2R0VA

Structure of the rsc4 tandem bromodomain acetylated at k25
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
293
structure length
292
Chain Sequence
PKYLPGHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin structure-remodeling complex protein RSC4
publication title Autoregulation of the rsc4 tandem bromodomain by gcn5 acetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 103
structure length 292
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0vA01
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0vA02
2GRCA 4Y03A 3UV5A 4MR4A 4UIVA 4MR6A 4YC9A 5FE4A 1WUMA 5HJCA 5CRZA 5EA1A 2OUOA 5L8UA 5A5NA 4NS5A 4J0RA 3IU5A 5I89A 5FE9A 5E3DA 4QYLA 2RNYA 5FH7A 5AD3A 4O75A 5EVAA 5LKUA 5DFCA 4NYWA 5LVRA 2N9GA 4NXJA 5LJ1A 4YYIA 4OUFA 5EISA 4YATA 4TU4A 5I86A 3MULA 5KTUA 5D26A 3UVDA 4TZ2A 4YYGA 4TU6A 4J1PA 5EPSA 4WHUA 4X2IA 5LKXA 5IGMA 2DVVA 4KV4A 4HXNA 4LYSA 4NR6A 5KO4A 3SVFA 2R10A 3P5OA 5D25A 5BT5A 4CUQA 4N4IA 3UVYA 4QNSA 3MQMA 5AMFA 5D3PA 4LDFA 2RFJA 4UYFA 1ZS5A 3HMFA 4HBVA 5F5ZA 5CPEA 5FG6A 4UYHA 4UYDA 4XUAA 3Q2FA 5E3GA 4ZC9A 4QSTA 4LYIA 4Q0NA 4NR9A 5DLXA 4UIZA 5CQ3A 4LYWA 4O7AA 5FE5A 4MENA 5I88A 5KHMA 3U5JA 5D3JA 5CU8A 5D3RA 5HRXA 5IG6A 2KTBB 5HQ5A 4BW4A 3AADA 4O78A 5DBMA 4N3WA 4CLBA 4LZSA 4NRBA 4ALGA 5L99A 2YDWA 3UV4A 2YW5A 5E73A 2RS9B 5DKHA 4BHWA 5FH8A 5ENFA 4O7BA 4QBMA 5CUAA 4TTEA 3IU6A 3AQAA 4BJXA 3MB3A 5FB1A 5A5QA 5BT3A 4GPJA 5HQ7A 4LZ2A 4YYHA 2DVRA 4XYAA 4OGJA 4LR6A 5I29A 4ALHA 4QC3A 5II1A 5I40A 4YYMA 5F63A 2H60A 4HXPA 2DWWA 5DX4A 4QSVA 5D3NA 3MXFA 4CUSA 4QY4A 5I7YA 5L97A 5FB0A 5E74A 3SVGA 5EGUA 5H1TA 5KTXA 4HXLA 2D82A 5ENCA 5ETDA 4UIYA 5A82A 3LQJA 4QYDA 4Z1QA 3D7CA 5A5OA 5CFWA 5E9VA 4YY4A 5I7XA 5I1QA 5C85A 4QEVA 2G4AA 3QZVA 5H1VA 5CUBA 3MB4A 5DFDA 5IBNA 4Z93A 4CUTA 4QSWA 4A9LA 4YYKA 5EICA 5L96A 4YYJA 4HXRA 5ENIA 4NYXA 3UW9A 4UIWA 5A81A 4YBMA 4YYDA 2I7KA 3DAIA 5DKDA 4AKNA 5F62A 4LZRA 4YH4A 4KCXA 5DY7A 5E9KA 5F61A 5CUCA 3U5NA 5CRMA 4NQNA 5A5SA 5EPRA 2D9EA 2F6NA 5AMEA 4A9IA 4Z6IA 5C8GA 5EU1A 3LQHA 4PY6A 5KTWA 2OSSA 4UIXA 4TT2A 5CQ8A 4TZ8A 5EPBA 3JVKA 5F25A 3TLPA 5TCMA 5F36A 4XY9A 4CUUA 4BW1A 3U5OA 2R0VA 3HMEA 3Q2EA 4O70A 4Z1SA 5FFWA 2WP2A 5I80A 3G0LA 5CQTA 3O37A 1JSPB 5DW2A 5HLSA 4YABA 4HBXA 4PTBA 4QSSA 4UYGA 5CY9A 5D3HA 5A5PA 5HRWA 5DYAA 4N4HA 4RVRA 4XY8A 2DVQA 2F6JA 5FG4A 5HCLA 5E9YA 5CZGA 5A83A 4O7CA 5H1UA 5G4SA 5FFYA 2E7NA 5K29A 4KV1A 5HFRA 3HMHA 5HRVA 4YAXA 2L84A 3SVHA 5D0CA 5EWCA 2YEKA 4A9EA 4ZQLA 4O74A 4YYNA 5A85A 5HENA 4QSQA 2L5EA 2FSAA 3DWYA 5EM3A 5IGLA 4CFLA 4A9OA 4HXSA 5EP7A 5FFVA 5E7DA 5ENEA 5AD2A 4TS8A 4CURA 2DATA 5IIDA 1JM4B 5HFQA 4IOQA 4NUEA 4MR5A 5A5RA 5L8TA 4O72A 3O33A 2YEMA 4UITA 4PCIA 4IR3A 3UVXA 5CP5A 2R0YA 5EK9A 2L85A 4Q0OA 5LVQA 4O71A 5D3TA 4NR8A 4NR4A 4QR5A 5FH6A 4QZSA 4O76A 5FBXA 4BW3A 4IR4A 4O7FA 5FE0A 3P1CA 3QZTA 1EQFA 4E96A 5EI4A 4QUTA 5L98A 4A9FA 4YADA 5FDZA 4YBTA 3U5PA 3QZSA 5HQ6A 5JWMA 4LC2A 4TT4A 5ENGA 4J3IA 5CQ4A 1N72A 5LKZA 5E0RA 5F60A 1E6IA 3S92A 3LQIA 5CGPA 4C66A 4PS5A 4O7EA 5D3SA 4QEUA 3ZYUA 4A9MA 5CQ6A 3U5KA 5E9IA 2DVSA 5CS8A 5EWDA 2WP1A 2NXBA 4N4GA 5H85A 4YK0A 3U5LA 4O77A 4IORA 5EV9A 5HM0A 4BW2A 4XUBA 5F1LA 2MJVB 4PCEA 4C67A 2YQDA 4A9HA 5LJ0A 3U5MA 4YH3A 3P1FA 5D7XA 4DONA 3ONIA 5CQ5A 5D3LA 4UYFB 5FG5A 4NRAA 5FE1A 5FE8A 3O34A 4MEQA 4A9JA 1F68A 4UIUA 3K2JA 2E3KA 4A9KA 3O36A 4TQNA 3UVWA 4NUCA 3MUKA 4IOOA 4IR5A 4NR5A 3JVLA 4MR3A 3GG3A 4OGIA 3JVMA 5JI8A 3FKMX 3JVJA 3LJWA 4ZW1A 3RCWA 2RNXA 2YYNA 4QC1A 4NYVA 4QR3A 5F2PA 3NXBA 4IR6A 5FE6A 4FLPA 2RI7A 1X0JA 5TB6A 4MEPA 4QUUA 4Z6HA 2RO1A 5DYCA 5FE7A 1WUGA 4NQMA 5HELA 2R0SA 5DYXA 5COIA 4UYEA 5EQ1A 5ETBA 3G0JA 2E7OA 4LRGA 5II2A 5ENHA 4YY6A 3P1EA 3O35A 4QSRA 4F3IA 5KU3A 2DKWA 4HBYA 4YBSA 5E9LA 4J0SA 5CUEA 5E9MA 5IGKA 5C7NA 5J0DA 4CUPA 4HXOA 3S91A 4NRCA 4NR7A 4WIVA 5FE3A 4HBWA 4PKLA 2RNWA 5C87A 5LUUA 5DFBA 5DLZA 3P1DA 4CFKA 5ACYA 2YELA 5CUDA 5C4QA 4NUDA 5F3AA 5EWHA 5EWWA 5F1HA 5DKCA 5I83A 4HXKA 5IGNA 5A7CA 4TT6A 4CL9A 5HEMA 4QEWA 5DYUA 4A9NA 2I8NA 5CTLA 5CUGA 5D24A 5EWVA 5LKTA 5CQAA 4HXMA 4WHWA 5ENBA 2OO1A 4QB3A 5CQ7A 4QR4A 5C89A 5LJ2A 5G4RA 4QSPA 5FE2A 4QSXA 5DW1A 2LSPB 5BT4A 3UV2A 4N4FA 4TYLA 3I3JA 5ENJA 3LXJA 4MEOA 4QSUA
chains in the Genus database with same CATH superfamily
2GRCA 4Y03A 3UV5A 4MR4A 4UIVA 4MR6A 4YC9A 5FE4A 1WUMA 5HJCA 5CRZA 5EA1A 2OUOA 5L8UA 5A5NA 4NS5A 4J0RA 3IU5A 5I89A 5FE9A 5E3DA 4QYLA 2RNYA 5FH7A 5AD3A 4O75A 5EVAA 5LKUA 5DFCA 4NYWA 5LVRA 2N9GA 4NXJA 5LJ1A 4YYIA 4OUFA 5EISA 4YATA 4TU4A 5I86A 3MULA 5KTUA 5D26A 3UVDA 4TZ2A 4YYGA 4TU6A 4J1PA 5EPSA 4WHUA 4X2IA 5LKXA 5IGMA 2DVVA 4KV4A 4HXNA 4LYSA 4NR6A 5KO4A 3SVFA 2R10A 3P5OA 5D25A 5BT5A 4CUQA 4N4IA 3UVYA 4QNSA 3MQMA 5AMFA 5D3PA 4LDFA 2RFJA 4UYFA 1ZS5A 3HMFA 3ERRA 4HBVA 5CPEA 5F5ZA 5FG6A 4UYHA 4UYDA 4XUAA 3Q2FA 5E3GA 4ZC9A 4QSTA 4LYIA 4Q0NA 4NR9A 5DLXA 4UIZA 5CQ3A 4LYWA 4O7AA 5FE5A 4MENA 5I88A 5KHMA 3U5JA 5D3JA 5CU8A 5D3RA 5HRXA 5IG6A 2KTBB 5HQ5A 4BW4A 3AADA 4O78A 5DBMA 4N3WA 4CLBA 4LZSA 4NRBA 4ALGA 5L99A 2YDWA 3UV4A 2YW5A 5E73A 2RS9B 5DKHA 4BHWA 5FH8A 5ENFA 4O7BA 4QBMA 5CUAA 4TTEA 3IU6A 3AQAA 4BJXA 3MB3A 5FB1A 5A5QA 5BT3A 4GPJA 5HQ7A 4LZ2A 4YYHA 2DVRA 4XYAA 4OGJA 4LR6A 5I29A 4ALHA 4QC3A 4AKIA 5II1A 4AKHA 5I40A 4YYMA 5F63A 2H60A 1ZKRA 4HXPA 2DWWA 5DX4A 3D1BA 4QSVA 5D3NA 3MXFA 4CUSA 4QY4A 5I7YA 5L97A 5FB0A 5E74A 3SVGA 5EGUA 5H1TA 5KTXA 4HXLA 2D82A 5ENCA 5ETDA 4UIYA 5A82A 3LQJA 4QYDA 4Z1QA 3D7CA 5A5OA 5CFWA 5E9VA 4YY4A 5I7XA 5I1QA 5C85A 4QEVA 2G4AA 3QZVA 5H1VA 5CUBA 3MB4A 5DFDA 5IBNA 4Z93A 4CUTA 4QSWA 4A9LA 4YYKA 5EICA 5L96A 4YYJA 4HXRA 5ENIA 4NYXA 3UW9A 4UIWA 5A81A 4YBMA 4YYDA 2I7KA 3DAIA 5DKDA 4AKNA 5F62A 4LZRA 4YH4A 4KCXA 5DY7A 5E9KA 5F61A 5CUCA 3U5NA 5CRMA 4NQNA 5A5SA 5EPRA 2D9EA 2F6NA 2EJNA 5AMEA 4A9IA 4Z6IA 5C8GA 5EU1A 3LQHA 4PY6A 5KTWA 2OSSA 4UIXA 4TT2A 5CQ8A 4TZ8A 5EPBA 3JVKA 5F25A 3TLPA 5TCMA 5F36A 4XY9A 4CUUA 4BW1A 3U5OA 2R0VA 3HMEA 3Q2EA 4O70A 4Z1SA 5FFWA 2WP2A 5I80A 3G0LA 5CQTA 3O37A 1JSPB 5DW2A 5HLSA 4YABA 4HBXA 4PTBA 4QSSA 4UYGA 5CY9A 5D3HA 5A5PA 5HRWA 5DYAA 4N4HA 4RVRA 4XY8A 2DVQA 2F6JA 5FG4A 5HCLA 5E9YA 5CZGA 5A83A 4O7CA 5H1UA 5G4SA 5FFYA 2E7NA 5K29A 4KV1A 5HFRA 3HMHA 5HRVA 4YAXA 2L84A 3SVHA 5D0CA 5EWCA 2YEKA 4A9EA 4ZQLA 4O74A 4YYNA 5A85A 5HENA 4QSQA 2L5EA 2FSAA 3DWYA 5EM3A 1PUOA 5IGLA 4CFLA 4A9OA 4HXSA 5EP7A 5FFVA 5E7DA 5ENEA 5AD2A 4TS8A 4CURA 2DATA 5IIDA 1JM4B 5HFQA 4IOQA 4NUEA 4MR5A 5A5RA 5L8TA 4O72A 3O33A 2YEMA 4UITA 4PCIA 4IR3A 3UVXA 5CP5A 2R0YA 5EK9A 2L85A 4Q0OA 5LVQA 4O71A 5D3TA 4NR8A 4NR4A 4QR5A 4AI6A 5FH6A 4QZSA 4O76A 5FBXA 4BW3A 4IR4A 4O7FA 5FE0A 3P1CA 3QZTA 1EQFA 4E96A 5EI4A 4QUTA 5L98A 4A9FA 4YADA 5FDZA 4YBTA 3U5PA 3QZSA 5HQ6A 5JWMA 4LC2A 4TT4A 5ENGA 4J3IA 5CQ4A 1N72A 5LKZA 5E0RA 5F60A 1E6IA 3S92A 3LQIA 5CGPA 4C66A 4PS5A 4O7EA 5D3SA 4QEUA 3ZYUA 4A9MA 5CQ6A 3U5KA 5E9IA 2DVSA 5CS8A 5EWDA 2WP1A 2NXBA 4N4GA 5H85A 4YK0A 3U5LA 4O77A 4IORA 5EV9A 5HM0A 4BW2A 4XUBA 5F1LA 4AKGA 2MJVB 4PCEA 4C67A 2YQDA 4A9HA 5LJ0A 3U5MA 4YH3A 3P1FA 5D7XA 4DONA 3ONIA 5CQ5A 5D3LA 4UYFB 5FG5A 4NRAA 3VKGA 5FE1A 5FE8A 3O34A 4MEQA 4A9JA 1F68A 4UIUA 3K2JA 2E3KA 4A9KA 3O36A 4TQNA 3UVWA 4NUCA 3MUKA 4IOOA 4IR5A 4NR5A 3JVLA 4MR3A 3GG3A 4OGIA 3JVMA 5JI8A 3FKMX 3JVJA 3LJWA 4ZW1A 3RCWA 2RNXA 2YYNA 4QC1A 4NYVA 4QR3A 5F2PA 3NXBA 4IR6A 5FE6A 4FLPA 2RI7A 1X0JA 5TB6A 4MEPA 4QUUA 4Z6HA 2RO1A 5DYCA 5FE7A 1WUGA 4NQMA 5HELA 2R0SA 3D1DA 5DYXA 5COIA 4UYEA 5EQ1A 5ETBA 3G0JA 2E7OA 4LRGA 5II2A 5ENHA 4YY6A 3P1EA 3O35A 4QSRA 4F3IA 5KU3A 2DKWA 4HBYA 4YBSA 5E9LA 4J0SA 5CUEA 5E9MA 5IGKA 5C7NA 5J0DA 4CUPA 4HXOA 3S91A 4NRCA 4NR7A 4WIVA 5FE3A 4HBWA 4PKLA 2RNWA 5C87A 5LUUA 5DFBA 5DLZA 3P1DA 4CFKA 5ACYA 2YELA 5CUDA 5C4QA 4NUDA 5F3AA 5EWHA 5EWWA 5F1HA 5DKCA 5I83A 4HXKA 5IGNA 5A7CA 4TT6A 4CL9A 5HEMA 4QEWA 5DYUA 4A9NA 2I8NA 5CTLA 5CUGA 5D24A 5EWVA 5LKTA 5CQAA 4HXMA 4WHWA 5ENBA 2OO1A 4QB3A 5CQ7A 4QR4A 5C89A 5LJ2A 3VKHA 5G4RA 4QSPA 5FE2A 4QSXA 5DW1A 2LSPB 5BT4A 3UV2A 4N4FA 4TYLA 3I3JA 5ENJA 3LXJA 4MEOA 4QSUA
chains in the Genus database with same CATH topology
2GRCA 4Y03A 3UV5A 4MR4A 4UIVA 4MR6A 4YC9A 5FE4A 1WUMA 5HJCA 5CRZA 5EA1A 2OUOA 5L8UA 5A5NA 4NS5A 4J0RA 3IU5A 5I89A 5FE9A 5E3DA 4QYLA 2RNYA 5FH7A 5AD3A 4O75A 5EVAA 5LKUA 5DFCA 4NYWA 5LVRA 2N9GA 4NXJA 5LJ1A 4YYIA 4OUFA 5EISA 4YATA 4TU4A 5I86A 3MULA 5KTUA 5D26A 3UVDA 4TZ2A 4YYGA 4TU6A 4J1PA 5EPSA 4WHUA 4X2IA 5LKXA 5IGMA 2DVVA 4KV4A 4HXNA 4LYSA 4NR6A 5KO4A 3SVFA 2R10A 3P5OA 5D25A 5BT5A 4CUQA 4N4IA 3UVYA 4QNSA 3MQMA 5AMFA 5D3PA 4LDFA 2RFJA 4UYFA 1ZS5A 3HMFA 4HBVA 5F5ZA 5CPEA 5FG6A 4UYHA 4UYDA 4XUAA 3Q2FA 5E3GA 4ZC9A 4QSTA 4LYIA 4Q0NA 4NR9A 5DLXA 4UIZA 5CQ3A 4LYWA 4O7AA 5FE5A 4MENA 5I88A 5KHMA 3U5JA 5D3JA 5CU8A 5D3RA 5HRXA 5IG6A 2KTBB 5HQ5A 4BW4A 3AADA 4O78A 5DBMA 4N3WA 4CLBA 4LZSA 4NRBA 4ALGA 5L99A 2YDWA 3UV4A 2YW5A 5E73A 2RS9B 5DKHA 4BHWA 5FH8A 5ENFA 4O7BA 4QBMA 5CUAA 4TTEA 3IU6A 3AQAA 4BJXA 3MB3A 5FB1A 5A5QA 5BT3A 4GPJA 5HQ7A 4LZ2A 4YYHA 2DVRA 4XYAA 4OGJA 4LR6A 5I29A 4ALHA 4QC3A 5II1A 5I40A 4YYMA 5F63A 2H60A 4HXPA 2DWWA 5DX4A 4QSVA 5D3NA 3MXFA 4CUSA 4QY4A 5I7YA 5L97A 5FB0A 5E74A 3SVGA 5EGUA 5H1TA 5KTXA 4HXLA 2D82A 5ENCA 5ETDA 4UIYA 5A82A 3LQJA 4QYDA 4Z1QA 3D7CA 5A5OA 5CFWA 5E9VA 4YY4A 5I7XA 5I1QA 5C85A 4QEVA 2G4AA 3QZVA 5H1VA 5CUBA 3MB4A 5DFDA 5IBNA 4Z93A 4CUTA 4QSWA 4A9LA 4YYKA 5EICA 5L96A 4YYJA 4HXRA 5ENIA 4NYXA 3UW9A 4UIWA 5A81A 4YBMA 4YYDA 2I7KA 3DAIA 5DKDA 4AKNA 5F62A 4LZRA 4YH4A 4KCXA 5DY7A 5E9KA 5F61A 5CUCA 3U5NA 5CRMA 4NQNA 5A5SA 5EPRA 2D9EA 2F6NA 5AMEA 4A9IA 4Z6IA 5C8GA 5EU1A 3LQHA 4PY6A 5KTWA 2OSSA 4UIXA 4TT2A 5CQ8A 4TZ8A 5EPBA 3JVKA 5F25A 3TLPA 5TCMA 5F36A 4XY9A 4CUUA 4BW1A 3U5OA 2R0VA 3HMEA 3Q2EA 4O70A 4Z1SA 5FFWA 2WP2A 5I80A 3G0LA 5CQTA 3O37A 1JSPB 5DW2A 5HLSA 4YABA 4HBXA 4PTBA 4QSSA 4UYGA 5CY9A 5D3HA 5A5PA 5HRWA 5DYAA 4N4HA 4RVRA 4XY8A 2DVQA 2F6JA 5FG4A 5HCLA 5E9YA 5CZGA 5A83A 4O7CA 5H1UA 5G4SA 5FFYA 2E7NA 5K29A 4KV1A 5HFRA 3HMHA 5HRVA 4YAXA 2L84A 3SVHA 5D0CA 5EWCA 2YEKA 4A9EA 4ZQLA 4O74A 4YYNA 5A85A 5HENA 4QSQA 2L5EA 2FSAA 3DWYA 5EM3A 5IGLA 4CFLA 4A9OA 4HXSA 5EP7A 5FFVA 5E7DA 5ENEA 5AD2A 4TS8A 4CURA 2DATA 5IIDA 1JM4B 5HFQA 4IOQA 4NUEA 4MR5A 5A5RA 5L8TA 4O72A 3O33A 2YEMA 4UITA 4PCIA 4IR3A 3UVXA 5CP5A 2R0YA 5EK9A 2L85A 4Q0OA 5LVQA 4O71A 5D3TA 4NR8A 4NR4A 4QR5A 5FH6A 4QZSA 4O76A 5FBXA 4BW3A 4IR4A 4O7FA 5FE0A 3P1CA 3QZTA 1EQFA 4E96A 5EI4A 4QUTA 5L98A 4A9FA 4YADA 5FDZA 4YBTA 3U5PA 3QZSA 5HQ6A 5JWMA 4LC2A 4TT4A 5ENGA 4J3IA 5CQ4A 1N72A 5LKZA 5E0RA 5F60A 1E6IA 3S92A 3LQIA 5CGPA 4C66A 4PS5A 4O7EA 5D3SA 4QEUA 3ZYUA 4A9MA 5CQ6A 3U5KA 5E9IA 2DVSA 5CS8A 5EWDA 2WP1A 2NXBA 4N4GA 5H85A 4YK0A 3U5LA 4O77A 4IORA 5EV9A 5HM0A 4BW2A 4XUBA 5F1LA 2MJVB 4PCEA 4C67A 2YQDA 4A9HA 5LJ0A 3U5MA 4YH3A 3P1FA 5D7XA 4DONA 3ONIA 5CQ5A 5D3LA 4UYFB 5FG5A 4NRAA 5FE1A 5FE8A 3O34A 4MEQA 4A9JA 1F68A 4UIUA 3K2JA 2E3KA 4A9KA 3O36A 4TQNA 3UVWA 4NUCA 3MUKA 4IOOA 4IR5A 4NR5A 3JVLA 4MR3A 3GG3A 4OGIA 3JVMA 5JI8A 3FKMX 3JVJA 3LJWA 4ZW1A 3RCWA 2RNXA 2YYNA 4QC1A 4NYVA 4QR3A 5F2PA 3NXBA 4IR6A 5FE6A 4FLPA 2RI7A 1X0JA 5TB6A 4MEPA 4QUUA 4Z6HA 2RO1A 5DYCA 5FE7A 1WUGA 4NQMA 5HELA 2R0SA 5DYXA 5COIA 4UYEA 5EQ1A 5ETBA 3G0JA 2E7OA 4LRGA 5II2A 5ENHA 4YY6A 3P1EA 3O35A 4QSRA 4F3IA 5KU3A 2DKWA 4HBYA 4YBSA 5E9LA 4J0SA 5CUEA 5E9MA 5IGKA 5C7NA 5J0DA 4CUPA 4HXOA 3S91A 4NRCA 4NR7A 4WIVA 5FE3A 4HBWA 4PKLA 2RNWA 5C87A 5LUUA 5DFBA 5DLZA 3P1DA 4CFKA 5ACYA 2YELA 5CUDA 5C4QA 4NUDA 5F3AA 5EWHA 5EWWA 5F1HA 5DKCA 5I83A 4HXKA 5IGNA 5A7CA 4TT6A 4CL9A 5HEMA 4QEWA 5DYUA 4A9NA 2I8NA 5CTLA 5CUGA 5D24A 5EWVA 5LKTA 5CQAA 4HXMA 4WHWA 5ENBA 2OO1A 4QB3A 5CQ7A 4QR4A 5C89A 5LJ2A 5G4RA 4QSPA 5FE2A 4QSXA 5DW1A 2LSPB 5BT4A 3UV2A 4N4FA 4TYLA 3I3JA 5ENJA 3LXJA 4MEOA 4QSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRC A;  4Y03 A;  3UV5 A;  4MR4 A;  4UIV A;  4MR6 A;  4YC9 A;  5FE4 A;  1WUM A;  5HJC A;  5CRZ A;  5EA1 A;  2OUO A;  5L8U A;  5A5N A;  4NS5 A;  4J0R A;  3IU5 A;  5I89 A;  5FE9 A;  5E3D A;  4QYL A;  2RNY A;  5FH7 A;  5AD3 A;  4O75 A;  5EVA A;  5LKU A;  5DFC A;  4NYW A;  5LVR A;  2N9G A;  4NXJ A;  5LJ1 A;  4YYI A;  4OUF A;  5EIS A;  4YAT A;  4TU4 A;  5I86 A;  3MUL A;  5KTU A;  5D26 A;  3UVD A;  4TZ2 A;  4YYG A;  4TU6 A;  4J1P A;  5EPS A;  4WHU A;  4X2I A;  5LKX A;  5IGM A;  2DVV A;  4KV4 A;  4HXN A;  4LYS A;  4NR6 A;  5KO4 A;  3SVF A;  2R10 A;  3P5O A;  5D25 A;  5BT5 A;  4CUQ A;  4N4I A;  3UVY A;  4QNS A;  3MQM A;  5AMF A;  5D3P A;  4LDF A;  2RFJ A;  4UYF A;  1ZS5 A;  3HMF A;  4HBV A;  5F5Z A;  5CPE A;  5FG6 A;  4UYH A;  4UYD A;  4XUA A;  3Q2F A;  5E3G A;  4ZC9 A;  4QST A;  4LYI A;  4Q0N A;  4NR9 A;  5DLX A;  4UIZ A;  5CQ3 A;  4LYW A;  4O7A A;  5FE5 A;  4MEN A;  5I88 A;  5KHM A;  3U5J A;  5D3J A;  5CU8 A;  5D3R A;  5HRX A;  5IG6 A;  2KTB B;  5HQ5 A;  4BW4 A;  3AAD A;  4O78 A;  5DBM A;  4N3W A;  4CLB A;  4LZS A;  4NRB A;  4ALG A;  5L99 A;  2YDW A;  3UV4 A;  2YW5 A;  5E73 A;  2RS9 B;  5DKH A;  4BHW A;  5FH8 A;  5ENF A;  4O7B A;  4QBM A;  5CUA A;  4TTE A;  3IU6 A;  3AQA A;  4BJX A;  3MB3 A;  5FB1 A;  5A5Q A;  5BT3 A;  4GPJ A;  5HQ7 A;  4LZ2 A;  4YYH A;  2DVR A;  4XYA A;  4OGJ A;  4LR6 A;  5I29 A;  4ALH A;  4QC3 A;  5II1 A;  5I40 A;  4YYM A;  5F63 A;  2H60 A;  4HXP A;  2DWW A;  5DX4 A;  4QSV A;  5D3N A;  3MXF A;  4CUS A;  4QY4 A;  5I7Y A;  5L97 A;  5FB0 A;  5E74 A;  3SVG A;  5EGU A;  5H1T A;  5KTX A;  4HXL A;  2D82 A;  5ENC A;  5ETD A;  4UIY A;  5A82 A;  3LQJ A;  4QYD A;  4Z1Q A;  3D7C A;  5A5O A;  5CFW A;  5E9V A;  4YY4 A;  5I7X A;  5I1Q A;  5C85 A;  4QEV A;  2G4A A;  3QZV A;  5H1V A;  5CUB A;  3MB4 A;  5DFD A;  5IBN A;  4Z93 A;  4CUT A;  4QSW A;  4A9L A;  4YYK A;  5EIC A;  5L96 A;  4YYJ A;  4HXR A;  5ENI A;  4NYX A;  3UW9 A;  4UIW A;  5A81 A;  4YBM A;  4YYD A;  2I7K A;  3DAI A;  5DKD A;  4AKN A;  5F62 A;  4LZR A;  4YH4 A;  4KCX A;  5DY7 A;  5E9K A;  5F61 A;  5CUC A;  3U5N A;  5CRM A;  4NQN A;  5A5S A;  5EPR A;  2D9E A;  2F6N A;  5AME A;  4A9I A;  4Z6I A;  5C8G A;  5EU1 A;  3LQH A;  4PY6 A;  5KTW A;  2OSS A;  4UIX A;  4TT2 A;  5CQ8 A;  4TZ8 A;  5EPB A;  3JVK A;  5F25 A;  3TLP A;  5TCM A;  5F36 A;  4XY9 A;  4CUU A;  4BW1 A;  3U5O A;  2R0V A;  3HME A;  3Q2E A;  4O70 A;  4Z1S A;  5FFW A;  2WP2 A;  5I80 A;  3G0L A;  5CQT A;  3O37 A;  1JSP B;  5DW2 A;  5HLS A;  4YAB A;  4HBX A;  4PTB A;  4QSS A;  4UYG A;  5CY9 A;  5D3H A;  5A5P A;  5HRW A;  5DYA A;  4N4H A;  4RVR A;  4XY8 A;  2DVQ A;  2F6J A;  5FG4 A;  5HCL A;  5E9Y A;  5CZG A;  5A83 A;  4O7C A;  5H1U A;  5G4S A;  5FFY A;  2E7N A;  5K29 A;  4KV1 A;  5HFR A;  3HMH A;  5HRV A;  4YAX A;  2L84 A;  3SVH A;  5D0C A;  5EWC A;  2YEK A;  4A9E A;  4ZQL A;  4O74 A;  4YYN A;  5A85 A;  5HEN A;  4QSQ A;  2L5E A;  2FSA A;  3DWY A;  5EM3 A;  5IGL A;  4CFL A;  4A9O A;  4HXS A;  5EP7 A;  5FFV A;  5E7D A;  5ENE A;  5AD2 A;  4TS8 A;  4CUR A;  2DAT A;  5IID A;  1JM4 B;  5HFQ A;  4IOQ A;  4NUE A;  4MR5 A;  5A5R A;  5L8T A;  4O72 A;  3O33 A;  2YEM A;  4UIT A;  4PCI A;  4IR3 A;  3UVX A;  5CP5 A;  2R0Y A;  5EK9 A;  2L85 A;  4Q0O A;  5LVQ A;  4O71 A;  5D3T A;  4NR8 A;  4NR4 A;  4QR5 A;  5FH6 A;  4QZS A;  4O76 A;  5FBX A;  4BW3 A;  4IR4 A;  4O7F A;  5FE0 A;  3P1C A;  3QZT A;  1EQF A;  4E96 A;  5EI4 A;  4QUT A;  5L98 A;  4A9F A;  4YAD A;  5FDZ A;  4YBT A;  3U5P A;  3QZS A;  5HQ6 A;  5JWM A;  4LC2 A;  4TT4 A;  5ENG A;  4J3I A;  5CQ4 A;  1N72 A;  5LKZ A;  5E0R A;  5F60 A;  1E6I A;  3S92 A;  3LQI A;  5CGP A;  4C66 A;  4PS5 A;  4O7E A;  5D3S A;  4QEU A;  3ZYU A;  4A9M A;  5CQ6 A;  3U5K A;  5E9I A;  2DVS A;  5CS8 A;  5EWD A;  2WP1 A;  2NXB A;  4N4G A;  5H85 A;  4YK0 A;  3U5L A;  4O77 A;  4IOR A;  5EV9 A;  5HM0 A;  4BW2 A;  4XUB A;  5F1L A;  2MJV B;  4PCE A;  4C67 A;  2YQD A;  4A9H A;  5LJ0 A;  3U5M A;  4YH3 A;  3P1F A;  5D7X A;  4DON A;  3ONI A;  5CQ5 A;  5D3L A;  4UYF B;  5FG5 A;  4NRA A;  5FE1 A;  5FE8 A;  3O34 A;  4MEQ A;  4A9J A;  1F68 A;  4UIU A;  3K2J A;  2E3K A;  4A9K A;  3O36 A;  4TQN A;  3UVW A;  4NUC A;  3MUK A;  4IOO A;  4IR5 A;  4NR5 A;  3JVL A;  4MR3 A;  3GG3 A;  4OGI A;  3JVM A;  5JI8 A;  3FKM X;  3JVJ A;  3LJW A;  4ZW1 A;  3RCW A;  2RNX A;  2YYN A;  4QC1 A;  4NYV A;  4QR3 A;  5F2P A;  3NXB A;  4IR6 A;  5FE6 A;  4FLP A;  2RI7 A;  1X0J A;  5TB6 A;  4MEP A;  4QUU A;  4Z6H A;  2RO1 A;  5DYC A;  5FE7 A;  1WUG A;  4NQM A;  5HEL A;  2R0S A;  5DYX A;  5COI A;  4UYE A;  5EQ1 A;  5ETB A;  3G0J A;  2E7O A;  4LRG A;  5II2 A;  5ENH A;  4YY6 A;  3P1E A;  3O35 A;  4QSR A;  4F3I A;  5KU3 A;  2DKW A;  4HBY A;  4YBS A;  5E9L A;  4J0S A;  5CUE A;  5E9M A;  5IGK A;  5C7N A;  5J0D A;  4CUP A;  4HXO A;  3S91 A;  4NRC A;  4NR7 A;  4WIV A;  5FE3 A;  4HBW A;  4PKL A;  2RNW A;  5C87 A;  5LUU A;  5DFB A;  5DLZ A;  3P1D A;  4CFK A;  5ACY A;  2YEL A;  5CUD A;  5C4Q A;  4NUD A;  5F3A A;  5EWH A;  5EWW A;  5F1H A;  5DKC A;  5I83 A;  4HXK A;  5IGN A;  5A7C A;  4TT6 A;  4CL9 A;  5HEM A;  4QEW A;  5DYU A;  4A9N A;  2I8N A;  5CTL A;  5CUG A;  5D24 A;  5EWV A;  5LKT A;  5CQA A;  4HXM A;  4WHW A;  5ENB A;  2OO1 A;  4QB3 A;  5CQ7 A;  4QR4 A;  5C89 A;  5LJ2 A;  5G4R A;  4QSP A;  5FE2 A;  4QSX A;  5DW1 A;  2LSP B;  5BT4 A;  3UV2 A;  4N4F A;  4TYL A;  3I3J A;  5ENJ A;  3LXJ A;  4MEO A;  4QSU A; 
#chains in the Genus database with same CATH topology
 2GRC A;  4Y03 A;  3UV5 A;  4MR4 A;  4UIV A;  4MR6 A;  4YC9 A;  5FE4 A;  1WUM A;  5HJC A;  5CRZ A;  5EA1 A;  2OUO A;  5L8U A;  5A5N A;  4NS5 A;  4J0R A;  3IU5 A;  5I89 A;  5FE9 A;  5E3D A;  4QYL A;  2RNY A;  5FH7 A;  5AD3 A;  4O75 A;  5EVA A;  5LKU A;  5DFC A;  4NYW A;  5LVR A;  2N9G A;  4NXJ A;  5LJ1 A;  4YYI A;  4OUF A;  5EIS A;  4YAT A;  4TU4 A;  5I86 A;  3MUL A;  5KTU A;  5D26 A;  3UVD A;  4TZ2 A;  4YYG A;  4TU6 A;  4J1P A;  5EPS A;  4WHU A;  4X2I A;  5LKX A;  5IGM A;  2DVV A;  4KV4 A;  4HXN A;  4LYS A;  4NR6 A;  5KO4 A;  3SVF A;  2R10 A;  3P5O A;  5D25 A;  5BT5 A;  4CUQ A;  4N4I A;  3UVY A;  4QNS A;  3MQM A;  5AMF A;  5D3P A;  4LDF A;  2RFJ A;  4UYF A;  1ZS5 A;  3HMF A;  3ERR A;  4HBV A;  5CPE A;  5F5Z A;  5FG6 A;  4UYH A;  4UYD A;  4XUA A;  3Q2F A;  5E3G A;  4ZC9 A;  4QST A;  4LYI A;  4Q0N A;  4NR9 A;  5DLX A;  4UIZ A;  5CQ3 A;  4LYW A;  4O7A A;  5FE5 A;  4MEN A;  5I88 A;  5KHM A;  3U5J A;  5D3J A;  5CU8 A;  5D3R A;  5HRX A;  5IG6 A;  2KTB B;  5HQ5 A;  4BW4 A;  3AAD A;  4O78 A;  5DBM A;  4N3W A;  4CLB A;  4LZS A;  4NRB A;  4ALG A;  5L99 A;  2YDW A;  3UV4 A;  2YW5 A;  5E73 A;  2RS9 B;  5DKH A;  4BHW A;  5FH8 A;  5ENF A;  4O7B A;  4QBM A;  5CUA A;  4TTE A;  3IU6 A;  3AQA A;  4BJX A;  3MB3 A;  5FB1 A;  5A5Q A;  5BT3 A;  4GPJ A;  5HQ7 A;  4LZ2 A;  4YYH A;  2DVR A;  4XYA A;  4OGJ A;  4LR6 A;  5I29 A;  4ALH A;  4QC3 A;  4AKI A;  5II1 A;  4AKH A;  5I40 A;  4YYM A;  5F63 A;  2H60 A;  1ZKR A;  4HXP A;  2DWW A;  5DX4 A;  3D1B A;  4QSV A;  5D3N A;  3MXF A;  4CUS A;  4QY4 A;  5I7Y A;  5L97 A;  5FB0 A;  5E74 A;  3SVG A;  5EGU A;  5H1T A;  5KTX A;  4HXL A;  2D82 A;  5ENC A;  5ETD A;  4UIY A;  5A82 A;  3LQJ A;  4QYD A;  4Z1Q A;  3D7C A;  5A5O A;  5CFW A;  5E9V A;  4YY4 A;  5I7X A;  5I1Q A;  5C85 A;  4QEV A;  2G4A A;  3QZV A;  5H1V A;  5CUB A;  3MB4 A;  5DFD A;  5IBN A;  4Z93 A;  4CUT A;  4QSW A;  4A9L A;  4YYK A;  5EIC A;  5L96 A;  4YYJ A;  4HXR A;  5ENI A;  4NYX A;  3UW9 A;  4UIW A;  5A81 A;  4YBM A;  4YYD A;  2I7K A;  3DAI A;  5DKD A;  4AKN A;  5F62 A;  4LZR A;  4YH4 A;  4KCX A;  5DY7 A;  5E9K A;  5F61 A;  5CUC A;  3U5N A;  5CRM A;  4NQN A;  5A5S A;  5EPR A;  2D9E A;  2F6N A;  2EJN A;  5AME A;  4A9I A;  4Z6I A;  5C8G A;  5EU1 A;  3LQH A;  4PY6 A;  5KTW A;  2OSS A;  4UIX A;  4TT2 A;  5CQ8 A;  4TZ8 A;  5EPB A;  3JVK A;  5F25 A;  3TLP A;  5TCM A;  5F36 A;  4XY9 A;  4CUU A;  4BW1 A;  3U5O A;  2R0V A;  3HME A;  3Q2E A;  4O70 A;  4Z1S A;  5FFW A;  2WP2 A;  5I80 A;  3G0L A;  5CQT A;  3O37 A;  1JSP B;  5DW2 A;  5HLS A;  4YAB A;  4HBX A;  4PTB A;  4QSS A;  4UYG A;  5CY9 A;  5D3H A;  5A5P A;  5HRW A;  5DYA A;  4N4H A;  4RVR A;  4XY8 A;  2DVQ A;  2F6J A;  5FG4 A;  5HCL A;  5E9Y A;  5CZG A;  5A83 A;  4O7C A;  5H1U A;  5G4S A;  5FFY A;  2E7N A;  5K29 A;  4KV1 A;  5HFR A;  3HMH A;  5HRV A;  4YAX A;  2L84 A;  3SVH A;  5D0C A;  5EWC A;  2YEK A;  4A9E A;  4ZQL A;  4O74 A;  4YYN A;  5A85 A;  5HEN A;  4QSQ A;  2L5E A;  2FSA A;  3DWY A;  5EM3 A;  1PUO A;  5IGL A;  4CFL A;  4A9O A;  4HXS A;  5EP7 A;  5FFV A;  5E7D A;  5ENE A;  5AD2 A;  4TS8 A;  4CUR A;  2DAT A;  5IID A;  1JM4 B;  5HFQ A;  4IOQ A;  4NUE A;  4MR5 A;  5A5R A;  5L8T A;  4O72 A;  3O33 A;  2YEM A;  4UIT A;  4PCI A;  4IR3 A;  3UVX A;  5CP5 A;  2R0Y A;  5EK9 A;  2L85 A;  4Q0O A;  5LVQ A;  4O71 A;  5D3T A;  4NR8 A;  4NR4 A;  4QR5 A;  4AI6 A;  5FH6 A;  4QZS A;  4O76 A;  5FBX A;  4BW3 A;  4IR4 A;  4O7F A;  5FE0 A;  3P1C A;  3QZT A;  1EQF A;  4E96 A;  5EI4 A;  4QUT A;  5L98 A;  4A9F A;  4YAD A;  5FDZ A;  4YBT A;  3U5P A;  3QZS A;  5HQ6 A;  5JWM A;  4LC2 A;  4TT4 A;  5ENG A;  4J3I A;  5CQ4 A;  1N72 A;  5LKZ A;  5E0R A;  5F60 A;  1E6I A;  3S92 A;  3LQI A;  5CGP A;  4C66 A;  4PS5 A;  4O7E A;  5D3S A;  4QEU A;  3ZYU A;  4A9M A;  5CQ6 A;  3U5K A;  5E9I A;  2DVS A;  5CS8 A;  5EWD A;  2WP1 A;  2NXB A;  4N4G A;  5H85 A;  4YK0 A;  3U5L A;  4O77 A;  4IOR A;  5EV9 A;  5HM0 A;  4BW2 A;  4XUB A;  5F1L A;  4AKG A;  2MJV B;  4PCE A;  4C67 A;  2YQD A;  4A9H A;  5LJ0 A;  3U5M A;  4YH3 A;  3P1F A;  5D7X A;  4DON A;  3ONI A;  5CQ5 A;  5D3L A;  4UYF B;  5FG5 A;  4NRA A;  3VKG A;  5FE1 A;  5FE8 A;  3O34 A;  4MEQ A;  4A9J A;  1F68 A;  4UIU A;  3K2J A;  2E3K A;  4A9K A;  3O36 A;  4TQN A;  3UVW A;  4NUC A;  3MUK A;  4IOO A;  4IR5 A;  4NR5 A;  3JVL A;  4MR3 A;  3GG3 A;  4OGI A;  3JVM A;  5JI8 A;  3FKM X;  3JVJ A;  3LJW A;  4ZW1 A;  3RCW A;  2RNX A;  2YYN A;  4QC1 A;  4NYV A;  4QR3 A;  5F2P A;  3NXB A;  4IR6 A;  5FE6 A;  4FLP A;  2RI7 A;  1X0J A;  5TB6 A;  4MEP A;  4QUU A;  4Z6H A;  2RO1 A;  5DYC A;  5FE7 A;  1WUG A;  4NQM A;  5HEL A;  2R0S A;  3D1D A;  5DYX A;  5COI A;  4UYE A;  5EQ1 A;  5ETB A;  3G0J A;  2E7O A;  4LRG A;  5II2 A;  5ENH A;  4YY6 A;  3P1E A;  3O35 A;  4QSR A;  4F3I A;  5KU3 A;  2DKW A;  4HBY A;  4YBS A;  5E9L A;  4J0S A;  5CUE A;  5E9M A;  5IGK A;  5C7N A;  5J0D A;  4CUP A;  4HXO A;  3S91 A;  4NRC A;  4NR7 A;  4WIV A;  5FE3 A;  4HBW A;  4PKL A;  2RNW A;  5C87 A;  5LUU A;  5DFB A;  5DLZ A;  3P1D A;  4CFK A;  5ACY A;  2YEL A;  5CUD A;  5C4Q A;  4NUD A;  5F3A A;  5EWH A;  5EWW A;  5F1H A;  5DKC A;  5I83 A;  4HXK A;  5IGN A;  5A7C A;  4TT6 A;  4CL9 A;  5HEM A;  4QEW A;  5DYU A;  4A9N A;  2I8N A;  5CTL A;  5CUG A;  5D24 A;  5EWV A;  5LKT A;  5CQA A;  4HXM A;  4WHW A;  5ENB A;  2OO1 A;  4QB3 A;  5CQ7 A;  4QR4 A;  5C89 A;  5LJ2 A;  3VKH A;  5G4R A;  4QSP A;  5FE2 A;  4QSX A;  5DW1 A;  2LSP B;  5BT4 A;  3UV2 A;  4N4F A;  4TYL A;  3I3J A;  5ENJ A;  3LXJ A;  4MEO A;  4QSU A; 
#chains in the Genus database with same CATH homology
 2GRC A;  4Y03 A;  3UV5 A;  4MR4 A;  4UIV A;  4MR6 A;  4YC9 A;  5FE4 A;  1WUM A;  5HJC A;  5CRZ A;  5EA1 A;  2OUO A;  5L8U A;  5A5N A;  4NS5 A;  4J0R A;  3IU5 A;  5I89 A;  5FE9 A;  5E3D A;  4QYL A;  2RNY A;  5FH7 A;  5AD3 A;  4O75 A;  5EVA A;  5LKU A;  5DFC A;  4NYW A;  5LVR A;  2N9G A;  4NXJ A;  5LJ1 A;  4YYI A;  4OUF A;  5EIS A;  4YAT A;  4TU4 A;  5I86 A;  3MUL A;  5KTU A;  5D26 A;  3UVD A;  4TZ2 A;  4YYG A;  4TU6 A;  4J1P A;  5EPS A;  4WHU A;  4X2I A;  5LKX A;  5IGM A;  2DVV A;  4KV4 A;  4HXN A;  4LYS A;  4NR6 A;  5KO4 A;  3SVF A;  2R10 A;  3P5O A;  5D25 A;  5BT5 A;  4CUQ A;  4N4I A;  3UVY A;  4QNS A;  3MQM A;  5AMF A;  5D3P A;  4LDF A;  2RFJ A;  4UYF A;  1ZS5 A;  3HMF A;  4HBV A;  5F5Z A;  5CPE A;  5FG6 A;  4UYH A;  4UYD A;  4XUA A;  3Q2F A;  5E3G A;  4ZC9 A;  4QST A;  4LYI A;  4Q0N A;  4NR9 A;  5DLX A;  4UIZ A;  5CQ3 A;  4LYW A;  4O7A A;  5FE5 A;  4MEN A;  5I88 A;  5KHM A;  3U5J A;  5D3J A;  5CU8 A;  5D3R A;  5HRX A;  5IG6 A;  2KTB B;  5HQ5 A;  4BW4 A;  3AAD A;  4O78 A;  5DBM A;  4N3W A;  4CLB A;  4LZS A;  4NRB A;  4ALG A;  5L99 A;  2YDW A;  3UV4 A;  2YW5 A;  5E73 A;  2RS9 B;  5DKH A;  4BHW A;  5FH8 A;  5ENF A;  4O7B A;  4QBM A;  5CUA A;  4TTE A;  3IU6 A;  3AQA A;  4BJX A;  3MB3 A;  5FB1 A;  5A5Q A;  5BT3 A;  4GPJ A;  5HQ7 A;  4LZ2 A;  4YYH A;  2DVR A;  4XYA A;  4OGJ A;  4LR6 A;  5I29 A;  4ALH A;  4QC3 A;  5II1 A;  5I40 A;  4YYM A;  5F63 A;  2H60 A;  4HXP A;  2DWW A;  5DX4 A;  4QSV A;  5D3N A;  3MXF A;  4CUS A;  4QY4 A;  5I7Y A;  5L97 A;  5FB0 A;  5E74 A;  3SVG A;  5EGU A;  5H1T A;  5KTX A;  4HXL A;  2D82 A;  5ENC A;  5ETD A;  4UIY A;  5A82 A;  3LQJ A;  4QYD A;  4Z1Q A;  3D7C A;  5A5O A;  5CFW A;  5E9V A;  4YY4 A;  5I7X A;  5I1Q A;  5C85 A;  4QEV A;  2G4A A;  3QZV A;  5H1V A;  5CUB A;  3MB4 A;  5DFD A;  5IBN A;  4Z93 A;  4CUT A;  4QSW A;  4A9L A;  4YYK A;  5EIC A;  5L96 A;  4YYJ A;  4HXR A;  5ENI A;  4NYX A;  3UW9 A;  4UIW A;  5A81 A;  4YBM A;  4YYD A;  2I7K A;  3DAI A;  5DKD A;  4AKN A;  5F62 A;  4LZR A;  4YH4 A;  4KCX A;  5DY7 A;  5E9K A;  5F61 A;  5CUC A;  3U5N A;  5CRM A;  4NQN A;  5A5S A;  5EPR A;  2D9E A;  2F6N A;  5AME A;  4A9I A;  4Z6I A;  5C8G A;  5EU1 A;  3LQH A;  4PY6 A;  5KTW A;  2OSS A;  4UIX A;  4TT2 A;  5CQ8 A;  4TZ8 A;  5EPB A;  3JVK A;  5F25 A;  3TLP A;  5TCM A;  5F36 A;  4XY9 A;  4CUU A;  4BW1 A;  3U5O A;  2R0V A;  3HME A;  3Q2E A;  4O70 A;  4Z1S A;  5FFW A;  2WP2 A;  5I80 A;  3G0L A;  5CQT A;  3O37 A;  1JSP B;  5DW2 A;  5HLS A;  4YAB A;  4HBX A;  4PTB A;  4QSS A;  4UYG A;  5CY9 A;  5D3H A;  5A5P A;  5HRW A;  5DYA A;  4N4H A;  4RVR A;  4XY8 A;  2DVQ A;  2F6J A;  5FG4 A;  5HCL A;  5E9Y A;  5CZG A;  5A83 A;  4O7C A;  5H1U A;  5G4S A;  5FFY A;  2E7N A;  5K29 A;  4KV1 A;  5HFR A;  3HMH A;  5HRV A;  4YAX A;  2L84 A;  3SVH A;  5D0C A;  5EWC A;  2YEK A;  4A9E A;  4ZQL A;  4O74 A;  4YYN A;  5A85 A;  5HEN A;  4QSQ A;  2L5E A;  2FSA A;  3DWY A;  5EM3 A;  5IGL A;  4CFL A;  4A9O A;  4HXS A;  5EP7 A;  5FFV A;  5E7D A;  5ENE A;  5AD2 A;  4TS8 A;  4CUR A;  2DAT A;  5IID A;  1JM4 B;  5HFQ A;  4IOQ A;  4NUE A;  4MR5 A;  5A5R A;  5L8T A;  4O72 A;  3O33 A;  2YEM A;  4UIT A;  4PCI A;  4IR3 A;  3UVX A;  5CP5 A;  2R0Y A;  5EK9 A;  2L85 A;  4Q0O A;  5LVQ A;  4O71 A;  5D3T A;  4NR8 A;  4NR4 A;  4QR5 A;  5FH6 A;  4QZS A;  4O76 A;  5FBX A;  4BW3 A;  4IR4 A;  4O7F A;  5FE0 A;  3P1C A;  3QZT A;  1EQF A;  4E96 A;  5EI4 A;  4QUT A;  5L98 A;  4A9F A;  4YAD A;  5FDZ A;  4YBT A;  3U5P A;  3QZS A;  5HQ6 A;  5JWM A;  4LC2 A;  4TT4 A;  5ENG A;  4J3I A;  5CQ4 A;  1N72 A;  5LKZ A;  5E0R A;  5F60 A;  1E6I A;  3S92 A;  3LQI A;  5CGP A;  4C66 A;  4PS5 A;  4O7E A;  5D3S A;  4QEU A;  3ZYU A;  4A9M A;  5CQ6 A;  3U5K A;  5E9I A;  2DVS A;  5CS8 A;  5EWD A;  2WP1 A;  2NXB A;  4N4G A;  5H85 A;  4YK0 A;  3U5L A;  4O77 A;  4IOR A;  5EV9 A;  5HM0 A;  4BW2 A;  4XUB A;  5F1L A;  2MJV B;  4PCE A;  4C67 A;  2YQD A;  4A9H A;  5LJ0 A;  3U5M A;  4YH3 A;  3P1F A;  5D7X A;  4DON A;  3ONI A;  5CQ5 A;  5D3L A;  4UYF B;  5FG5 A;  4NRA A;  5FE1 A;  5FE8 A;  3O34 A;  4MEQ A;  4A9J A;  1F68 A;  4UIU A;  3K2J A;  2E3K A;  4A9K A;  3O36 A;  4TQN A;  3UVW A;  4NUC A;  3MUK A;  4IOO A;  4IR5 A;  4NR5 A;  3JVL A;  4MR3 A;  3GG3 A;  4OGI A;  3JVM A;  5JI8 A;  3FKM X;  3JVJ A;  3LJW A;  4ZW1 A;  3RCW A;  2RNX A;  2YYN A;  4QC1 A;  4NYV A;  4QR3 A;  5F2P A;  3NXB A;  4IR6 A;  5FE6 A;  4FLP A;  2RI7 A;  1X0J A;  5TB6 A;  4MEP A;  4QUU A;  4Z6H A;  2RO1 A;  5DYC A;  5FE7 A;  1WUG A;  4NQM A;  5HEL A;  2R0S A;  5DYX A;  5COI A;  4UYE A;  5EQ1 A;  5ETB A;  3G0J A;  2E7O A;  4LRG A;  5II2 A;  5ENH A;  4YY6 A;  3P1E A;  3O35 A;  4QSR A;  4F3I A;  5KU3 A;  2DKW A;  4HBY A;  4YBS A;  5E9L A;  4J0S A;  5CUE A;  5E9M A;  5IGK A;  5C7N A;  5J0D A;  4CUP A;  4HXO A;  3S91 A;  4NRC A;  4NR7 A;  4WIV A;  5FE3 A;  4HBW A;  4PKL A;  2RNW A;  5C87 A;  5LUU A;  5DFB A;  5DLZ A;  3P1D A;  4CFK A;  5ACY A;  2YEL A;  5CUD A;  5C4Q A;  4NUD A;  5F3A A;  5EWH A;  5EWW A;  5F1H A;  5DKC A;  5I83 A;  4HXK A;  5IGN A;  5A7C A;  4TT6 A;  4CL9 A;  5HEM A;  4QEW A;  5DYU A;  4A9N A;  2I8N A;  5CTL A;  5CUG A;  5D24 A;  5EWV A;  5LKT A;  5CQA A;  4HXM A;  4WHW A;  5ENB A;  2OO1 A;  4QB3 A;  5CQ7 A;  4QR4 A;  5C89 A;  5LJ2 A;  5G4R A;  4QSP A;  5FE2 A;  4QSX A;  5DW1 A;  2LSP B;  5BT4 A;  3UV2 A;  4N4F A;  4TYL A;  3I3J A;  5ENJ A;  3LXJ A;  4MEO A;  4QSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...