2R0VA

Structure of the rsc4 tandem bromodomain acetylated at k25
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
293
structure length
292
Chain Sequence
PKYLPGHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin structure-remodeling complex protein RSC4
publication title Autoregulation of the rsc4 tandem bromodomain by gcn5 acetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 103
structure length 292
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0vA01
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0vA02
4NXJA 4YYGA 5G4SA 5D7XA 3AADA 5HJCA 4MR3A 4Y03A 4YK0A 5LUUA 4DONA 5I83A 5D3HA 5HM0A 4TTEA 5F5ZA 5I88A 3RCWA 2R0SA 5EWHA 4N4IA 5EWVA 4GPJA 5FH8A 4IR4A 4LYIA 4N4FA 5I29A 2I8NA 4YY6A 4QSTA 4Z6IA 4XY9A 5I86A 1ZS5A 5ACYA 5FE0A 3I3JA 4YYJA 4TQNA 5H1TA 5AD2A 3U5JA 2E7NA 5CUGA 5DFCA 5HELA 4CL9A 5CQ8A 5DYAA 4YY4A 4NR7A 5HCLA 4NYXA 4C66A 5A7CA 5CZGA 5LKTA 4QSUA 1X0JA 5DFDA 4O74A 3MUKA 4CUSA 4Q0NA 2WP2A 5DYXA 5KTWA 4O77A 5J0DA 4NR5A 5CP5A 5CUDA 4UIYA 5CQ7A 5ENFA 4UIZA 4BW2A 2D82A 4LZ2A 5II2A 4QBMA 3IU6A 3UV2A 4PY6A 4YATA 4NUDA 2R0YA 4J1PA 3MXFA 4WHWA 4KV1A 2N9GA 4UITA 2I7KA 1JSPB 4MENA 5CQTA 2OO1A 4CLBA 3UVWA 2DVSA 5LKUA 5LJ2A 1N72A 4HBYA 5DW2A 5D3TA 5G4RA 2YELA 3LJWA 2RNXA 5AMFA 4WIVA 4IOQA 5BT3A 4LZSA 5ENBA 4MR4A 4HBVA 5L97A 4LR6A 5E73A 3U5NA 2OSSA 3LXJA 4LZRA 3P1DA 4PTBA 5EWDA 2OUOA 2RNYA 5D3SA 5ENJA 4A9OA 5A5RA 2KTBB 2RNWA 4TT6A 4O7EA 5EK9A 3MB4A 5CQ3A 4BHWA 4QNSA 5KTXA 3K2JA 5E0RA 5L8UA 4NQNA 5E9IA 4OGIA 3JVJA 5COIA 4HBWA 4O72A 5E9KA 5I80A 5LKXA 4QYDA 5ENCA 3MB3A 5CQAA 4J0RA 3FKMX 5A82A 3U5PA 5E9YA 3S91A 3DAIA 5KHMA 4LRGA 5I89A 5D26A 3SVHA 4NRBA 3QZSA 4YYIA 3S92A 2F6JA 5ENHA 5F1HA 5FH7A 3O33A 5DX4A 5E3DA 5HLSA 3U5MA 4QSXA 5IGLA 5A5PA 4TS8A 4A9IA 5DKCA 5D0CA 4O7FA 5C8GA 3HMHA 4NYWA 3U5OA 4YYKA 5F61A 4XUAA 4QUTA 5DBMA 5IG6A 5DYUA 4QC3A 3NXBA 4N3WA 5L96A 4PS5A 4NR6A 5E9MA 1WUGA 5EPSA 4C67A 4LYSA 5LJ1A 5LVRA 4TZ8A 5FE1A 4ALHA 3LQHA 5A83A 4CURA 4YYDA 4QB3A 5F63A 4A9JA 5A5OA 5EP7A 3ZYUA 4MR5A 4A9KA 5CY9A 5E7DA 3LQIA 4AKNA 2G4AA 4Q0OA 3P1EA 4QSWA 5C89A 4O70A 5LKZA 3QZVA 3P1FA 2YYNA 1JM4B 3UV5A 4QEWA 5E74A 4BW4A 4CFLA 5EU1A 4YBTA 5DLZA 5HQ5A 4UIVA 2RFJA 4WHUA 4UIXA 5EPRA 4QSRA 4NRAA 5EGUA 3LQJA 4UYHA 2H60A 4MEQA 4O7BA 5FG4A 4F3IA 5A5SA 1E6IA 4XYAA 5EVAA 5FG5A 5HQ7A 4UIUA 4HXSA 4QUUA 5IBNA 5A81A 4BW1A 5K29A 3U5KA 4OUFA 4NRCA 4PKLA 4Z1QA 5FE5A 3MQMA 5FE8A 4QEUA 5EV9A 3HMEA 3P1CA 3D7CA 4ZW1A 4A9LA 4YABA 2L5EA 5ENIA 3O35A 2LSPB 2YEMA 3MULA 4HXKA 4YH4A 3U5LA 4IR6A 4NUCA 5C85A 4QC1A 4HXPA 5LJ0A 5D3PA 4LC2A 2F6NA 2RI7A 5ENGA 2DVVA 5EWWA 4XY8A 5HRXA 5KU3A 4NR8A 4YYNA 2RS9B 5CFWA 4CUQA 2DVRA 4YADA 5HQ6A 3QZTA 5F36A 2GRCA 5EICA 5F1LA 4QR5A 5FB0A 5FFWA 4UYEA 5FFYA 4TYLA 5FB1A 4YYHA 4CUPA 5H1UA 4PCEA 5CGPA 5E9VA 3UVDA 4NYVA 5ETDA 4KCXA 5II1A 5D24A 3Q2EA 4TT2A 2YW5A 5D3LA 4NR9A 5CUCA 3IU5A 3P5OA 5DW1A 2FSAA 1EQFA 2R10A 5CUBA 5CQ4A 5E3GA 4N4HA 5F25A 5FE9A 3TLPA 5CS8A 3O34A 3G0JA 2WP1A 4QR4A 4XUBA 5CRZA 5DKDA 5HFRA 4O7CA 5L98A 2DWWA 4NQMA 5I40A 4HXNA 4HXRA 5D3RA 3SVGA 5JWMA 4A9FA 4A9MA 4YC9A 2L84A 5JI8A 4IR5A 5IGNA 4UYDA 5HRVA 5FE7A 4QZSA 4QSSA 4BJXA 3AQAA 5F3AA 4YH3A 5DYCA 5HEMA 5ENEA 5H85A 4MEPA 4LDFA 4PCIA 5KO4A 2E7OA 5TCMA 5HENA 5LVQA 3GG3A 5I7XA 4TZ2A 5D3NA 4Z93A 3JVMA 2NXBA 4UIWA 5I7YA 4NR4A 5C4QA 5CTLA 5DFBA 5H1VA 5L8TA 5BT5A 4IORA 5CUEA 3UV4A 4UYFA 4Z1SA 4J0SA 5ETBA 4Z6HA 2DVQA 4HXMA 4A9NA 4O78A 5FH6A 4O75A 4CUTA 3SVFA 4YYMA 2DATA 3UVYA 3HMFA 5CU8A 5HRWA 5FDZA 4E96A 4OGJA 2MJVB 3DWYA 3UVXA 4A9EA 4N4GA 5I1QA 5KTUA 4NS5A 4O71A 4CUUA 5AMEA 5FBXA 5FE2A 4TT4A 5A5NA 4YBSA 5C87A 4RVRA 5AD3A 5FFVA 5C7NA 4QEVA 3ONIA 4HBXA 5FG6A 4LYWA 4QSVA 4QSPA 4UYGA 4ALGA 4BW3A 5E9LA 5CRMA 4IR3A 4YBMA 4KV4A 4HXLA 5DKHA 5FE6A 5L99A 5CQ6A 2D9EA 2RO1A 4IOOA 5IIDA 4CFKA 2YQDA 3UW9A 5EPBA 3JVKA 3O37A 4QY4A 4UYFB 4FLPA 5CUAA 4MR6A 1WUMA 5IGKA 4O7AA 4QSQA 5FE3A 4ZC9A 2R0VA 1F68A 5CPEA 5D25A 2L85A 5EISA 4X2IA 5EWCA 3O36A 5EM3A 2YEKA 3Q2FA 5BT4A 2DKWA 4TU4A 4YAXA 4NUEA 5F2PA 5FE4A 5EI4A 4A9HA 3G0LA 4J3IA 4ZQLA 5TB6A 4HXOA 5EA1A 5HFQA 5A5QA 4QYLA 4O76A 5F62A 5IGMA 5DY7A 4TU6A 3JVLA 5DLXA 2E3KA 5EQ1A 5A85A 4MEOA 5F60A 4QR3A 5CQ5A 2YDWA 5D3JA
chains in the Genus database with same CATH superfamily
4NXJA 4YYGA 5G4SA 5D7XA 3AADA 5HJCA 4MR3A 4Y03A 4YK0A 5LUUA 4DONA 5I83A 5D3HA 5HM0A 4TTEA 5F5ZA 5I88A 3RCWA 2R0SA 5EWHA 4N4IA 5EWVA 4GPJA 5FH8A 4IR4A 4LYIA 4N4FA 3VKGA 5I29A 2I8NA 4YY6A 4QSTA 4Z6IA 4XY9A 5I86A 1ZS5A 5ACYA 5FE0A 3I3JA 4YYJA 4TQNA 5H1TA 5AD2A 3U5JA 2E7NA 5CUGA 5DFCA 5HELA 4CL9A 5CQ8A 5DYAA 4YY4A 4NR7A 5HCLA 4NYXA 4C66A 5A7CA 5CZGA 5LKTA 4QSUA 1X0JA 5DFDA 4O74A 3MUKA 4CUSA 4Q0NA 2WP2A 5DYXA 5KTWA 4O77A 5J0DA 4NR5A 5CP5A 5CUDA 4UIYA 5CQ7A 5ENFA 4UIZA 4BW2A 2D82A 4LZ2A 5II2A 4QBMA 3IU6A 3UV2A 4PY6A 4YATA 4NUDA 2R0YA 4J1PA 3MXFA 4WHWA 4KV1A 2N9GA 4UITA 2I7KA 1JSPB 4MENA 5CQTA 2OO1A 4CLBA 3UVWA 2DVSA 5LKUA 5LJ2A 1N72A 4HBYA 5DW2A 5D3TA 5G4RA 2YELA 3LJWA 2RNXA 5AMFA 4WIVA 4IOQA 5BT3A 4LZSA 5ENBA 4MR4A 4HBVA 5L97A 4LR6A 5E73A 3U5NA 2OSSA 3LXJA 4LZRA 3P1DA 4PTBA 5EWDA 2OUOA 2RNYA 5D3SA 5ENJA 4A9OA 5A5RA 2KTBB 2RNWA 4TT6A 4O7EA 5EK9A 3MB4A 5CQ3A 4BHWA 4QNSA 5KTXA 3K2JA 5E0RA 5L8UA 4NQNA 5E9IA 4OGIA 3JVJA 5COIA 4HBWA 4O72A 5E9KA 5I80A 5LKXA 4QYDA 4AI6A 5ENCA 3MB3A 5CQAA 4J0RA 3FKMX 5A82A 3U5PA 5E9YA 3S91A 3DAIA 5KHMA 4LRGA 5I89A 5D26A 3SVHA 4NRBA 3QZSA 3D1BA 3D1DA 4YYIA 4AKHA 3S92A 2F6JA 5ENHA 5F1HA 5FH7A 3O33A 5DX4A 5E3DA 5HLSA 3U5MA 4QSXA 5IGLA 5A5PA 4TS8A 4A9IA 5DKCA 5D0CA 4O7FA 5C8GA 3HMHA 4NYWA 3U5OA 3ERRA 4YYKA 5F61A 4XUAA 4QUTA 5DBMA 5IG6A 5DYUA 4QC3A 3NXBA 4N3WA 5L96A 4PS5A 4NR6A 5E9MA 1WUGA 5EPSA 4C67A 4LYSA 5LJ1A 5LVRA 4TZ8A 5FE1A 4ALHA 3LQHA 5A83A 4CURA 1ZKRA 4YYDA 4QB3A 5F63A 4A9JA 5A5OA 5EP7A 3ZYUA 4MR5A 4A9KA 5CY9A 5E7DA 3LQIA 4AKNA 2G4AA 4Q0OA 3P1EA 4QSWA 5C89A 4O70A 5LKZA 3QZVA 3P1FA 2YYNA 1JM4B 3UV5A 4QEWA 5E74A 4BW4A 4CFLA 5EU1A 4YBTA 5DLZA 5HQ5A 4UIVA 2RFJA 4WHUA 4UIXA 5EPRA 4QSRA 4NRAA 5EGUA 3LQJA 4UYHA 2H60A 4MEQA 4O7BA 5FG4A 4F3IA 5A5SA 1E6IA 4XYAA 5EVAA 5FG5A 5HQ7A 4UIUA 4HXSA 4QUUA 5IBNA 5A81A 4BW1A 5K29A 3U5KA 4OUFA 4NRCA 4PKLA 4Z1QA 5FE5A 3MQMA 5FE8A 4QEUA 5EV9A 3HMEA 3P1CA 3D7CA 4ZW1A 4A9LA 4YABA 2L5EA 5ENIA 3O35A 2LSPB 2YEMA 3MULA 4HXKA 4YH4A 3U5LA 4IR6A 4NUCA 5C85A 4QC1A 4HXPA 5LJ0A 5D3PA 4LC2A 2F6NA 2RI7A 5ENGA 2DVVA 5EWWA 4XY8A 5HRXA 5KU3A 4NR8A 4YYNA 3VKHA 2RS9B 5CFWA 4CUQA 2DVRA 4YADA 5HQ6A 3QZTA 5F36A 2GRCA 5EICA 5F1LA 4QR5A 5FB0A 5FFWA 4UYEA 5FFYA 4TYLA 5FB1A 4YYHA 4CUPA 5H1UA 4PCEA 5CGPA 5E9VA 3UVDA 4NYVA 5ETDA 4KCXA 5II1A 5D24A 3Q2EA 4TT2A 2YW5A 5D3LA 4NR9A 5CUCA 3IU5A 3P5OA 5DW1A 2FSAA 1EQFA 2R10A 5CUBA 5CQ4A 5E3GA 4N4HA 5F25A 4AKIA 5FE9A 3TLPA 5CS8A 3O34A 3G0JA 2WP1A 4QR4A 4XUBA 5CRZA 5DKDA 5HFRA 4O7CA 5L98A 2DWWA 4NQMA 5I40A 4HXNA 4HXRA 5D3RA 3SVGA 5JWMA 4A9FA 4A9MA 4YC9A 2L84A 5JI8A 4IR5A 5IGNA 4UYDA 5HRVA 5FE7A 4QZSA 4QSSA 4BJXA 3AQAA 5F3AA 4YH3A 5DYCA 5HEMA 5ENEA 5H85A 4MEPA 4LDFA 4PCIA 5KO4A 2E7OA 5TCMA 5HENA 5LVQA 3GG3A 5I7XA 4TZ2A 5D3NA 4Z93A 3JVMA 2NXBA 4UIWA 5I7YA 4NR4A 5C4QA 5CTLA 5DFBA 5H1VA 5L8TA 5BT5A 4IORA 5CUEA 3UV4A 4UYFA 4Z1SA 4J0SA 5ETBA 4Z6HA 2DVQA 4HXMA 4A9NA 4O78A 5FH6A 4O75A 4CUTA 3SVFA 4YYMA 2EJNA 4AKGA 2DATA 3UVYA 3HMFA 5CU8A 5HRWA 5FDZA 4E96A 4OGJA 2MJVB 3DWYA 3UVXA 4A9EA 4N4GA 5I1QA 5KTUA 4NS5A 4O71A 4CUUA 5AMEA 5FBXA 5FE2A 4TT4A 5A5NA 4YBSA 5C87A 4RVRA 5AD3A 5FFVA 5C7NA 4QEVA 3ONIA 4HBXA 5FG6A 4LYWA 4QSVA 4QSPA 4UYGA 4ALGA 4BW3A 5E9LA 5CRMA 4IR3A 4YBMA 4KV4A 4HXLA 5DKHA 5FE6A 5L99A 5CQ6A 2D9EA 2RO1A 1PUOA 4IOOA 5IIDA 4CFKA 2YQDA 3UW9A 5EPBA 3JVKA 3O37A 4QY4A 4UYFB 4FLPA 5CUAA 4MR6A 1WUMA 5IGKA 4O7AA 4QSQA 5FE3A 4ZC9A 2R0VA 1F68A 5CPEA 5D25A 2L85A 5EISA 4X2IA 5EWCA 3O36A 5EM3A 2YEKA 3Q2FA 5BT4A 2DKWA 4TU4A 4YAXA 4NUEA 5F2PA 5FE4A 5EI4A 4A9HA 3G0LA 4J3IA 4ZQLA 5TB6A 4HXOA 5EA1A 5HFQA 5A5QA 4QYLA 4O76A 5F62A 5IGMA 5DY7A 4TU6A 3JVLA 5DLXA 2E3KA 5EQ1A 5A85A 4MEOA 5F60A 4QR3A 5CQ5A 2YDWA 5D3JA
chains in the Genus database with same CATH topology
4NXJA 4YYGA 5G4SA 5D7XA 3AADA 5HJCA 4MR3A 4Y03A 4YK0A 5LUUA 4DONA 5I83A 5D3HA 5HM0A 4TTEA 5F5ZA 5I88A 3RCWA 2R0SA 5EWHA 4N4IA 5EWVA 4GPJA 5FH8A 4IR4A 4LYIA 4N4FA 5I29A 2I8NA 4YY6A 4QSTA 4Z6IA 4XY9A 5I86A 1ZS5A 5ACYA 5FE0A 3I3JA 4YYJA 4TQNA 5H1TA 5AD2A 3U5JA 2E7NA 5CUGA 5DFCA 5HELA 4CL9A 5CQ8A 5DYAA 4YY4A 4NR7A 5HCLA 4NYXA 4C66A 5A7CA 5CZGA 5LKTA 4QSUA 1X0JA 5DFDA 4O74A 3MUKA 4CUSA 4Q0NA 2WP2A 5DYXA 5KTWA 4O77A 5J0DA 4NR5A 5CP5A 5CUDA 4UIYA 5CQ7A 5ENFA 4UIZA 4BW2A 2D82A 4LZ2A 5II2A 4QBMA 3IU6A 3UV2A 4PY6A 4YATA 4NUDA 2R0YA 4J1PA 3MXFA 4WHWA 4KV1A 2N9GA 4UITA 2I7KA 1JSPB 4MENA 5CQTA 2OO1A 4CLBA 3UVWA 2DVSA 5LKUA 5LJ2A 1N72A 4HBYA 5DW2A 5D3TA 5G4RA 2YELA 3LJWA 2RNXA 5AMFA 4WIVA 4IOQA 5BT3A 4LZSA 5ENBA 4MR4A 4HBVA 5L97A 4LR6A 5E73A 3U5NA 2OSSA 3LXJA 4LZRA 3P1DA 4PTBA 5EWDA 2OUOA 2RNYA 5D3SA 5ENJA 4A9OA 5A5RA 2KTBB 2RNWA 4TT6A 4O7EA 5EK9A 3MB4A 5CQ3A 4BHWA 4QNSA 5KTXA 3K2JA 5E0RA 5L8UA 4NQNA 5E9IA 4OGIA 3JVJA 5COIA 4HBWA 4O72A 5E9KA 5I80A 5LKXA 4QYDA 5ENCA 3MB3A 5CQAA 4J0RA 3FKMX 5A82A 3U5PA 5E9YA 3S91A 3DAIA 5KHMA 4LRGA 5I89A 5D26A 3SVHA 4NRBA 3QZSA 4YYIA 3S92A 2F6JA 5ENHA 5F1HA 5FH7A 3O33A 5DX4A 5E3DA 5HLSA 3U5MA 4QSXA 5IGLA 5A5PA 4TS8A 4A9IA 5DKCA 5D0CA 4O7FA 5C8GA 3HMHA 4NYWA 3U5OA 4YYKA 5F61A 4XUAA 4QUTA 5DBMA 5IG6A 5DYUA 4QC3A 3NXBA 4N3WA 5L96A 4PS5A 4NR6A 5E9MA 1WUGA 5EPSA 4C67A 4LYSA 5LJ1A 5LVRA 4TZ8A 5FE1A 4ALHA 3LQHA 5A83A 4CURA 4YYDA 4QB3A 5F63A 4A9JA 5A5OA 5EP7A 3ZYUA 4MR5A 4A9KA 5CY9A 5E7DA 3LQIA 4AKNA 2G4AA 4Q0OA 3P1EA 4QSWA 5C89A 4O70A 5LKZA 3QZVA 3P1FA 2YYNA 1JM4B 3UV5A 4QEWA 5E74A 4BW4A 4CFLA 5EU1A 4YBTA 5DLZA 5HQ5A 4UIVA 2RFJA 4WHUA 4UIXA 5EPRA 4QSRA 4NRAA 5EGUA 3LQJA 4UYHA 2H60A 4MEQA 4O7BA 5FG4A 4F3IA 5A5SA 1E6IA 4XYAA 5EVAA 5FG5A 5HQ7A 4UIUA 4HXSA 4QUUA 5IBNA 5A81A 4BW1A 5K29A 3U5KA 4OUFA 4NRCA 4PKLA 4Z1QA 5FE5A 3MQMA 5FE8A 4QEUA 5EV9A 3HMEA 3P1CA 3D7CA 4ZW1A 4A9LA 4YABA 2L5EA 5ENIA 3O35A 2LSPB 2YEMA 3MULA 4HXKA 4YH4A 3U5LA 4IR6A 4NUCA 5C85A 4QC1A 4HXPA 5LJ0A 5D3PA 4LC2A 2F6NA 2RI7A 5ENGA 2DVVA 5EWWA 4XY8A 5HRXA 5KU3A 4NR8A 4YYNA 2RS9B 5CFWA 4CUQA 2DVRA 4YADA 5HQ6A 3QZTA 5F36A 2GRCA 5EICA 5F1LA 4QR5A 5FB0A 5FFWA 4UYEA 5FFYA 4TYLA 5FB1A 4YYHA 4CUPA 5H1UA 4PCEA 5CGPA 5E9VA 3UVDA 4NYVA 5ETDA 4KCXA 5II1A 5D24A 3Q2EA 4TT2A 2YW5A 5D3LA 4NR9A 5CUCA 3IU5A 3P5OA 5DW1A 2FSAA 1EQFA 2R10A 5CUBA 5CQ4A 5E3GA 4N4HA 5F25A 5FE9A 3TLPA 5CS8A 3O34A 3G0JA 2WP1A 4QR4A 4XUBA 5CRZA 5DKDA 5HFRA 4O7CA 5L98A 2DWWA 4NQMA 5I40A 4HXNA 4HXRA 5D3RA 3SVGA 5JWMA 4A9FA 4A9MA 4YC9A 2L84A 5JI8A 4IR5A 5IGNA 4UYDA 5HRVA 5FE7A 4QZSA 4QSSA 4BJXA 3AQAA 5F3AA 4YH3A 5DYCA 5HEMA 5ENEA 5H85A 4MEPA 4LDFA 4PCIA 5KO4A 2E7OA 5TCMA 5HENA 5LVQA 3GG3A 5I7XA 4TZ2A 5D3NA 4Z93A 3JVMA 2NXBA 4UIWA 5I7YA 4NR4A 5C4QA 5CTLA 5DFBA 5H1VA 5L8TA 5BT5A 4IORA 5CUEA 3UV4A 4UYFA 4Z1SA 4J0SA 5ETBA 4Z6HA 2DVQA 4HXMA 4A9NA 4O78A 5FH6A 4O75A 4CUTA 3SVFA 4YYMA 2DATA 3UVYA 3HMFA 5CU8A 5HRWA 5FDZA 4E96A 4OGJA 2MJVB 3DWYA 3UVXA 4A9EA 4N4GA 5I1QA 5KTUA 4NS5A 4O71A 4CUUA 5AMEA 5FBXA 5FE2A 4TT4A 5A5NA 4YBSA 5C87A 4RVRA 5AD3A 5FFVA 5C7NA 4QEVA 3ONIA 4HBXA 5FG6A 4LYWA 4QSVA 4QSPA 4UYGA 4ALGA 4BW3A 5E9LA 5CRMA 4IR3A 4YBMA 4KV4A 4HXLA 5DKHA 5FE6A 5L99A 5CQ6A 2D9EA 2RO1A 4IOOA 5IIDA 4CFKA 2YQDA 3UW9A 5EPBA 3JVKA 3O37A 4QY4A 4UYFB 4FLPA 5CUAA 4MR6A 1WUMA 5IGKA 4O7AA 4QSQA 5FE3A 4ZC9A 2R0VA 1F68A 5CPEA 5D25A 2L85A 5EISA 4X2IA 5EWCA 3O36A 5EM3A 2YEKA 3Q2FA 5BT4A 2DKWA 4TU4A 4YAXA 4NUEA 5F2PA 5FE4A 5EI4A 4A9HA 3G0LA 4J3IA 4ZQLA 5TB6A 4HXOA 5EA1A 5HFQA 5A5QA 4QYLA 4O76A 5F62A 5IGMA 5DY7A 4TU6A 3JVLA 5DLXA 2E3KA 5EQ1A 5A85A 4MEOA 5F60A 4QR3A 5CQ5A 2YDWA 5D3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXJ A;  4YYG A;  5G4S A;  5D7X A;  3AAD A;  5HJC A;  4MR3 A;  4Y03 A;  4YK0 A;  5LUU A;  4DON A;  5I83 A;  5D3H A;  5HM0 A;  4TTE A;  5F5Z A;  5I88 A;  3RCW A;  2R0S A;  5EWH A;  4N4I A;  5EWV A;  4GPJ A;  5FH8 A;  4IR4 A;  4LYI A;  4N4F A;  5I29 A;  2I8N A;  4YY6 A;  4QST A;  4Z6I A;  4XY9 A;  5I86 A;  1ZS5 A;  5ACY A;  5FE0 A;  3I3J A;  4YYJ A;  4TQN A;  5H1T A;  5AD2 A;  3U5J A;  2E7N A;  5CUG A;  5DFC A;  5HEL A;  4CL9 A;  5CQ8 A;  5DYA A;  4YY4 A;  4NR7 A;  5HCL A;  4NYX A;  4C66 A;  5A7C A;  5CZG A;  5LKT A;  4QSU A;  1X0J A;  5DFD A;  4O74 A;  3MUK A;  4CUS A;  4Q0N A;  2WP2 A;  5DYX A;  5KTW A;  4O77 A;  5J0D A;  4NR5 A;  5CP5 A;  5CUD A;  4UIY A;  5CQ7 A;  5ENF A;  4UIZ A;  4BW2 A;  2D82 A;  4LZ2 A;  5II2 A;  4QBM A;  3IU6 A;  3UV2 A;  4PY6 A;  4YAT A;  4NUD A;  2R0Y A;  4J1P A;  3MXF A;  4WHW A;  4KV1 A;  2N9G A;  4UIT A;  2I7K A;  1JSP B;  4MEN A;  5CQT A;  2OO1 A;  4CLB A;  3UVW A;  2DVS A;  5LKU A;  5LJ2 A;  1N72 A;  4HBY A;  5DW2 A;  5D3T A;  5G4R A;  2YEL A;  3LJW A;  2RNX A;  5AMF A;  4WIV A;  4IOQ A;  5BT3 A;  4LZS A;  5ENB A;  4MR4 A;  4HBV A;  5L97 A;  4LR6 A;  5E73 A;  3U5N A;  2OSS A;  3LXJ A;  4LZR A;  3P1D A;  4PTB A;  5EWD A;  2OUO A;  2RNY A;  5D3S A;  5ENJ A;  4A9O A;  5A5R A;  2KTB B;  2RNW A;  4TT6 A;  4O7E A;  5EK9 A;  3MB4 A;  5CQ3 A;  4BHW A;  4QNS A;  5KTX A;  3K2J A;  5E0R A;  5L8U A;  4NQN A;  5E9I A;  4OGI A;  3JVJ A;  5COI A;  4HBW A;  4O72 A;  5E9K A;  5I80 A;  5LKX A;  4QYD A;  5ENC A;  3MB3 A;  5CQA A;  4J0R A;  3FKM X;  5A82 A;  3U5P A;  5E9Y A;  3S91 A;  3DAI A;  5KHM A;  4LRG A;  5I89 A;  5D26 A;  3SVH A;  4NRB A;  3QZS A;  4YYI A;  3S92 A;  2F6J A;  5ENH A;  5F1H A;  5FH7 A;  3O33 A;  5DX4 A;  5E3D A;  5HLS A;  3U5M A;  4QSX A;  5IGL A;  5A5P A;  4TS8 A;  4A9I A;  5DKC A;  5D0C A;  4O7F A;  5C8G A;  3HMH A;  4NYW A;  3U5O A;  4YYK A;  5F61 A;  4XUA A;  4QUT A;  5DBM A;  5IG6 A;  5DYU A;  4QC3 A;  3NXB A;  4N3W A;  5L96 A;  4PS5 A;  4NR6 A;  5E9M A;  1WUG A;  5EPS A;  4C67 A;  4LYS A;  5LJ1 A;  5LVR A;  4TZ8 A;  5FE1 A;  4ALH A;  3LQH A;  5A83 A;  4CUR A;  4YYD A;  4QB3 A;  5F63 A;  4A9J A;  5A5O A;  5EP7 A;  3ZYU A;  4MR5 A;  4A9K A;  5CY9 A;  5E7D A;  3LQI A;  4AKN A;  2G4A A;  4Q0O A;  3P1E A;  4QSW A;  5C89 A;  4O70 A;  5LKZ A;  3QZV A;  3P1F A;  2YYN A;  1JM4 B;  3UV5 A;  4QEW A;  5E74 A;  4BW4 A;  4CFL A;  5EU1 A;  4YBT A;  5DLZ A;  5HQ5 A;  4UIV A;  2RFJ A;  4WHU A;  4UIX A;  5EPR A;  4QSR A;  4NRA A;  5EGU A;  3LQJ A;  4UYH A;  2H60 A;  4MEQ A;  4O7B A;  5FG4 A;  4F3I A;  5A5S A;  1E6I A;  4XYA A;  5EVA A;  5FG5 A;  5HQ7 A;  4UIU A;  4HXS A;  4QUU A;  5IBN A;  5A81 A;  4BW1 A;  5K29 A;  3U5K A;  4OUF A;  4NRC A;  4PKL A;  4Z1Q A;  5FE5 A;  3MQM A;  5FE8 A;  4QEU A;  5EV9 A;  3HME A;  3P1C A;  3D7C A;  4ZW1 A;  4A9L A;  4YAB A;  2L5E A;  5ENI A;  3O35 A;  2LSP B;  2YEM A;  3MUL A;  4HXK A;  4YH4 A;  3U5L A;  4IR6 A;  4NUC A;  5C85 A;  4QC1 A;  4HXP A;  5LJ0 A;  5D3P A;  4LC2 A;  2F6N A;  2RI7 A;  5ENG A;  2DVV A;  5EWW A;  4XY8 A;  5HRX A;  5KU3 A;  4NR8 A;  4YYN A;  2RS9 B;  5CFW A;  4CUQ A;  2DVR A;  4YAD A;  5HQ6 A;  3QZT A;  5F36 A;  2GRC A;  5EIC A;  5F1L A;  4QR5 A;  5FB0 A;  5FFW A;  4UYE A;  5FFY A;  4TYL A;  5FB1 A;  4YYH A;  4CUP A;  5H1U A;  4PCE A;  5CGP A;  5E9V A;  3UVD A;  4NYV A;  5ETD A;  4KCX A;  5II1 A;  5D24 A;  3Q2E A;  4TT2 A;  2YW5 A;  5D3L A;  4NR9 A;  5CUC A;  3IU5 A;  3P5O A;  5DW1 A;  2FSA A;  1EQF A;  2R10 A;  5CUB A;  5CQ4 A;  5E3G A;  4N4H A;  5F25 A;  5FE9 A;  3TLP A;  5CS8 A;  3O34 A;  3G0J A;  2WP1 A;  4QR4 A;  4XUB A;  5CRZ A;  5DKD A;  5HFR A;  4O7C A;  5L98 A;  2DWW A;  4NQM A;  5I40 A;  4HXN A;  4HXR A;  5D3R A;  3SVG A;  5JWM A;  4A9F A;  4A9M A;  4YC9 A;  2L84 A;  5JI8 A;  4IR5 A;  5IGN A;  4UYD A;  5HRV A;  5FE7 A;  4QZS A;  4QSS A;  4BJX A;  3AQA A;  5F3A A;  4YH3 A;  5DYC A;  5HEM A;  5ENE A;  5H85 A;  4MEP A;  4LDF A;  4PCI A;  5KO4 A;  2E7O A;  5TCM A;  5HEN A;  5LVQ A;  3GG3 A;  5I7X A;  4TZ2 A;  5D3N A;  4Z93 A;  3JVM A;  2NXB A;  4UIW A;  5I7Y A;  4NR4 A;  5C4Q A;  5CTL A;  5DFB A;  5H1V A;  5L8T A;  5BT5 A;  4IOR A;  5CUE A;  3UV4 A;  4UYF A;  4Z1S A;  4J0S A;  5ETB A;  4Z6H A;  2DVQ A;  4HXM A;  4A9N A;  4O78 A;  5FH6 A;  4O75 A;  4CUT A;  3SVF A;  4YYM A;  2DAT A;  3UVY A;  3HMF A;  5CU8 A;  5HRW A;  5FDZ A;  4E96 A;  4OGJ A;  2MJV B;  3DWY A;  3UVX A;  4A9E A;  4N4G A;  5I1Q A;  5KTU A;  4NS5 A;  4O71 A;  4CUU A;  5AME A;  5FBX A;  5FE2 A;  4TT4 A;  5A5N A;  4YBS A;  5C87 A;  4RVR A;  5AD3 A;  5FFV A;  5C7N A;  4QEV A;  3ONI A;  4HBX A;  5FG6 A;  4LYW A;  4QSV A;  4QSP A;  4UYG A;  4ALG A;  4BW3 A;  5E9L A;  5CRM A;  4IR3 A;  4YBM A;  4KV4 A;  4HXL A;  5DKH A;  5FE6 A;  5L99 A;  5CQ6 A;  2D9E A;  2RO1 A;  4IOO A;  5IID A;  4CFK A;  2YQD A;  3UW9 A;  5EPB A;  3JVK A;  3O37 A;  4QY4 A;  4UYF B;  4FLP A;  5CUA A;  4MR6 A;  1WUM A;  5IGK A;  4O7A A;  4QSQ A;  5FE3 A;  4ZC9 A;  2R0V A;  1F68 A;  5CPE A;  5D25 A;  2L85 A;  5EIS A;  4X2I A;  5EWC A;  3O36 A;  5EM3 A;  2YEK A;  3Q2F A;  5BT4 A;  2DKW A;  4TU4 A;  4YAX A;  4NUE A;  5F2P A;  5FE4 A;  5EI4 A;  4A9H A;  3G0L A;  4J3I A;  4ZQL A;  5TB6 A;  4HXO A;  5EA1 A;  5HFQ A;  5A5Q A;  4QYL A;  4O76 A;  5F62 A;  5IGM A;  5DY7 A;  4TU6 A;  3JVL A;  5DLX A;  2E3K A;  5EQ1 A;  5A85 A;  4MEO A;  5F60 A;  4QR3 A;  5CQ5 A;  2YDW A;  5D3J A; 
#chains in the Genus database with same CATH topology
 4NXJ A;  4YYG A;  5G4S A;  5D7X A;  3AAD A;  5HJC A;  4MR3 A;  4Y03 A;  4YK0 A;  5LUU A;  4DON A;  5I83 A;  5D3H A;  5HM0 A;  4TTE A;  5F5Z A;  5I88 A;  3RCW A;  2R0S A;  5EWH A;  4N4I A;  5EWV A;  4GPJ A;  5FH8 A;  4IR4 A;  4LYI A;  4N4F A;  3VKG A;  5I29 A;  2I8N A;  4YY6 A;  4QST A;  4Z6I A;  4XY9 A;  5I86 A;  1ZS5 A;  5ACY A;  5FE0 A;  3I3J A;  4YYJ A;  4TQN A;  5H1T A;  5AD2 A;  3U5J A;  2E7N A;  5CUG A;  5DFC A;  5HEL A;  4CL9 A;  5CQ8 A;  5DYA A;  4YY4 A;  4NR7 A;  5HCL A;  4NYX A;  4C66 A;  5A7C A;  5CZG A;  5LKT A;  4QSU A;  1X0J A;  5DFD A;  4O74 A;  3MUK A;  4CUS A;  4Q0N A;  2WP2 A;  5DYX A;  5KTW A;  4O77 A;  5J0D A;  4NR5 A;  5CP5 A;  5CUD A;  4UIY A;  5CQ7 A;  5ENF A;  4UIZ A;  4BW2 A;  2D82 A;  4LZ2 A;  5II2 A;  4QBM A;  3IU6 A;  3UV2 A;  4PY6 A;  4YAT A;  4NUD A;  2R0Y A;  4J1P A;  3MXF A;  4WHW A;  4KV1 A;  2N9G A;  4UIT A;  2I7K A;  1JSP B;  4MEN A;  5CQT A;  2OO1 A;  4CLB A;  3UVW A;  2DVS A;  5LKU A;  5LJ2 A;  1N72 A;  4HBY A;  5DW2 A;  5D3T A;  5G4R A;  2YEL A;  3LJW A;  2RNX A;  5AMF A;  4WIV A;  4IOQ A;  5BT3 A;  4LZS A;  5ENB A;  4MR4 A;  4HBV A;  5L97 A;  4LR6 A;  5E73 A;  3U5N A;  2OSS A;  3LXJ A;  4LZR A;  3P1D A;  4PTB A;  5EWD A;  2OUO A;  2RNY A;  5D3S A;  5ENJ A;  4A9O A;  5A5R A;  2KTB B;  2RNW A;  4TT6 A;  4O7E A;  5EK9 A;  3MB4 A;  5CQ3 A;  4BHW A;  4QNS A;  5KTX A;  3K2J A;  5E0R A;  5L8U A;  4NQN A;  5E9I A;  4OGI A;  3JVJ A;  5COI A;  4HBW A;  4O72 A;  5E9K A;  5I80 A;  5LKX A;  4QYD A;  4AI6 A;  5ENC A;  3MB3 A;  5CQA A;  4J0R A;  3FKM X;  5A82 A;  3U5P A;  5E9Y A;  3S91 A;  3DAI A;  5KHM A;  4LRG A;  5I89 A;  5D26 A;  3SVH A;  4NRB A;  3QZS A;  3D1B A;  3D1D A;  4YYI A;  4AKH A;  3S92 A;  2F6J A;  5ENH A;  5F1H A;  5FH7 A;  3O33 A;  5DX4 A;  5E3D A;  5HLS A;  3U5M A;  4QSX A;  5IGL A;  5A5P A;  4TS8 A;  4A9I A;  5DKC A;  5D0C A;  4O7F A;  5C8G A;  3HMH A;  4NYW A;  3U5O A;  3ERR A;  4YYK A;  5F61 A;  4XUA A;  4QUT A;  5DBM A;  5IG6 A;  5DYU A;  4QC3 A;  3NXB A;  4N3W A;  5L96 A;  4PS5 A;  4NR6 A;  5E9M A;  1WUG A;  5EPS A;  4C67 A;  4LYS A;  5LJ1 A;  5LVR A;  4TZ8 A;  5FE1 A;  4ALH A;  3LQH A;  5A83 A;  4CUR A;  1ZKR A;  4YYD A;  4QB3 A;  5F63 A;  4A9J A;  5A5O A;  5EP7 A;  3ZYU A;  4MR5 A;  4A9K A;  5CY9 A;  5E7D A;  3LQI A;  4AKN A;  2G4A A;  4Q0O A;  3P1E A;  4QSW A;  5C89 A;  4O70 A;  5LKZ A;  3QZV A;  3P1F A;  2YYN A;  1JM4 B;  3UV5 A;  4QEW A;  5E74 A;  4BW4 A;  4CFL A;  5EU1 A;  4YBT A;  5DLZ A;  5HQ5 A;  4UIV A;  2RFJ A;  4WHU A;  4UIX A;  5EPR A;  4QSR A;  4NRA A;  5EGU A;  3LQJ A;  4UYH A;  2H60 A;  4MEQ A;  4O7B A;  5FG4 A;  4F3I A;  5A5S A;  1E6I A;  4XYA A;  5EVA A;  5FG5 A;  5HQ7 A;  4UIU A;  4HXS A;  4QUU A;  5IBN A;  5A81 A;  4BW1 A;  5K29 A;  3U5K A;  4OUF A;  4NRC A;  4PKL A;  4Z1Q A;  5FE5 A;  3MQM A;  5FE8 A;  4QEU A;  5EV9 A;  3HME A;  3P1C A;  3D7C A;  4ZW1 A;  4A9L A;  4YAB A;  2L5E A;  5ENI A;  3O35 A;  2LSP B;  2YEM A;  3MUL A;  4HXK A;  4YH4 A;  3U5L A;  4IR6 A;  4NUC A;  5C85 A;  4QC1 A;  4HXP A;  5LJ0 A;  5D3P A;  4LC2 A;  2F6N A;  2RI7 A;  5ENG A;  2DVV A;  5EWW A;  4XY8 A;  5HRX A;  5KU3 A;  4NR8 A;  4YYN A;  3VKH A;  2RS9 B;  5CFW A;  4CUQ A;  2DVR A;  4YAD A;  5HQ6 A;  3QZT A;  5F36 A;  2GRC A;  5EIC A;  5F1L A;  4QR5 A;  5FB0 A;  5FFW A;  4UYE A;  5FFY A;  4TYL A;  5FB1 A;  4YYH A;  4CUP A;  5H1U A;  4PCE A;  5CGP A;  5E9V A;  3UVD A;  4NYV A;  5ETD A;  4KCX A;  5II1 A;  5D24 A;  3Q2E A;  4TT2 A;  2YW5 A;  5D3L A;  4NR9 A;  5CUC A;  3IU5 A;  3P5O A;  5DW1 A;  2FSA A;  1EQF A;  2R10 A;  5CUB A;  5CQ4 A;  5E3G A;  4N4H A;  5F25 A;  4AKI A;  5FE9 A;  3TLP A;  5CS8 A;  3O34 A;  3G0J A;  2WP1 A;  4QR4 A;  4XUB A;  5CRZ A;  5DKD A;  5HFR A;  4O7C A;  5L98 A;  2DWW A;  4NQM A;  5I40 A;  4HXN A;  4HXR A;  5D3R A;  3SVG A;  5JWM A;  4A9F A;  4A9M A;  4YC9 A;  2L84 A;  5JI8 A;  4IR5 A;  5IGN A;  4UYD A;  5HRV A;  5FE7 A;  4QZS A;  4QSS A;  4BJX A;  3AQA A;  5F3A A;  4YH3 A;  5DYC A;  5HEM A;  5ENE A;  5H85 A;  4MEP A;  4LDF A;  4PCI A;  5KO4 A;  2E7O A;  5TCM A;  5HEN A;  5LVQ A;  3GG3 A;  5I7X A;  4TZ2 A;  5D3N A;  4Z93 A;  3JVM A;  2NXB A;  4UIW A;  5I7Y A;  4NR4 A;  5C4Q A;  5CTL A;  5DFB A;  5H1V A;  5L8T A;  5BT5 A;  4IOR A;  5CUE A;  3UV4 A;  4UYF A;  4Z1S A;  4J0S A;  5ETB A;  4Z6H A;  2DVQ A;  4HXM A;  4A9N A;  4O78 A;  5FH6 A;  4O75 A;  4CUT A;  3SVF A;  4YYM A;  2EJN A;  4AKG A;  2DAT A;  3UVY A;  3HMF A;  5CU8 A;  5HRW A;  5FDZ A;  4E96 A;  4OGJ A;  2MJV B;  3DWY A;  3UVX A;  4A9E A;  4N4G A;  5I1Q A;  5KTU A;  4NS5 A;  4O71 A;  4CUU A;  5AME A;  5FBX A;  5FE2 A;  4TT4 A;  5A5N A;  4YBS A;  5C87 A;  4RVR A;  5AD3 A;  5FFV A;  5C7N A;  4QEV A;  3ONI A;  4HBX A;  5FG6 A;  4LYW A;  4QSV A;  4QSP A;  4UYG A;  4ALG A;  4BW3 A;  5E9L A;  5CRM A;  4IR3 A;  4YBM A;  4KV4 A;  4HXL A;  5DKH A;  5FE6 A;  5L99 A;  5CQ6 A;  2D9E A;  2RO1 A;  1PUO A;  4IOO A;  5IID A;  4CFK A;  2YQD A;  3UW9 A;  5EPB A;  3JVK A;  3O37 A;  4QY4 A;  4UYF B;  4FLP A;  5CUA A;  4MR6 A;  1WUM A;  5IGK A;  4O7A A;  4QSQ A;  5FE3 A;  4ZC9 A;  2R0V A;  1F68 A;  5CPE A;  5D25 A;  2L85 A;  5EIS A;  4X2I A;  5EWC A;  3O36 A;  5EM3 A;  2YEK A;  3Q2F A;  5BT4 A;  2DKW A;  4TU4 A;  4YAX A;  4NUE A;  5F2P A;  5FE4 A;  5EI4 A;  4A9H A;  3G0L A;  4J3I A;  4ZQL A;  5TB6 A;  4HXO A;  5EA1 A;  5HFQ A;  5A5Q A;  4QYL A;  4O76 A;  5F62 A;  5IGM A;  5DY7 A;  4TU6 A;  3JVL A;  5DLX A;  2E3K A;  5EQ1 A;  5A85 A;  4MEO A;  5F60 A;  4QR3 A;  5CQ5 A;  2YDW A;  5D3J A; 
#chains in the Genus database with same CATH homology
 4NXJ A;  4YYG A;  5G4S A;  5D7X A;  3AAD A;  5HJC A;  4MR3 A;  4Y03 A;  4YK0 A;  5LUU A;  4DON A;  5I83 A;  5D3H A;  5HM0 A;  4TTE A;  5F5Z A;  5I88 A;  3RCW A;  2R0S A;  5EWH A;  4N4I A;  5EWV A;  4GPJ A;  5FH8 A;  4IR4 A;  4LYI A;  4N4F A;  5I29 A;  2I8N A;  4YY6 A;  4QST A;  4Z6I A;  4XY9 A;  5I86 A;  1ZS5 A;  5ACY A;  5FE0 A;  3I3J A;  4YYJ A;  4TQN A;  5H1T A;  5AD2 A;  3U5J A;  2E7N A;  5CUG A;  5DFC A;  5HEL A;  4CL9 A;  5CQ8 A;  5DYA A;  4YY4 A;  4NR7 A;  5HCL A;  4NYX A;  4C66 A;  5A7C A;  5CZG A;  5LKT A;  4QSU A;  1X0J A;  5DFD A;  4O74 A;  3MUK A;  4CUS A;  4Q0N A;  2WP2 A;  5DYX A;  5KTW A;  4O77 A;  5J0D A;  4NR5 A;  5CP5 A;  5CUD A;  4UIY A;  5CQ7 A;  5ENF A;  4UIZ A;  4BW2 A;  2D82 A;  4LZ2 A;  5II2 A;  4QBM A;  3IU6 A;  3UV2 A;  4PY6 A;  4YAT A;  4NUD A;  2R0Y A;  4J1P A;  3MXF A;  4WHW A;  4KV1 A;  2N9G A;  4UIT A;  2I7K A;  1JSP B;  4MEN A;  5CQT A;  2OO1 A;  4CLB A;  3UVW A;  2DVS A;  5LKU A;  5LJ2 A;  1N72 A;  4HBY A;  5DW2 A;  5D3T A;  5G4R A;  2YEL A;  3LJW A;  2RNX A;  5AMF A;  4WIV A;  4IOQ A;  5BT3 A;  4LZS A;  5ENB A;  4MR4 A;  4HBV A;  5L97 A;  4LR6 A;  5E73 A;  3U5N A;  2OSS A;  3LXJ A;  4LZR A;  3P1D A;  4PTB A;  5EWD A;  2OUO A;  2RNY A;  5D3S A;  5ENJ A;  4A9O A;  5A5R A;  2KTB B;  2RNW A;  4TT6 A;  4O7E A;  5EK9 A;  3MB4 A;  5CQ3 A;  4BHW A;  4QNS A;  5KTX A;  3K2J A;  5E0R A;  5L8U A;  4NQN A;  5E9I A;  4OGI A;  3JVJ A;  5COI A;  4HBW A;  4O72 A;  5E9K A;  5I80 A;  5LKX A;  4QYD A;  5ENC A;  3MB3 A;  5CQA A;  4J0R A;  3FKM X;  5A82 A;  3U5P A;  5E9Y A;  3S91 A;  3DAI A;  5KHM A;  4LRG A;  5I89 A;  5D26 A;  3SVH A;  4NRB A;  3QZS A;  4YYI A;  3S92 A;  2F6J A;  5ENH A;  5F1H A;  5FH7 A;  3O33 A;  5DX4 A;  5E3D A;  5HLS A;  3U5M A;  4QSX A;  5IGL A;  5A5P A;  4TS8 A;  4A9I A;  5DKC A;  5D0C A;  4O7F A;  5C8G A;  3HMH A;  4NYW A;  3U5O A;  4YYK A;  5F61 A;  4XUA A;  4QUT A;  5DBM A;  5IG6 A;  5DYU A;  4QC3 A;  3NXB A;  4N3W A;  5L96 A;  4PS5 A;  4NR6 A;  5E9M A;  1WUG A;  5EPS A;  4C67 A;  4LYS A;  5LJ1 A;  5LVR A;  4TZ8 A;  5FE1 A;  4ALH A;  3LQH A;  5A83 A;  4CUR A;  4YYD A;  4QB3 A;  5F63 A;  4A9J A;  5A5O A;  5EP7 A;  3ZYU A;  4MR5 A;  4A9K A;  5CY9 A;  5E7D A;  3LQI A;  4AKN A;  2G4A A;  4Q0O A;  3P1E A;  4QSW A;  5C89 A;  4O70 A;  5LKZ A;  3QZV A;  3P1F A;  2YYN A;  1JM4 B;  3UV5 A;  4QEW A;  5E74 A;  4BW4 A;  4CFL A;  5EU1 A;  4YBT A;  5DLZ A;  5HQ5 A;  4UIV A;  2RFJ A;  4WHU A;  4UIX A;  5EPR A;  4QSR A;  4NRA A;  5EGU A;  3LQJ A;  4UYH A;  2H60 A;  4MEQ A;  4O7B A;  5FG4 A;  4F3I A;  5A5S A;  1E6I A;  4XYA A;  5EVA A;  5FG5 A;  5HQ7 A;  4UIU A;  4HXS A;  4QUU A;  5IBN A;  5A81 A;  4BW1 A;  5K29 A;  3U5K A;  4OUF A;  4NRC A;  4PKL A;  4Z1Q A;  5FE5 A;  3MQM A;  5FE8 A;  4QEU A;  5EV9 A;  3HME A;  3P1C A;  3D7C A;  4ZW1 A;  4A9L A;  4YAB A;  2L5E A;  5ENI A;  3O35 A;  2LSP B;  2YEM A;  3MUL A;  4HXK A;  4YH4 A;  3U5L A;  4IR6 A;  4NUC A;  5C85 A;  4QC1 A;  4HXP A;  5LJ0 A;  5D3P A;  4LC2 A;  2F6N A;  2RI7 A;  5ENG A;  2DVV A;  5EWW A;  4XY8 A;  5HRX A;  5KU3 A;  4NR8 A;  4YYN A;  2RS9 B;  5CFW A;  4CUQ A;  2DVR A;  4YAD A;  5HQ6 A;  3QZT A;  5F36 A;  2GRC A;  5EIC A;  5F1L A;  4QR5 A;  5FB0 A;  5FFW A;  4UYE A;  5FFY A;  4TYL A;  5FB1 A;  4YYH A;  4CUP A;  5H1U A;  4PCE A;  5CGP A;  5E9V A;  3UVD A;  4NYV A;  5ETD A;  4KCX A;  5II1 A;  5D24 A;  3Q2E A;  4TT2 A;  2YW5 A;  5D3L A;  4NR9 A;  5CUC A;  3IU5 A;  3P5O A;  5DW1 A;  2FSA A;  1EQF A;  2R10 A;  5CUB A;  5CQ4 A;  5E3G A;  4N4H A;  5F25 A;  5FE9 A;  3TLP A;  5CS8 A;  3O34 A;  3G0J A;  2WP1 A;  4QR4 A;  4XUB A;  5CRZ A;  5DKD A;  5HFR A;  4O7C A;  5L98 A;  2DWW A;  4NQM A;  5I40 A;  4HXN A;  4HXR A;  5D3R A;  3SVG A;  5JWM A;  4A9F A;  4A9M A;  4YC9 A;  2L84 A;  5JI8 A;  4IR5 A;  5IGN A;  4UYD A;  5HRV A;  5FE7 A;  4QZS A;  4QSS A;  4BJX A;  3AQA A;  5F3A A;  4YH3 A;  5DYC A;  5HEM A;  5ENE A;  5H85 A;  4MEP A;  4LDF A;  4PCI A;  5KO4 A;  2E7O A;  5TCM A;  5HEN A;  5LVQ A;  3GG3 A;  5I7X A;  4TZ2 A;  5D3N A;  4Z93 A;  3JVM A;  2NXB A;  4UIW A;  5I7Y A;  4NR4 A;  5C4Q A;  5CTL A;  5DFB A;  5H1V A;  5L8T A;  5BT5 A;  4IOR A;  5CUE A;  3UV4 A;  4UYF A;  4Z1S A;  4J0S A;  5ETB A;  4Z6H A;  2DVQ A;  4HXM A;  4A9N A;  4O78 A;  5FH6 A;  4O75 A;  4CUT A;  3SVF A;  4YYM A;  2DAT A;  3UVY A;  3HMF A;  5CU8 A;  5HRW A;  5FDZ A;  4E96 A;  4OGJ A;  2MJV B;  3DWY A;  3UVX A;  4A9E A;  4N4G A;  5I1Q A;  5KTU A;  4NS5 A;  4O71 A;  4CUU A;  5AME A;  5FBX A;  5FE2 A;  4TT4 A;  5A5N A;  4YBS A;  5C87 A;  4RVR A;  5AD3 A;  5FFV A;  5C7N A;  4QEV A;  3ONI A;  4HBX A;  5FG6 A;  4LYW A;  4QSV A;  4QSP A;  4UYG A;  4ALG A;  4BW3 A;  5E9L A;  5CRM A;  4IR3 A;  4YBM A;  4KV4 A;  4HXL A;  5DKH A;  5FE6 A;  5L99 A;  5CQ6 A;  2D9E A;  2RO1 A;  4IOO A;  5IID A;  4CFK A;  2YQD A;  3UW9 A;  5EPB A;  3JVK A;  3O37 A;  4QY4 A;  4UYF B;  4FLP A;  5CUA A;  4MR6 A;  1WUM A;  5IGK A;  4O7A A;  4QSQ A;  5FE3 A;  4ZC9 A;  2R0V A;  1F68 A;  5CPE A;  5D25 A;  2L85 A;  5EIS A;  4X2I A;  5EWC A;  3O36 A;  5EM3 A;  2YEK A;  3Q2F A;  5BT4 A;  2DKW A;  4TU4 A;  4YAX A;  4NUE A;  5F2P A;  5FE4 A;  5EI4 A;  4A9H A;  3G0L A;  4J3I A;  4ZQL A;  5TB6 A;  4HXO A;  5EA1 A;  5HFQ A;  5A5Q A;  4QYL A;  4O76 A;  5F62 A;  5IGM A;  5DY7 A;  4TU6 A;  3JVL A;  5DLX A;  2E3K A;  5EQ1 A;  5A85 A;  4MEO A;  5F60 A;  4QR3 A;  5CQ5 A;  2YDW A;  5D3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...