3RCW A;  3ZYU A;  5AD3 A;  4QNS A;  4CUP A;  4QSR A;  5HLS A;  5ENE A;  5DYX A;  1N72 A;  3O36 A;  4NUC A;  5F1L A;  5E0R A;  5LUU A;  4MEN A;  5DYU A;  5EGU A;  5BT3 A;  5E3G A;  5EP7 A;  3SVH A;  4Q0N A;  4FLP A;  5DLX A;  2DKW A;  5I7X A;  3Q2E A;  5IGL A;  3UV2 A;  3SVG A;  4MR5 A;  3D7C A;  5CQ3 A;  4PCE A;  5I83 A;  5CRM A;  5A81 A;  2OSS A;  5HRV A;  4CUT A;  1EQF A;  4KCX A;  5D7X A;  4QEV A;  5I29 A;  5CPE A;  5II1 A;  2L84 A;  5F5Z A;  5FB1 A;  4UYG A;  5H1U A;  2L5E A;  5II2 A;  4IOO A;  4MEO A;  4QB3 A;  4N4F A;  4HBX A;  5J0D A;  4NUD A;  5G4R A;  4UIX A;  5CY9 A;  5L8U A;  3QZV A;  5DKD A;  3UVW A;  2I7K A;  5CZG A;  4QR4 A;  5E9I A;  3LJW A;  2D9E A;  4N3W A;  4A9N A;  4TU6 A;  2RNW A;  5HFQ A;  5A85 A;  4MEQ A;  3MXF A;  4YAT A;  4Z1S A;  5FE5 A;  4CUQ A;  4A9O A;  5A5P A;  1JM4 B;  4BW1 A;  4O7E A;  5FFY A;  4YH4 A;  3TLP A;  4J3I A;  5IID A;  5HM0 A;  5CU8 A;  5DKH A;  2RO1 A;  4NRA A;  4WIV A;  5EWH A;  3DAI A;  3LQI A;  3U5P A;  3U5M A;  5CQT A;  4J0S A;  1JSP B;  3U5J A;  5DBM A;  3O37 A;  5FE0 A;  4A9J A;  3Q2F A;  4O72 A;  4YYI A;  4NQM A;  3S92 A;  5HEM A;  2D82 A;  4A9F A;  5EI4 A;  5EPS A;  5COI A;  5CQ4 A;  3NXB A;  4MEP A;  5LVR A;  4PY6 A;  5DW2 A;  4TT2 A;  5A83 A;  5D0C A;  3FKM X;  2DVR A;  4XY8 A;  5G4S A;  4ALG A;  5LJ0 A;  5I7Y A;  4IOQ A;  3QZT A;  3LQJ A;  2DVV A;  4KV4 A;  4NR9 A;  4O74 A;  4A9M A;  5FE7 A;  5D3S A;  3K2J A;  4ZW1 A;  5C87 A;  5EU1 A;  3U5N A;  4PCI A;  5E74 A;  5FE9 A;  4YYG A;  5D25 A;  5EK9 A;  2DAT A;  5F2P A;  5KU3 A;  4HXM A;  1E6I A;  4QSQ A;  2YYN A;  5F63 A;  5EWC A;  4LYI A;  2H60 A;  4LZR A;  5A7C A;  5CUB A;  4LYW A;  3P1D A;  5CUD A;  4YBM A;  4XYA A;  5EM3 A;  4HXL A;  4UYE A;  2FSA A;  4YYM A;  5LKT A;  2L85 A;  3JVK A;  5E7D A;  3I3J A;  4Q0O A;  4Z6H A;  3G0L A;  3O33 A;  4N4I A;  4BW3 A;  4YY4 A;  5F36 A;  2E7O A;  5ETD A;  4ALH A;  4YBT A;  4KV1 A;  3DWY A;  4QYL A;  4Y03 A;  4HXK A;  4HBV A;  3MQM A;  3IU6 A;  5I40 A;  5FG6 A;  4BW4 A;  3P5O A;  4ZQL A;  3UVD A;  3UV5 A;  4NQN A;  5CUE A;  4A9E A;  5L99 A;  4IR6 A;  4NRC A;  5L98 A;  5DY7 A;  5K29 A;  2N9G A;  5EPB A;  5L8T A;  5LJ2 A;  5HFR A;  4MR6 A;  4HXP A;  5ENI A;  5I89 A;  5HRW A;  4LR6 A;  2OUO A;  3U5L A;  2E7N A; 
#chains in the Genus database with same CATH topology
 4J0R A;  3HME A;  4YYH A;  5CQ8 A;  5D3H A;  5C4Q A;  5D3T A;  4LZS A;  5HRX A;  4WHW A;  4CUS A;  5H85 A;  3U5K A;  4QUT A;  4TZ2 A;  5F61 A;  2DVS A;  5ACY A;  3JVM A;  5HQ7 A;  4O7B A;  4O75 A;  4O7A A;  4UIT A;  2YEM A;  4HXS A;  4O71 A;  4O70 A;  5DKC A;  5LJ1 A;  4UIU A;  2WP1 A;  4NR8 A;  4QC3 A;  5E73 A;  3HMF A;  4CFK A;  4NYW A;  4J1P A;  3U5O A;  4UYF B;  3MUL A;  4YAD A;  1X0J A;  4OGJ A;  3S91 A;  5FH7 A;  5EQ1 A;  5A5N A;  3ONI A;  5D3N A;  5F60 A;  4YBS A;  4UYF A;  3MB4 A;  5JI8 A;  5ENG A;  4XUB A;  4A9H A;  5CUG A;  4TT4 A;  2OO1 A;  4NYX A;  4O7F A;  5CQ7 A;  2R10 A;  4C67 A;  4IR4 A;  5ENJ A;  5DFC A;  5FB0 A;  4LDF A;  5IGK A;  5HJC A;  5L96 A;  5F25 A;  4QSV A;  2KTB B;  5D3L A;  5D3R A;  5EWV A;  1WUG A;  4IR5 A;  2F6N A;  4QBM A;  5DYC A;  5I86 A;  4YYN A;  5F62 A;  3UVX A;  2E3K A;  4QY4 A;  5FE1 A;  4QSW A;  4A9K A;  4MR3 A;  5FFW A;  4HXR A;  4CUU A;  5HQ5 A;  2NXB A;  5E9L A;  5F3A A;  5CQ5 A;  4NYV A;  4MR4 A;  5H1T A;  5A5O A;  2R0Y A;  2GRC A;  3O34 A;  4OGI A;  5TB6 A;  5ENB A;  4AKN A;  5E9K A;  5LKZ A;  4TS8 A;  5KTW A;  5KTU A;  5DFD A;  4C66 A;  3P1F A;  5ENF A;  3MUK A;  5TCM A;  4UIW A;  5FE2 A;  5EWD A;  5LKU A;  2MJV B;  4QZS A;  5C89 A;  4YAX A;  5D24 A;  5E9Y A;  4TT6 A;  5BT5 A;  5C7N A;  4ZC9 A;  3MB3 A;  5FH8 A;  2R0S A;  4NUE A;  5DLZ A;  5CUC A;  4TU4 A;  4TYL A;  5CUA A;  4YY6 A;  5EA1 A;  5H1V A;  4QST A;  4CFL A;  4GPJ A;  4NRB A;  4QYD A;  5DFB A;  3LQH A;  5CTL A;  5ENC A;  5FFV A;  5C8G A;  1WUM A;  4YYK A;  4QR5 A;  4LC2 A;  5CQ6 A;  5FE3 A;  5FG5 A;  2I8N A;  4NXJ A;  4XY9 A;  4QEW A;  4YC9 A;  4NR7 A;  4NS5 A;  4AKI A;  4HBY A;  2YW5 A;  3UW9 A;  5I80 A;  3UVY A;  5LKX A;  5HCL A;  5IBN A;  3P1E A;  3GG3 A;  4QC1 A;  4PKL A;  3P1C A;  4BW2 A;  5A5S A;  4QSX A;  4OUF A;  4PS5 A;  2RFJ A;  5DW1 A;  5LVQ A;  5D26 A;  4Z6I A;  5KO4 A;  5D3P A;  4UIY A;  2RS9 B;  2LSP B;  5AD2 A;  4UIV A;  3VKH A;  2YEK A;  5CS8 A;  5HEL A;  5BT4 A;  4NR5 A;  2EJN A;  4TTE A;  3D1D A;  4CLB A;  4NR6 A;  5FE4 A;  4PTB A;  2WP2 A;  5ENH A;  4IOR A;  4UYH A;  4TZ8 A;  5CQA A;  5FDZ A;  5KHM A;  5I1Q A;  5A82 A;  2DWW A;  4LYS A;  4YK0 A;  4YYD A;  3HMH A;  3UV4 A;  5E3D A;  5FE8 A;  4YAB A;  4HXO A;  4RVR A;  5EVA A;  4A9I A;  4QR3 A;  5HQ6 A;  5E9M A;  5CFW A;  4QSU A;  4DON A;  4AI6 A;  5FG4 A;  5FBX A;  5A5R A;  4XUA A;  4YH3 A;  5A5Q A;  5EWW A;  4BJX A;  4CUR A;  5JWM A;  3AQA A;  5ETB A;  1F68 A;  3LXJ A;  5CRZ A;  2G4A A;  4QEU A;  2RNX A;  2R0V A;  2F6J A;  5E9V A;  5EIS A;  3SVF A;  4IR3 A;  4CL9 A;  4QSS A;  5L97 A;  4NR4 A;  4X2I A;  3JVJ A;  4QUU A;  5AMF A;  4E96 A;  4O76 A;  5EV9 A;  2DVQ A;  4O77 A;  3IU5 A;  5EIC A;  2YQD A;  4A9L A;  4O78 A;  5F1H A;  3AAD A;  4O7C A;  5DX4 A;  5D3J A;  4HBW A;  5C85 A;  5CGP A;  5IGN A;  3G0J A;  4LRG A;  4N4G A;  4UIZ A;  5KTX A;  4AKH A;  4Z93 A;  5DYA A;  4UYD A;  5IGM A;  4TQN A;  2RI7 A;  4QSP A;  5FE6 A;  4LZ2 A;  5HEN A;  2RNY A;  5EPR A;  4Z1Q A;  5FH6 A;  2YEL A;  4BHW A;  1ZKR A;  5AME A;  5IG6 A;  3JVL A;  3O35 A;  4N4H A;  3QZS A;  4F3I A;  5I88 A;  4WHU A;  2YDW A;  5CP5 A;  4YYJ A;  4HXN A;  1ZS5 A;  3RCW A;  3ZYU A;  5AD3 A;  4QNS A;  4CUP A;  4QSR A;  5HLS A;  5ENE A;  5DYX A;  1N72 A;  3O36 A;  4NUC A;  5F1L A;  5E0R A;  5LUU A;  4MEN A;  5DYU A;  5EGU A;  5BT3 A;  5E3G A;  5EP7 A;  3SVH A;  4Q0N A;  4FLP A;  5DLX A;  2DKW A;  5I7X A;  3Q2E A;  5IGL A;  3UV2 A;  3SVG A;  4MR5 A;  3D7C A;  5CQ3 A;  4PCE A;  5I83 A;  5CRM A;  5A81 A;  2OSS A;  5HRV A;  4CUT A;  1EQF A;  4KCX A;  5D7X A;  4QEV A;  5I29 A;  3VKG A;  5CPE A;  5II1 A;  2L84 A;  5F5Z A;  5FB1 A;  4UYG A;  5H1U A;  2L5E A;  5II2 A;  4IOO A;  4MEO A;  4QB3 A;  4N4F A;  4HBX A;  5J0D A;  4NUD A;  5G4R A;  4UIX A;  5CY9 A;  5L8U A;  3QZV A;  5DKD A;  3UVW A;  2I7K A;  5CZG A;  4QR4 A;  5E9I A;  3LJW A;  2D9E A;  4N3W A;  4A9N A;  4TU6 A;  2RNW A;  5HFQ A;  5A85 A;  4MEQ A;  3MXF A;  4YAT A;  4Z1S A;  5FE5 A;  4CUQ A;  4A9O A;  5A5P A;  1JM4 B;  4BW1 A;  4O7E A;  5FFY A;  4YH4 A;  3TLP A;  4J3I A;  5IID A;  5HM0 A;  5CU8 A;  5DKH A;  2RO1 A;  4NRA A;  4WIV A;  5EWH A;  3DAI A;  3LQI A;  3U5P A;  3U5M A;  5CQT A;  4J0S A;  3D1B A;  1JSP B;  3U5J A;  5DBM A;  3O37 A;  5FE0 A;  4A9J A;  3Q2F A;  4O72 A;  4YYI A;  4NQM A;  3S92 A;  5HEM A;  2D82 A;  4A9F A;  4AKG A;  5EI4 A;  5EPS A;  5COI A;  5CQ4 A;  3NXB A;  4MEP A;  5LVR A;  4PY6 A;  5DW2 A;  4TT2 A;  5A83 A;  5D0C A;  3FKM X;  2DVR A;  4XY8 A;  5G4S A;  4ALG A;  5LJ0 A;  5I7Y A;  4IOQ A;  3QZT A;  3LQJ A;  2DVV A;  4KV4 A;  4NR9 A;  4O74 A;  4A9M A;  5FE7 A;  5D3S A;  3K2J A;  4ZW1 A;  5C87 A;  5EU1 A;  3U5N A;  4PCI A;  5E74 A;  5FE9 A;  4YYG A;  5D25 A;  5EK9 A;  2DAT A;  5F2P A;  5KU3 A;  4HXM A;  1E6I A;  4QSQ A;  2YYN A;  5F63 A;  5EWC A;  4LYI A;  2H60 A;  3ERR A;  4LZR A;  5A7C A;  5CUB A;  4LYW A;  3P1D A;  5CUD A;  4YBM A;  4XYA A;  5EM3 A;  4HXL A;  4UYE A;  2FSA A;  4YYM A;  5LKT A;  2L85 A;  3JVK A;  5E7D A;  3I3J A;  4Q0O A;  4Z6H A;  3G0L A;  3O33 A;  4N4I A;  4BW3 A;  4YY4 A;  5F36 A;  2E7O A;  5ETD A;  4ALH A;  4YBT A;  4KV1 A;  3DWY A;  4QYL A;  4Y03 A;  4HXK A;  4HBV A;  3MQM A;  3IU6 A;  5I40 A;  5FG6 A;  4BW4 A;  3P5O A;  4ZQL A;  3UVD A;  3UV5 A;  4NQN A;  5CUE A;  4A9E A;  5L99 A;  4IR6 A;  4NRC A;  5L98 A;  5DY7 A;  5K29 A;  2N9G A;  5EPB A;  5L8T A;  5LJ2 A;  5HFR A;  4MR6 A;  4HXP A;  5ENI A;  5I89 A;  5HRW A;  4LR6 A;  2OUO A;  3U5L A;  2E7N A;  1PUO A; 
#chains in the Genus database with same CATH homology
 4J0R A;  3HME A;  4YYH A;  5CQ8 A;  5D3H A;  5C4Q A;  5D3T A;  4LZS A;  5HRX A;  4WHW A;  4CUS A;  5H85 A;  3U5K A;  4QUT A;  4TZ2 A;  5F61 A;  2DVS A;  5ACY A;  3JVM A;  5HQ7 A;  4O7B A;  4O75 A;  4O7A A;  4UIT A;  2YEM A;  4HXS A;  4O71 A;  4O70 A;  5DKC A;  5LJ1 A;  4UIU A;  2WP1 A;  4NR8 A;  4QC3 A;  5E73 A;  3HMF A;  4CFK A;  4NYW A;  4J1P A;  3U5O A;  4UYF B;  3MUL A;  4YAD A;  1X0J A;  4OGJ A;  3S91 A;  5FH7 A;  5EQ1 A;  5A5N A;  3ONI A;  5D3N A;  5F60 A;  4YBS A;  4UYF A;  3MB4 A;  5JI8 A;  5ENG A;  4XUB A;  4A9H A;  5CUG A;  4TT4 A;  2OO1 A;  4NYX A;  4O7F A;  5CQ7 A;  2R10 A;  4C67 A;  4IR4 A;  5ENJ A;  5DFC A;  5FB0 A;  4LDF A;  5IGK A;  5HJC A;  5L96 A;  5F25 A;  4QSV A;  2KTB B;  5D3L A;  5D3R A;  5EWV A;  1WUG A;  4IR5 A;  2F6N A;  4QBM A;  5DYC A;  5I86 A;  4YYN A;  5F62 A;  3UVX A;  2E3K A;  4QY4 A;  5FE1 A;  4QSW A;  4A9K A;  4MR3 A;  5FFW A;  4HXR A;  4CUU A;  5HQ5 A;  2NXB A;  5E9L A;  5F3A A;  5CQ5 A;  4NYV A;  4MR4 A;  5H1T A;  5A5O A;  2R0Y A;  2GRC A;  3O34 A;  4OGI A;  5TB6 A;  5ENB A;  4AKN A;  5E9K A;  5LKZ A;  4TS8 A;  5KTW A;  5KTU A;  5DFD A;  4C66 A;  3P1F A;  5ENF A;  3MUK A;  5TCM A;  4UIW A;  5FE2 A;  5EWD A;  5LKU A;  2MJV B;  4QZS A;  5C89 A;  4YAX A;  5D24 A;  5E9Y A;  4TT6 A;  5BT5 A;  5C7N A;  4ZC9 A;  3MB3 A;  5FH8 A;  2R0S A;  4NUE A;  5DLZ A;  5CUC A;  4TU4 A;  4TYL A;  5CUA A;  4YY6 A;  5EA1 A;  5H1V A;  4QST A;  4CFL A;  4GPJ A;  4NRB A;  4QYD A;  5DFB A;  3LQH A;  5CTL A;  5ENC A;  5FFV A;  5C8G A;  1WUM A;  4YYK A;  4QR5 A;  4LC2 A;  5CQ6 A;  5FE3 A;  5FG5 A;  2I8N A;  4NXJ A;  4XY9 A;  4QEW A;  4YC9 A;  4NR7 A;  4NS5 A;  4HBY A;  2YW5 A;  3UW9 A;  5I80 A;  3UVY A;  5LKX A;  5HCL A;  5IBN A;  3P1E A;  3GG3 A;  4QC1 A;  4PKL A;  3P1C A;  4BW2 A;  5A5S A;  4QSX A;  4OUF A;  4PS5 A;  2RFJ A;  5DW1 A;  5LVQ A;  5D26 A;  4Z6I A;  5KO4 A;  5D3P A;  4UIY A;  2RS9 B;  2LSP B;  5AD2 A;  4UIV A;  2YEK A;  5CS8 A;  5HEL A;  5BT4 A;  4NR5 A;  4TTE A;  4CLB A;  4NR6 A;  5FE4 A;  4PTB A;  2WP2 A;  5ENH A;  4IOR A;  4UYH A;  4TZ8 A;  5CQA A;  5FDZ A;  5KHM A;  5I1Q A;  5A82 A;  2DWW A;  4LYS A;  4YK0 A;  4YYD A;  3HMH A;  3UV4 A;  5E3D A;  5FE8 A;  4YAB A;  4HXO A;  4RVR A;  5EVA A;  4A9I A;  4QR3 A;  5HQ6 A;  5E9M A;  5CFW A;  4QSU A;  4DON A;  5FG4 A;  5FBX A;  5A5R A;  4XUA A;  4YH3 A;  5A5Q A;  5EWW A;  4BJX A;  4CUR A;  5JWM A;  3AQA A;  5ETB A;  1F68 A;  3LXJ A;  5CRZ A;  2G4A A;  4QEU A;  2RNX A;  2R0V A;  2F6J A;  5E9V A;  5EIS A;  3SVF A;  4IR3 A;  4CL9 A;  4QSS A;  5L97 A;  4NR4 A;  4X2I A;  3JVJ A;  4QUU A;  5AMF A;  4E96 A;  4O76 A;  5EV9 A;  2DVQ A;  4O77 A;  3IU5 A;  5EIC A;  2YQD A;  4A9L A;  4O78 A;  5F1H A;  3AAD A;  4O7C A;  5DX4 A;  5D3J A;  4HBW A;  5C85 A;  5CGP A;  5IGN A;  3G0J A;  4LRG A;  4N4G A;  4UIZ A;  5KTX A;  4Z93 A;  5DYA A;  4UYD A;  5IGM A;  4TQN A;  2RI7 A;  4QSP A;  5FE6 A;  4LZ2 A;  5HEN A;  2RNY A;  5EPR A;  4Z1Q A;  5FH6 A;  2YEL A;  4BHW A;  5AME A;  5IG6 A;  3JVL A;  3O35 A;  4N4H A;  3QZS A;  4F3I A;  5I88 A;  4WHU A;  2YDW A;  5CP5 A;  4YYJ A;  4HXN A;  1ZS5 A;  3RCW A;  3ZYU A;  5AD3 A;  4QNS A;  4CUP A;  4QSR A;  5HLS A;  5ENE A;  5DYX A;  1N72 A;  3O36 A;  4NUC A;  5F1L A;  5E0R A;  5LUU A;  4MEN A;  5DYU A;  5EGU A;  5BT3 A;  5E3G A;  5EP7 A;  3SVH A;  4Q0N A;  4FLP A;  5DLX A;  2DKW A;  5I7X A;  3Q2E A;  5IGL A;  3UV2 A;  3SVG A;  4MR5 A;  3D7C A;  5CQ3 A;  4PCE A;  5I83 A;  5CRM A;  5A81 A;  2OSS A;  5HRV A;  4CUT A;  1EQF A;  4KCX A;  5D7X A;  4QEV A;  5I29 A;  5CPE A;  5II1 A;  2L84 A;  5F5Z A;  5FB1 A;  4UYG A;  5H1U A;  2L5E A;  5II2 A;  4IOO A;  4MEO A;  4QB3 A;  4N4F A;  4HBX A;  5J0D A;  4NUD A;  5G4R A;  4UIX A;  5CY9 A;  5L8U A;  3QZV A;  5DKD A;  3UVW A;  2I7K A;  5CZG A;  4QR4 A;  5E9I A;  3LJW A;  2D9E A;  4N3W A;  4A9N A;  4TU6 A;  2RNW A;  5HFQ A;  5A85 A;  4MEQ A;  3MXF A;  4YAT A;  4Z1S A;  5FE5 A;  4CUQ A;  4A9O A;  5A5P A;  1JM4 B;  4BW1 A;  4O7E A;  5FFY A;  4YH4 A;  3TLP A;  4J3I A;  5IID A;  5HM0 A;  5CU8 A;  5DKH A;  2RO1 A;  4NRA A;  4WIV A;  5EWH A;  3DAI A;  3LQI A;  3U5P A;  3U5M A;  5CQT A;  4J0S A;  1JSP B;  3U5J A;  5DBM A;  3O37 A;  5FE0 A;  4A9J A;  3Q2F A;  4O72 A;  4YYI A;  4NQM A;  3S92 A;  5HEM A;  2D82 A;  4A9F A;  5EI4 A;  5EPS A;  5COI A;  5CQ4 A;  3NXB A;  4MEP A;  5LVR A;  4PY6 A;  5DW2 A;  4TT2 A;  5A83 A;  5D0C A;  3FKM X;  2DVR A;  4XY8 A;  5G4S A;  4ALG A;  5LJ0 A;  5I7Y A;  4IOQ A;  3QZT A;  3LQJ A;  2DVV A;  4KV4 A;  4NR9 A;  4O74 A;  4A9M A;  5FE7 A;  5D3S A;  3K2J A;  4ZW1 A;  5C87 A;  5EU1 A;  3U5N A;  4PCI A;  5E74 A;  5FE9 A;  4YYG A;  5D25 A;  5EK9 A;  2DAT A;  5F2P A;  5KU3 A;  4HXM A;  1E6I A;  4QSQ A;  2YYN A;  5F63 A;  5EWC A;  4LYI A;  2H60 A;  4LZR A;  5A7C A;  5CUB A;  4LYW A;  3P1D A;  5CUD A;  4YBM A;  4XYA A;  5EM3 A;  4HXL A;  4UYE A;  2FSA A;  4YYM A;  5LKT A;  2L85 A;  3JVK A;  5E7D A;  3I3J A;  4Q0O A;  4Z6H A;  3G0L A;  3O33 A;  4N4I A;  4BW3 A;  4YY4 A;  5F36 A;  2E7O A;  5ETD A;  4ALH A;  4YBT A;  4KV1 A;  3DWY A;  4QYL A;  4Y03 A;  4HXK A;  4HBV A;  3MQM A;  3IU6 A;  5I40 A;  5FG6 A;  4BW4 A;  3P5O A;  4ZQL A;  3UVD A;  3UV5 A;  4NQN A;  5CUE A;  4A9E A;  5L99 A;  4IR6 A;  4NRC A;  5L98 A;  5DY7 A;  5K29 A;  2N9G A;  5EPB A;  5L8T A;  5LJ2 A;  5HFR A;  4MR6 A;  4HXP A;  5ENI A;  5I89 A;  5HRW A;  4LR6 A;  2OUO A;  3U5L A;  2E7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...