2R0VA

Structure of the rsc4 tandem bromodomain acetylated at k25
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
293
structure length
292
Chain Sequence
PKYLPGHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromatin structure-remodeling complex protein RSC4
publication title Autoregulation of the rsc4 tandem bromodomain by gcn5 acetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 103
structure length 292
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0vA01
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0vA02
4HBVA 5BT5A 5KU3A 5CUGA 4QBMA 4YBSA 3U5PA 4YH3A 5A81A 4BW3A 4MR5A 5CUDA 5E9MA 3FKMX 5A82A 4NS5A 5D3LA 4IR4A 4O77A 5FG6A 5CRMA 5HENA 2OUOA 2DVSA 5EP7A 5FE4A 5ETBA 5CTLA 3K2JA 5FE7A 4QR5A 3UV4A 1EQFA 5A83A 5CUBA 5D3SA 5I88A 5DFBA 5I80A 5FFWA 4O7AA 4QR4A 4QEVA 4MR3A 2GRCA 4Q0NA 4C66A 2YEMA 4YH4A 2OO1A 5EK9A 5TCMA 4N4IA 5ENCA 5CQTA 4A9EA 3P1FA 4NR4A 3UVWA 4YK0A 3MXFA 4IORA 5ENFA 5D25A 4ALGA 5HJCA 5G4SA 4TT6A 5AMEA 5FG5A 5FB1A 5HQ6A 4QSSA 5H1UA 4QYLA 4QY4A 4UIZA 5CQ4A 5AD2A 4TT2A 4N4FA 5E3GA 5II2A 2I8NA 5I29A 2YEKA 5ACYA 4ZC9A 5KTXA 4HBXA 4N3WA 5I86A 4NR6A 5E9YA 4IOQA 5HQ7A 5LJ1A 5H1TA 3IU5A 4UYEA 3AADA 5E9LA 2DWWA 4IR5A 5DLXA 2G4AA 4CUQA 3HMFA 4LZSA 5HQ5A 4A9NA 4PCEA 5AD3A 5CZGA 3JVJA 5EV9A 5LKUA 4QSQA 1JSPB 5DW1A 4NRCA 5A5PA 4UITA 2N9GA 4UYFB 3JVMA 4TU4A 5HFRA 3Q2FA 4Q0OA 2L85A 4NUEA 5FH8A 1ZS5A 4HBWA 5L8TA 5EWDA 5FFVA 5ENBA 5DY7A 5HM0A 4J0SA 5H85A 1F68A 3MULA 5H1VA 5F1HA 4PCIA 4UIUA 3RCWA 4NRAA 4TYLA 2WP1A 5CQ3A 3LJWA 4YBTA 5EQ1A 4O75A 4QSWA 5I89A 4YYNA 2YELA 4LYIA 2DVVA 5F2PA 2RO1A 5F25A 4PTBA 3U5OA 4NYWA 4WHWA 4C67A 5FE8A 3LQIA 4MENA 4YADA 5DYXA 3JVLA 1WUMA 4QSRA 2RS9B 4YAXA 5ENIA 4YYDA 4NXJA 4LZ2A 5EISA 4CL9A 5HLSA 4O7BA 3QZSA 5FE3A 2RNYA 4YC9A 5DKCA 2YW5A 3HMEA 4BW2A 4CFKA 3O37A 3O34A 5I7XA 5KO4A 5CU8A 5FB0A 4QNSA 3DWYA 4MR6A 5EVAA 3U5JA 5C7NA 4NUCA 5J0DA 4HXPA 4QUTA 5ENHA 4UIVA 4QZSA 4A9JA 5DKHA 4IR3A 4XY9A 2DATA 2LSPB 4NYXA 4TTEA 4MEOA 3QZVA 2D9EA 4NR9A 5E9IA 5A5NA 5F1LA 4UYGA 5EWWA 4LZRA 4ZW1A 4CUSA 4OGIA 2YQDA 5HRVA 4YYKA 5F61A 3SVHA 5F60A 5D24A 4CURA 4FLPA 4KV1A 4XUAA 5KHMA 5BT3A 5COIA 4J3IA 4QEWA 5FE1A 4O7EA 5LJ0A 4A9IA 4BW1A 4HXRA 4PS5A 2RFJA 3MQMA 4MEPA 5K29A 5FG4A 4A9MA 5HRXA 4DONA 5CQ5A 4MEQA 5CUCA 5EICA 4Z1QA 5I7YA 5L8UA 3ZYUA 4A9KA 4YATA 5CPEA 3S92A 5ETDA 5I40A 3LQJA 4KV4A 5CY9A 5DYUA 3O36A 4QC1A 4J1PA 5CQAA 3Q2EA 5LUUA 5IGKA 4XY8A 4NUDA 5DFDA 3D7CA 2F6NA 4N4GA 4LRGA 2MJVB 3U5MA 3SVFA 4NR7A 5F63A 5KTWA 5LVQA 4CUPA 5FE0A 4KCXA 3AQAA 3P5OA 1WUGA 4QYDA 4X2IA 3LXJA 5ENJA 3UV5A 5EM3A 4XYAA 5JWMA 5E73A 5EWCA 5FDZA 3ONIA 4QEUA 4YYHA 3O33A 5KTUA 2RNWA 3U5LA 5DYCA 4NR5A 2I7KA 5DFCA 3MB3A 4UIYA 5CGPA 5D26A 4QUUA 3DAIA 4YY4A 2FSAA 4NRBA 4QB3A 3GG3A 4XUBA 3I3JA 1X0JA 4WHUA 3P1DA 5HCLA 4Z6HA 3U5KA 4YYJA 4UYFA 4TU6A 5E0RA 5DW2A 4LC2A 5CUAA 5EPBA 5FBXA 5CS8A 5IG6A 5FE5A 3NXBA 4Z1SA 2L84A 4CLBA 4YBMA 2DKWA 5DLZA 3U5NA 4HXOA 5IGLA 4TZ2A 5A5RA 5G4RA 5EPSA 5DX4A 5CQ6A 4NYVA 5D3TA 4BW4A 5A5QA 5DKDA 2WP2A 5C8GA 4CFLA 5JI8A 1JM4B 4CUUA 4O72A 4GPJA 4UIXA 4TZ8A 2E3KA 4LDFA 4QSUA 4A9FA 2DVRA 5EGUA 5E3DA 5F62A 4A9HA 2L5EA 4OGJA 4Z6IA 5LKZA 3TLPA 4CUTA 4YYIA 5EWHA 4UIWA 3P1EA 5EWVA 3UVXA 2R0YA 4HBYA 3QZTA 5E9KA 2YYNA 4HXNA 2H60A 5FH6A 4UYDA 2NXBA 4NQMA 4A9OA 5IGMA 3MUKA 3P1CA 5AMFA 1E6IA 5LKTA 3G0JA 1N72A 5L98A 4O70A 5ENGA 5IGNA 3UV2A 4O76A 5FE9A 5E9VA 4NQNA 4YY6A 4IR6A 3UVDA 5LJ2A 4BJXA 4A9LA 5LKXA 5D3PA 5CP5A 5D7XA 5E74A 4QSTA 4F3IA 5E7DA 5L97A 4YABA 3SVGA 4Z93A 2YDWA 4LYWA 2KTBB 5EA1A 5C4QA 3G0LA 5I83A 4O7FA 4AKNA 5C85A 4TS8A 5EPRA 4MR4A 4WIVA 5HFQA 5D3NA 4QSVA 3MB4A 4YYMA 4E96A 5A5SA 5HEMA 4UYHA 5CUEA 5A85A 2DVQA 4TQNA 5CQ8A 4ZQLA 3S91A 4HXMA 4N4HA 4BHWA 2R0SA 5F36A 4NR8A 5EI4A 5CQ7A 4LR6A 5II1A 5ENEA 2F6JA 5FE6A 5BT4A 4RVRA 2E7OA 5C87A 2RNXA 3JVKA 4J0RA 4OUFA 5LVRA 5D0CA 3O35A 5D3RA 5L96A 5A7CA 2R10A 5D3HA 2E7NA 5HELA 5L99A 4QSPA 5I1QA 5DYAA 4LYSA 5C89A 3IU6A 4TT4A 4O71A 2OSSA 4HXKA 4ALHA 5IIDA 4IOOA 4O7CA 3UW9A 5TB6A 2D82A 4HXSA 5HRWA 5EU1A 5FH7A 2RI7A 4HXLA 5DBMA 5F3AA 2R0VA 5D3JA 5FE2A 3UVYA 4PKLA 5FFYA 5IBNA 4O78A 4PY6A 5F5ZA 4QR3A 3LQHA 3HMHA 5CRZA 4YYGA 5A5OA 4O74A 5CFWA 4Y03A 4QSXA 4QC3A
chains in the Genus database with same CATH superfamily
4HBVA 5BT5A 5KU3A 5CUGA 4QBMA 4YBSA 3U5PA 4YH3A 5A81A 4BW3A 4MR5A 5CUDA 5E9MA 3FKMX 5A82A 4NS5A 5D3LA 4IR4A 4O77A 5FG6A 5CRMA 5HENA 2OUOA 2DVSA 5EP7A 5FE4A 5ETBA 5CTLA 3K2JA 5FE7A 4QR5A 3UV4A 1EQFA 5A83A 5CUBA 5D3SA 5I88A 5DFBA 5I80A 5FFWA 4O7AA 4QR4A 4QEVA 4MR3A 2GRCA 4Q0NA 4C66A 2YEMA 4YH4A 2OO1A 5EK9A 5TCMA 4N4IA 5ENCA 5CQTA 4A9EA 3P1FA 4NR4A 3UVWA 4YK0A 3MXFA 4IORA 5ENFA 5D25A 4ALGA 5HJCA 5G4SA 4TT6A 5AMEA 5FG5A 5FB1A 5HQ6A 4QSSA 5H1UA 4QYLA 4QY4A 4UIZA 5CQ4A 5AD2A 4TT2A 4N4FA 5E3GA 5II2A 2I8NA 5I29A 4AKIA 2YEKA 5ACYA 4ZC9A 5KTXA 4HBXA 4N3WA 5I86A 4NR6A 5E9YA 4IOQA 5HQ7A 5LJ1A 5H1TA 3IU5A 4UYEA 3AADA 5E9LA 2DWWA 4IR5A 5DLXA 2G4AA 3D1DA 4CUQA 3HMFA 4LZSA 5HQ5A 4A9NA 4PCEA 5AD3A 5CZGA 3JVJA 5EV9A 5LKUA 4QSQA 3VKHA 1JSPB 5DW1A 4NRCA 5A5PA 4UITA 2N9GA 4UYFB 3JVMA 4TU4A 5HFRA 3Q2FA 4Q0OA 2L85A 4NUEA 5FH8A 1ZS5A 4HBWA 5L8TA 5EWDA 5FFVA 5ENBA 5DY7A 5HM0A 4J0SA 5H85A 2EJNA 1F68A 3MULA 5H1VA 5F1HA 4PCIA 4UIUA 3RCWA 4NRAA 4TYLA 2WP1A 5CQ3A 3LJWA 4YBTA 5EQ1A 4O75A 4QSWA 5I89A 4YYNA 2YELA 4LYIA 2DVVA 5F2PA 2RO1A 5F25A 4PTBA 3U5OA 4NYWA 4WHWA 4C67A 5FE8A 3LQIA 4MENA 4YADA 5DYXA 3JVLA 1WUMA 4QSRA 2RS9B 4YAXA 5ENIA 4YYDA 4NXJA 4LZ2A 5EISA 4CL9A 3VKGA 5HLSA 4O7BA 3QZSA 5FE3A 2RNYA 4YC9A 5DKCA 3ERRA 2YW5A 3HMEA 4BW2A 4CFKA 3O37A 3O34A 1PUOA 5I7XA 5KO4A 5CU8A 5FB0A 4QNSA 3DWYA 4MR6A 5EVAA 3U5JA 5C7NA 4NUCA 5J0DA 4HXPA 4QUTA 5ENHA 4UIVA 4QZSA 4A9JA 5DKHA 4IR3A 4XY9A 2DATA 2LSPB 4NYXA 4TTEA 4MEOA 3QZVA 2D9EA 4NR9A 5E9IA 5A5NA 5F1LA 4UYGA 5EWWA 4LZRA 4ZW1A 4CUSA 4OGIA 2YQDA 5HRVA 4YYKA 5F61A 3SVHA 5F60A 5D24A 4CURA 4FLPA 4KV1A 4XUAA 5KHMA 5BT3A 5COIA 4J3IA 4QEWA 5FE1A 4O7EA 5LJ0A 4A9IA 4BW1A 4HXRA 4PS5A 2RFJA 3MQMA 4MEPA 5K29A 5FG4A 4A9MA 5HRXA 4DONA 5CQ5A 4MEQA 5CUCA 5EICA 4Z1QA 5I7YA 5L8UA 3ZYUA 4A9KA 4YATA 5CPEA 3S92A 5ETDA 5I40A 3LQJA 4KV4A 5CY9A 5DYUA 3O36A 4QC1A 4J1PA 5CQAA 3Q2EA 5LUUA 1ZKRA 5IGKA 4XY8A 4NUDA 5DFDA 3D7CA 2F6NA 4N4GA 4LRGA 2MJVB 3U5MA 3SVFA 4NR7A 5F63A 5KTWA 5LVQA 4CUPA 5FE0A 4KCXA 3AQAA 3P5OA 1WUGA 4QYDA 4X2IA 3LXJA 5ENJA 3UV5A 5EM3A 4XYAA 5JWMA 5E73A 5EWCA 5FDZA 3ONIA 4QEUA 4YYHA 3O33A 5KTUA 2RNWA 3U5LA 5DYCA 4NR5A 2I7KA 5DFCA 3MB3A 4UIYA 5CGPA 5D26A 4QUUA 3DAIA 4YY4A 2FSAA 4NRBA 4QB3A 3GG3A 4XUBA 3I3JA 1X0JA 4WHUA 3P1DA 5HCLA 4Z6HA 3U5KA 4YYJA 4UYFA 4TU6A 5E0RA 5DW2A 4LC2A 5CUAA 5EPBA 5FBXA 5CS8A 5IG6A 5FE5A 3NXBA 4Z1SA 2L84A 4CLBA 4YBMA 2DKWA 5DLZA 3U5NA 4HXOA 5IGLA 4TZ2A 5A5RA 5G4RA 5EPSA 5DX4A 5CQ6A 4NYVA 5D3TA 4BW4A 5A5QA 5DKDA 2WP2A 5C8GA 4CFLA 5JI8A 1JM4B 4CUUA 4O72A 4GPJA 4UIXA 4TZ8A 2E3KA 4LDFA 4QSUA 4A9FA 2DVRA 5EGUA 5E3DA 5F62A 4A9HA 2L5EA 4OGJA 4Z6IA 5LKZA 3TLPA 4CUTA 4YYIA 5EWHA 4UIWA 3P1EA 5EWVA 3UVXA 2R0YA 4HBYA 3QZTA 5E9KA 2YYNA 4HXNA 2H60A 5FH6A 4UYDA 2NXBA 4NQMA 4A9OA 5IGMA 3MUKA 3P1CA 5AMFA 1E6IA 5LKTA 3G0JA 1N72A 5L98A 4O70A 5ENGA 5IGNA 3UV2A 4O76A 5FE9A 5E9VA 4NQNA 4YY6A 4IR6A 3UVDA 5LJ2A 4BJXA 4A9LA 4AI6A 5LKXA 5D3PA 5CP5A 5D7XA 5E74A 4QSTA 4F3IA 5E7DA 5L97A 4YABA 3SVGA 4Z93A 2YDWA 4LYWA 2KTBB 5EA1A 5C4QA 3G0LA 5I83A 4O7FA 4AKNA 5C85A 4TS8A 5EPRA 4MR4A 4WIVA 5HFQA 5D3NA 4QSVA 3MB4A 4YYMA 4E96A 5A5SA 5HEMA 4UYHA 5CUEA 5A85A 2DVQA 4TQNA 5CQ8A 4ZQLA 3S91A 4HXMA 4N4HA 4BHWA 4AKGA 2R0SA 5F36A 4NR8A 5EI4A 5CQ7A 4LR6A 5II1A 5ENEA 2F6JA 5FE6A 5BT4A 4RVRA 2E7OA 5C87A 2RNXA 3JVKA 4J0RA 4OUFA 5LVRA 5D0CA 3O35A 5D3RA 5L96A 5A7CA 2R10A 5D3HA 2E7NA 5HELA 5L99A 4QSPA 5I1QA 5DYAA 4LYSA 5C89A 3IU6A 4TT4A 4O71A 2OSSA 4HXKA 4ALHA 5IIDA 4IOOA 4O7CA 3UW9A 5TB6A 2D82A 4HXSA 5HRWA 5EU1A 5FH7A 2RI7A 4HXLA 3D1BA 5DBMA 5F3AA 4AKHA 2R0VA 5D3JA 5FE2A 3UVYA 4PKLA 5FFYA 5IBNA 4O78A 4PY6A 5F5ZA 4QR3A 3LQHA 3HMHA 5CRZA 4YYGA 5A5OA 4O74A 5CFWA 4Y03A 4QSXA 4QC3A
chains in the Genus database with same CATH topology
4HBVA 5BT5A 5KU3A 5CUGA 4QBMA 4YBSA 3U5PA 4YH3A 5A81A 4BW3A 4MR5A 5CUDA 5E9MA 3FKMX 5A82A 4NS5A 5D3LA 4IR4A 4O77A 5FG6A 5CRMA 5HENA 2OUOA 2DVSA 5EP7A 5FE4A 5ETBA 5CTLA 3K2JA 5FE7A 4QR5A 3UV4A 1EQFA 5A83A 5CUBA 5D3SA 5I88A 5DFBA 5I80A 5FFWA 4O7AA 4QR4A 4QEVA 4MR3A 2GRCA 4Q0NA 4C66A 2YEMA 4YH4A 2OO1A 5EK9A 5TCMA 4N4IA 5ENCA 5CQTA 4A9EA 3P1FA 4NR4A 3UVWA 4YK0A 3MXFA 4IORA 5ENFA 5D25A 4ALGA 5HJCA 5G4SA 4TT6A 5AMEA 5FG5A 5FB1A 5HQ6A 4QSSA 5H1UA 4QYLA 4QY4A 4UIZA 5CQ4A 5AD2A 4TT2A 4N4FA 5E3GA 5II2A 2I8NA 5I29A 2YEKA 5ACYA 4ZC9A 5KTXA 4HBXA 4N3WA 5I86A 4NR6A 5E9YA 4IOQA 5HQ7A 5LJ1A 5H1TA 3IU5A 4UYEA 3AADA 5E9LA 2DWWA 4IR5A 5DLXA 2G4AA 4CUQA 3HMFA 4LZSA 5HQ5A 4A9NA 4PCEA 5AD3A 5CZGA 3JVJA 5EV9A 5LKUA 4QSQA 1JSPB 5DW1A 4NRCA 5A5PA 4UITA 2N9GA 4UYFB 3JVMA 4TU4A 5HFRA 3Q2FA 4Q0OA 2L85A 4NUEA 5FH8A 1ZS5A 4HBWA 5L8TA 5EWDA 5FFVA 5ENBA 5DY7A 5HM0A 4J0SA 5H85A 1F68A 3MULA 5H1VA 5F1HA 4PCIA 4UIUA 3RCWA 4NRAA 4TYLA 2WP1A 5CQ3A 3LJWA 4YBTA 5EQ1A 4O75A 4QSWA 5I89A 4YYNA 2YELA 4LYIA 2DVVA 5F2PA 2RO1A 5F25A 4PTBA 3U5OA 4NYWA 4WHWA 4C67A 5FE8A 3LQIA 4MENA 4YADA 5DYXA 3JVLA 1WUMA 4QSRA 2RS9B 4YAXA 5ENIA 4YYDA 4NXJA 4LZ2A 5EISA 4CL9A 5HLSA 4O7BA 3QZSA 5FE3A 2RNYA 4YC9A 5DKCA 2YW5A 3HMEA 4BW2A 4CFKA 3O37A 3O34A 5I7XA 5KO4A 5CU8A 5FB0A 4QNSA 3DWYA 4MR6A 5EVAA 3U5JA 5C7NA 4NUCA 5J0DA 4HXPA 4QUTA 5ENHA 4UIVA 4QZSA 4A9JA 5DKHA 4IR3A 4XY9A 2DATA 2LSPB 4NYXA 4TTEA 4MEOA 3QZVA 2D9EA 4NR9A 5E9IA 5A5NA 5F1LA 4UYGA 5EWWA 4LZRA 4ZW1A 4CUSA 4OGIA 2YQDA 5HRVA 4YYKA 5F61A 3SVHA 5F60A 5D24A 4CURA 4FLPA 4KV1A 4XUAA 5KHMA 5BT3A 5COIA 4J3IA 4QEWA 5FE1A 4O7EA 5LJ0A 4A9IA 4BW1A 4HXRA 4PS5A 2RFJA 3MQMA 4MEPA 5K29A 5FG4A 4A9MA 5HRXA 4DONA 5CQ5A 4MEQA 5CUCA 5EICA 4Z1QA 5I7YA 5L8UA 3ZYUA 4A9KA 4YATA 5CPEA 3S92A 5ETDA 5I40A 3LQJA 4KV4A 5CY9A 5DYUA 3O36A 4QC1A 4J1PA 5CQAA 3Q2EA 5LUUA 5IGKA 4XY8A 4NUDA 5DFDA 3D7CA 2F6NA 4N4GA 4LRGA 2MJVB 3U5MA 3SVFA 4NR7A 5F63A 5KTWA 5LVQA 4CUPA 5FE0A 4KCXA 3AQAA 3P5OA 1WUGA 4QYDA 4X2IA 3LXJA 5ENJA 3UV5A 5EM3A 4XYAA 5JWMA 5E73A 5EWCA 5FDZA 3ONIA 4QEUA 4YYHA 3O33A 5KTUA 2RNWA 3U5LA 5DYCA 4NR5A 2I7KA 5DFCA 3MB3A 4UIYA 5CGPA 5D26A 4QUUA 3DAIA 4YY4A 2FSAA 4NRBA 4QB3A 3GG3A 4XUBA 3I3JA 1X0JA 4WHUA 3P1DA 5HCLA 4Z6HA 3U5KA 4YYJA 4UYFA 4TU6A 5E0RA 5DW2A 4LC2A 5CUAA 5EPBA 5FBXA 5CS8A 5IG6A 5FE5A 3NXBA 4Z1SA 2L84A 4CLBA 4YBMA 2DKWA 5DLZA 3U5NA 4HXOA 5IGLA 4TZ2A 5A5RA 5G4RA 5EPSA 5DX4A 5CQ6A 4NYVA 5D3TA 4BW4A 5A5QA 5DKDA 2WP2A 5C8GA 4CFLA 5JI8A 1JM4B 4CUUA 4O72A 4GPJA 4UIXA 4TZ8A 2E3KA 4LDFA 4QSUA 4A9FA 2DVRA 5EGUA 5E3DA 5F62A 4A9HA 2L5EA 4OGJA 4Z6IA 5LKZA 3TLPA 4CUTA 4YYIA 5EWHA 4UIWA 3P1EA 5EWVA 3UVXA 2R0YA 4HBYA 3QZTA 5E9KA 2YYNA 4HXNA 2H60A 5FH6A 4UYDA 2NXBA 4NQMA 4A9OA 5IGMA 3MUKA 3P1CA 5AMFA 1E6IA 5LKTA 3G0JA 1N72A 5L98A 4O70A 5ENGA 5IGNA 3UV2A 4O76A 5FE9A 5E9VA 4NQNA 4YY6A 4IR6A 3UVDA 5LJ2A 4BJXA 4A9LA 5LKXA 5D3PA 5CP5A 5D7XA 5E74A 4QSTA 4F3IA 5E7DA 5L97A 4YABA 3SVGA 4Z93A 2YDWA 4LYWA 2KTBB 5EA1A 5C4QA 3G0LA 5I83A 4O7FA 4AKNA 5C85A 4TS8A 5EPRA 4MR4A 4WIVA 5HFQA 5D3NA 4QSVA 3MB4A 4YYMA 4E96A 5A5SA 5HEMA 4UYHA 5CUEA 5A85A 2DVQA 4TQNA 5CQ8A 4ZQLA 3S91A 4HXMA 4N4HA 4BHWA 2R0SA 5F36A 4NR8A 5EI4A 5CQ7A 4LR6A 5II1A 5ENEA 2F6JA 5FE6A 5BT4A 4RVRA 2E7OA 5C87A 2RNXA 3JVKA 4J0RA 4OUFA 5LVRA 5D0CA 3O35A 5D3RA 5L96A 5A7CA 2R10A 5D3HA 2E7NA 5HELA 5L99A 4QSPA 5I1QA 5DYAA 4LYSA 5C89A 3IU6A 4TT4A 4O71A 2OSSA 4HXKA 4ALHA 5IIDA 4IOOA 4O7CA 3UW9A 5TB6A 2D82A 4HXSA 5HRWA 5EU1A 5FH7A 2RI7A 4HXLA 5DBMA 5F3AA 2R0VA 5D3JA 5FE2A 3UVYA 4PKLA 5FFYA 5IBNA 4O78A 4PY6A 5F5ZA 4QR3A 3LQHA 3HMHA 5CRZA 4YYGA 5A5OA 4O74A 5CFWA 4Y03A 4QSXA 4QC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBV A;  5BT5 A;  5KU3 A;  5CUG A;  4QBM A;  4YBS A;  3U5P A;  4YH3 A;  5A81 A;  4BW3 A;  4MR5 A;  5CUD A;  5E9M A;  3FKM X;  5A82 A;  4NS5 A;  5D3L A;  4IR4 A;  4O77 A;  5FG6 A;  5CRM A;  5HEN A;  2OUO A;  2DVS A;  5EP7 A;  5FE4 A;  5ETB A;  5CTL A;  3K2J A;  5FE7 A;  4QR5 A;  3UV4 A;  1EQF A;  5A83 A;  5CUB A;  5D3S A;  5I88 A;  5DFB A;  5I80 A;  5FFW A;  4O7A A;  4QR4 A;  4QEV A;  4MR3 A;  2GRC A;  4Q0N A;  4C66 A;  2YEM A;  4YH4 A;  2OO1 A;  5EK9 A;  5TCM A;  4N4I A;  5ENC A;  5CQT A;  4A9E A;  3P1F A;  4NR4 A;  3UVW A;  4YK0 A;  3MXF A;  4IOR A;  5ENF A;  5D25 A;  4ALG A;  5HJC A;  5G4S A;  4TT6 A;  5AME A;  5FG5 A;  5FB1 A;  5HQ6 A;  4QSS A;  5H1U A;  4QYL A;  4QY4 A;  4UIZ A;  5CQ4 A;  5AD2 A;  4TT2 A;  4N4F A;  5E3G A;  5II2 A;  2I8N A;  5I29 A;  2YEK A;  5ACY A;  4ZC9 A;  5KTX A;  4HBX A;  4N3W A;  5I86 A;  4NR6 A;  5E9Y A;  4IOQ A;  5HQ7 A;  5LJ1 A;  5H1T A;  3IU5 A;  4UYE A;  3AAD A;  5E9L A;  2DWW A;  4IR5 A;  5DLX A;  2G4A A;  4CUQ A;  3HMF A;  4LZS A;  5HQ5 A;  4A9N A;  4PCE A;  5AD3 A;  5CZG A;  3JVJ A;  5EV9 A;  5LKU A;  4QSQ A;  1JSP B;  5DW1 A;  4NRC A;  5A5P A;  4UIT A;  2N9G A;  4UYF B;  3JVM A;  4TU4 A;  5HFR A;  3Q2F A;  4Q0O A;  2L85 A;  4NUE A;  5FH8 A;  1ZS5 A;  4HBW A;  5L8T A;  5EWD A;  5FFV A;  5ENB A;  5DY7 A;  5HM0 A;  4J0S A;  5H85 A;  1F68 A;  3MUL A;  5H1V A;  5F1H A;  4PCI A;  4UIU A;  3RCW A;  4NRA A;  4TYL A;  2WP1 A;  5CQ3 A;  3LJW A;  4YBT A;  5EQ1 A;  4O75 A;  4QSW A;  5I89 A;  4YYN A;  2YEL A;  4LYI A;  2DVV A;  5F2P A;  2RO1 A;  5F25 A;  4PTB A;  3U5O A;  4NYW A;  4WHW A;  4C67 A;  5FE8 A;  3LQI A;  4MEN A;  4YAD A;  5DYX A;  3JVL A;  1WUM A;  4QSR A;  2RS9 B;  4YAX A;  5ENI A;  4YYD A;  4NXJ A;  4LZ2 A;  5EIS A;  4CL9 A;  5HLS A;  4O7B A;  3QZS A;  5FE3 A;  2RNY A;  4YC9 A;  5DKC A;  2YW5 A;  3HME A;  4BW2 A;  4CFK A;  3O37 A;  3O34 A;  5I7X A;  5KO4 A;  5CU8 A;  5FB0 A;  4QNS A;  3DWY A;  4MR6 A;  5EVA A;  3U5J A;  5C7N A;  4NUC A;  5J0D A;  4HXP A;  4QUT A;  5ENH A;  4UIV A;  4QZS A;  4A9J A;  5DKH A;  4IR3 A;  4XY9 A;  2DAT A;  2LSP B;  4NYX A;  4TTE A;  4MEO A;  3QZV A;  2D9E A;  4NR9 A;  5E9I A;  5A5N A;  5F1L A;  4UYG A;  5EWW A;  4LZR A;  4ZW1 A;  4CUS A;  4OGI A;  2YQD A;  5HRV A;  4YYK A;  5F61 A;  3SVH A;  5F60 A;  5D24 A;  4CUR A;  4FLP A;  4KV1 A;  4XUA A;  5KHM A;  5BT3 A;  5COI A;  4J3I A;  4QEW A;  5FE1 A;  4O7E A;  5LJ0 A;  4A9I A;  4BW1 A;  4HXR A;  4PS5 A;  2RFJ A;  3MQM A;  4MEP A;  5K29 A;  5FG4 A;  4A9M A;  5HRX A;  4DON A;  5CQ5 A;  4MEQ A;  5CUC A;  5EIC A;  4Z1Q A;  5I7Y A;  5L8U A;  3ZYU A;  4A9K A;  4YAT A;  5CPE A;  3S92 A;  5ETD A;  5I40 A;  3LQJ A;  4KV4 A;  5CY9 A;  5DYU A;  3O36 A;  4QC1 A;  4J1P A;  5CQA A;  3Q2E A;  5LUU A;  5IGK A;  4XY8 A;  4NUD A;  5DFD A;  3D7C A;  2F6N A;  4N4G A;  4LRG A;  2MJV B;  3U5M A;  3SVF A;  4NR7 A;  5F63 A;  5KTW A;  5LVQ A;  4CUP A;  5FE0 A;  4KCX A;  3AQA A;  3P5O A;  1WUG A;  4QYD A;  4X2I A;  3LXJ A;  5ENJ A;  3UV5 A;  5EM3 A;  4XYA A;  5JWM A;  5E73 A;  5EWC A;  5FDZ A;  3ONI A;  4QEU A;  4YYH A;  3O33 A;  5KTU A;  2RNW A;  3U5L A;  5DYC A;  4NR5 A;  2I7K A;  5DFC A;  3MB3 A;  4UIY A;  5CGP A;  5D26 A;  4QUU A;  3DAI A;  4YY4 A;  2FSA A;  4NRB A;  4QB3 A;  3GG3 A;  4XUB A;  3I3J A;  1X0J A;  4WHU A;  3P1D A;  5HCL A;  4Z6H A;  3U5K A;  4YYJ A;  4UYF A;  4TU6 A;  5E0R A;  5DW2 A;  4LC2 A;  5CUA A;  5EPB A;  5FBX A;  5CS8 A;  5IG6 A;  5FE5 A;  3NXB A;  4Z1S A;  2L84 A;  4CLB A;  4YBM A;  2DKW A;  5DLZ A;  3U5N A;  4HXO A;  5IGL A;  4TZ2 A;  5A5R A;  5G4R A;  5EPS A;  5DX4 A;  5CQ6 A;  4NYV A;  5D3T A;  4BW4 A;  5A5Q A;  5DKD A;  2WP2 A;  5C8G A;  4CFL A;  5JI8 A;  1JM4 B;  4CUU A;  4O72 A;  4GPJ A;  4UIX A;  4TZ8 A;  2E3K A;  4LDF A;  4QSU A;  4A9F A;  2DVR A;  5EGU A;  5E3D A;  5F62 A;  4A9H A;  2L5E A;  4OGJ A;  4Z6I A;  5LKZ A;  3TLP A;  4CUT A;  4YYI A;  5EWH A;  4UIW A;  3P1E A;  5EWV A;  3UVX A;  2R0Y A;  4HBY A;  3QZT A;  5E9K A;  2YYN A;  4HXN A;  2H60 A;  5FH6 A;  4UYD A;  2NXB A;  4NQM A;  4A9O A;  5IGM A;  3MUK A;  3P1C A;  5AMF A;  1E6I A;  5LKT A;  3G0J A;  1N72 A;  5L98 A;  4O70 A;  5ENG A;  5IGN A;  3UV2 A;  4O76 A;  5FE9 A;  5E9V A;  4NQN A;  4YY6 A;  4IR6 A;  3UVD A;  5LJ2 A;  4BJX A;  4A9L A;  5LKX A;  5D3P A;  5CP5 A;  5D7X A;  5E74 A;  4QST A;  4F3I A;  5E7D A;  5L97 A;  4YAB A;  3SVG A;  4Z93 A;  2YDW A;  4LYW A;  2KTB B;  5EA1 A;  5C4Q A;  3G0L A;  5I83 A;  4O7F A;  4AKN A;  5C85 A;  4TS8 A;  5EPR A;  4MR4 A;  4WIV A;  5HFQ A;  5D3N A;  4QSV A;  3MB4 A;  4YYM A;  4E96 A;  5A5S A;  5HEM A;  4UYH A;  5CUE A;  5A85 A;  2DVQ A;  4TQN A;  5CQ8 A;  4ZQL A;  3S91 A;  4HXM A;  4N4H A;  4BHW A;  2R0S A;  5F36 A;  4NR8 A;  5EI4 A;  5CQ7 A;  4LR6 A;  5II1 A;  5ENE A;  2F6J A;  5FE6 A;  5BT4 A;  4RVR A;  2E7O A;  5C87 A;  2RNX A;  3JVK A;  4J0R A;  4OUF A;  5LVR A;  5D0C A;  3O35 A;  5D3R A;  5L96 A;  5A7C A;  2R10 A;  5D3H A;  2E7N A;  5HEL A;  5L99 A;  4QSP A;  5I1Q A;  5DYA A;  4LYS A;  5C89 A;  3IU6 A;  4TT4 A;  4O71 A;  2OSS A;  4HXK A;  4ALH A;  5IID A;  4IOO A;  4O7C A;  3UW9 A;  5TB6 A;  2D82 A;  4HXS A;  5HRW A;  5EU1 A;  5FH7 A;  2RI7 A;  4HXL A;  5DBM A;  5F3A A;  2R0V A;  5D3J A;  5FE2 A;  3UVY A;  4PKL A;  5FFY A;  5IBN A;  4O78 A;  4PY6 A;  5F5Z A;  4QR3 A;  3LQH A;  3HMH A;  5CRZ A;  4YYG A;  5A5O A;  4O74 A;  5CFW A;  4Y03 A;  4QSX A;  4QC3 A; 
#chains in the Genus database with same CATH topology
 4HBV A;  5BT5 A;  5KU3 A;  5CUG A;  4QBM A;  4YBS A;  3U5P A;  4YH3 A;  5A81 A;  4BW3 A;  4MR5 A;  5CUD A;  5E9M A;  3FKM X;  5A82 A;  4NS5 A;  5D3L A;  4IR4 A;  4O77 A;  5FG6 A;  5CRM A;  5HEN A;  2OUO A;  2DVS A;  5EP7 A;  5FE4 A;  5ETB A;  5CTL A;  3K2J A;  5FE7 A;  4QR5 A;  3UV4 A;  1EQF A;  5A83 A;  5CUB A;  5D3S A;  5I88 A;  5DFB A;  5I80 A;  5FFW A;  4O7A A;  4QR4 A;  4QEV A;  4MR3 A;  2GRC A;  4Q0N A;  4C66 A;  2YEM A;  4YH4 A;  2OO1 A;  5EK9 A;  5TCM A;  4N4I A;  5ENC A;  5CQT A;  4A9E A;  3P1F A;  4NR4 A;  3UVW A;  4YK0 A;  3MXF A;  4IOR A;  5ENF A;  5D25 A;  4ALG A;  5HJC A;  5G4S A;  4TT6 A;  5AME A;  5FG5 A;  5FB1 A;  5HQ6 A;  4QSS A;  5H1U A;  4QYL A;  4QY4 A;  4UIZ A;  5CQ4 A;  5AD2 A;  4TT2 A;  4N4F A;  5E3G A;  5II2 A;  2I8N A;  5I29 A;  4AKI A;  2YEK A;  5ACY A;  4ZC9 A;  5KTX A;  4HBX A;  4N3W A;  5I86 A;  4NR6 A;  5E9Y A;  4IOQ A;  5HQ7 A;  5LJ1 A;  5H1T A;  3IU5 A;  4UYE A;  3AAD A;  5E9L A;  2DWW A;  4IR5 A;  5DLX A;  2G4A A;  3D1D A;  4CUQ A;  3HMF A;  4LZS A;  5HQ5 A;  4A9N A;  4PCE A;  5AD3 A;  5CZG A;  3JVJ A;  5EV9 A;  5LKU A;  4QSQ A;  3VKH A;  1JSP B;  5DW1 A;  4NRC A;  5A5P A;  4UIT A;  2N9G A;  4UYF B;  3JVM A;  4TU4 A;  5HFR A;  3Q2F A;  4Q0O A;  2L85 A;  4NUE A;  5FH8 A;  1ZS5 A;  4HBW A;  5L8T A;  5EWD A;  5FFV A;  5ENB A;  5DY7 A;  5HM0 A;  4J0S A;  5H85 A;  2EJN A;  1F68 A;  3MUL A;  5H1V A;  5F1H A;  4PCI A;  4UIU A;  3RCW A;  4NRA A;  4TYL A;  2WP1 A;  5CQ3 A;  3LJW A;  4YBT A;  5EQ1 A;  4O75 A;  4QSW A;  5I89 A;  4YYN A;  2YEL A;  4LYI A;  2DVV A;  5F2P A;  2RO1 A;  5F25 A;  4PTB A;  3U5O A;  4NYW A;  4WHW A;  4C67 A;  5FE8 A;  3LQI A;  4MEN A;  4YAD A;  5DYX A;  3JVL A;  1WUM A;  4QSR A;  2RS9 B;  4YAX A;  5ENI A;  4YYD A;  4NXJ A;  4LZ2 A;  5EIS A;  4CL9 A;  3VKG A;  5HLS A;  4O7B A;  3QZS A;  5FE3 A;  2RNY A;  4YC9 A;  5DKC A;  3ERR A;  2YW5 A;  3HME A;  4BW2 A;  4CFK A;  3O37 A;  3O34 A;  1PUO A;  5I7X A;  5KO4 A;  5CU8 A;  5FB0 A;  4QNS A;  3DWY A;  4MR6 A;  5EVA A;  3U5J A;  5C7N A;  4NUC A;  5J0D A;  4HXP A;  4QUT A;  5ENH A;  4UIV A;  4QZS A;  4A9J A;  5DKH A;  4IR3 A;  4XY9 A;  2DAT A;  2LSP B;  4NYX A;  4TTE A;  4MEO A;  3QZV A;  2D9E A;  4NR9 A;  5E9I A;  5A5N A;  5F1L A;  4UYG A;  5EWW A;  4LZR A;  4ZW1 A;  4CUS A;  4OGI A;  2YQD A;  5HRV A;  4YYK A;  5F61 A;  3SVH A;  5F60 A;  5D24 A;  4CUR A;  4FLP A;  4KV1 A;  4XUA A;  5KHM A;  5BT3 A;  5COI A;  4J3I A;  4QEW A;  5FE1 A;  4O7E A;  5LJ0 A;  4A9I A;  4BW1 A;  4HXR A;  4PS5 A;  2RFJ A;  3MQM A;  4MEP A;  5K29 A;  5FG4 A;  4A9M A;  5HRX A;  4DON A;  5CQ5 A;  4MEQ A;  5CUC A;  5EIC A;  4Z1Q A;  5I7Y A;  5L8U A;  3ZYU A;  4A9K A;  4YAT A;  5CPE A;  3S92 A;  5ETD A;  5I40 A;  3LQJ A;  4KV4 A;  5CY9 A;  5DYU A;  3O36 A;  4QC1 A;  4J1P A;  5CQA A;  3Q2E A;  5LUU A;  1ZKR A;  5IGK A;  4XY8 A;  4NUD A;  5DFD A;  3D7C A;  2F6N A;  4N4G A;  4LRG A;  2MJV B;  3U5M A;  3SVF A;  4NR7 A;  5F63 A;  5KTW A;  5LVQ A;  4CUP A;  5FE0 A;  4KCX A;  3AQA A;  3P5O A;  1WUG A;  4QYD A;  4X2I A;  3LXJ A;  5ENJ A;  3UV5 A;  5EM3 A;  4XYA A;  5JWM A;  5E73 A;  5EWC A;  5FDZ A;  3ONI A;  4QEU A;  4YYH A;  3O33 A;  5KTU A;  2RNW A;  3U5L A;  5DYC A;  4NR5 A;  2I7K A;  5DFC A;  3MB3 A;  4UIY A;  5CGP A;  5D26 A;  4QUU A;  3DAI A;  4YY4 A;  2FSA A;  4NRB A;  4QB3 A;  3GG3 A;  4XUB A;  3I3J A;  1X0J A;  4WHU A;  3P1D A;  5HCL A;  4Z6H A;  3U5K A;  4YYJ A;  4UYF A;  4TU6 A;  5E0R A;  5DW2 A;  4LC2 A;  5CUA A;  5EPB A;  5FBX A;  5CS8 A;  5IG6 A;  5FE5 A;  3NXB A;  4Z1S A;  2L84 A;  4CLB A;  4YBM A;  2DKW A;  5DLZ A;  3U5N A;  4HXO A;  5IGL A;  4TZ2 A;  5A5R A;  5G4R A;  5EPS A;  5DX4 A;  5CQ6 A;  4NYV A;  5D3T A;  4BW4 A;  5A5Q A;  5DKD A;  2WP2 A;  5C8G A;  4CFL A;  5JI8 A;  1JM4 B;  4CUU A;  4O72 A;  4GPJ A;  4UIX A;  4TZ8 A;  2E3K A;  4LDF A;  4QSU A;  4A9F A;  2DVR A;  5EGU A;  5E3D A;  5F62 A;  4A9H A;  2L5E A;  4OGJ A;  4Z6I A;  5LKZ A;  3TLP A;  4CUT A;  4YYI A;  5EWH A;  4UIW A;  3P1E A;  5EWV A;  3UVX A;  2R0Y A;  4HBY A;  3QZT A;  5E9K A;  2YYN A;  4HXN A;  2H60 A;  5FH6 A;  4UYD A;  2NXB A;  4NQM A;  4A9O A;  5IGM A;  3MUK A;  3P1C A;  5AMF A;  1E6I A;  5LKT A;  3G0J A;  1N72 A;  5L98 A;  4O70 A;  5ENG A;  5IGN A;  3UV2 A;  4O76 A;  5FE9 A;  5E9V A;  4NQN A;  4YY6 A;  4IR6 A;  3UVD A;  5LJ2 A;  4BJX A;  4A9L A;  4AI6 A;  5LKX A;  5D3P A;  5CP5 A;  5D7X A;  5E74 A;  4QST A;  4F3I A;  5E7D A;  5L97 A;  4YAB A;  3SVG A;  4Z93 A;  2YDW A;  4LYW A;  2KTB B;  5EA1 A;  5C4Q A;  3G0L A;  5I83 A;  4O7F A;  4AKN A;  5C85 A;  4TS8 A;  5EPR A;  4MR4 A;  4WIV A;  5HFQ A;  5D3N A;  4QSV A;  3MB4 A;  4YYM A;  4E96 A;  5A5S A;  5HEM A;  4UYH A;  5CUE A;  5A85 A;  2DVQ A;  4TQN A;  5CQ8 A;  4ZQL A;  3S91 A;  4HXM A;  4N4H A;  4BHW A;  4AKG A;  2R0S A;  5F36 A;  4NR8 A;  5EI4 A;  5CQ7 A;  4LR6 A;  5II1 A;  5ENE A;  2F6J A;  5FE6 A;  5BT4 A;  4RVR A;  2E7O A;  5C87 A;  2RNX A;  3JVK A;  4J0R A;  4OUF A;  5LVR A;  5D0C A;  3O35 A;  5D3R A;  5L96 A;  5A7C A;  2R10 A;  5D3H A;  2E7N A;  5HEL A;  5L99 A;  4QSP A;  5I1Q A;  5DYA A;  4LYS A;  5C89 A;  3IU6 A;  4TT4 A;  4O71 A;  2OSS A;  4HXK A;  4ALH A;  5IID A;  4IOO A;  4O7C A;  3UW9 A;  5TB6 A;  2D82 A;  4HXS A;  5HRW A;  5EU1 A;  5FH7 A;  2RI7 A;  4HXL A;  3D1B A;  5DBM A;  5F3A A;  4AKH A;  2R0V A;  5D3J A;  5FE2 A;  3UVY A;  4PKL A;  5FFY A;  5IBN A;  4O78 A;  4PY6 A;  5F5Z A;  4QR3 A;  3LQH A;  3HMH A;  5CRZ A;  4YYG A;  5A5O A;  4O74 A;  5CFW A;  4Y03 A;  4QSX A;  4QC3 A; 
#chains in the Genus database with same CATH homology
 4HBV A;  5BT5 A;  5KU3 A;  5CUG A;  4QBM A;  4YBS A;  3U5P A;  4YH3 A;  5A81 A;  4BW3 A;  4MR5 A;  5CUD A;  5E9M A;  3FKM X;  5A82 A;  4NS5 A;  5D3L A;  4IR4 A;  4O77 A;  5FG6 A;  5CRM A;  5HEN A;  2OUO A;  2DVS A;  5EP7 A;  5FE4 A;  5ETB A;  5CTL A;  3K2J A;  5FE7 A;  4QR5 A;  3UV4 A;  1EQF A;  5A83 A;  5CUB A;  5D3S A;  5I88 A;  5DFB A;  5I80 A;  5FFW A;  4O7A A;  4QR4 A;  4QEV A;  4MR3 A;  2GRC A;  4Q0N A;  4C66 A;  2YEM A;  4YH4 A;  2OO1 A;  5EK9 A;  5TCM A;  4N4I A;  5ENC A;  5CQT A;  4A9E A;  3P1F A;  4NR4 A;  3UVW A;  4YK0 A;  3MXF A;  4IOR A;  5ENF A;  5D25 A;  4ALG A;  5HJC A;  5G4S A;  4TT6 A;  5AME A;  5FG5 A;  5FB1 A;  5HQ6 A;  4QSS A;  5H1U A;  4QYL A;  4QY4 A;  4UIZ A;  5CQ4 A;  5AD2 A;  4TT2 A;  4N4F A;  5E3G A;  5II2 A;  2I8N A;  5I29 A;  2YEK A;  5ACY A;  4ZC9 A;  5KTX A;  4HBX A;  4N3W A;  5I86 A;  4NR6 A;  5E9Y A;  4IOQ A;  5HQ7 A;  5LJ1 A;  5H1T A;  3IU5 A;  4UYE A;  3AAD A;  5E9L A;  2DWW A;  4IR5 A;  5DLX A;  2G4A A;  4CUQ A;  3HMF A;  4LZS A;  5HQ5 A;  4A9N A;  4PCE A;  5AD3 A;  5CZG A;  3JVJ A;  5EV9 A;  5LKU A;  4QSQ A;  1JSP B;  5DW1 A;  4NRC A;  5A5P A;  4UIT A;  2N9G A;  4UYF B;  3JVM A;  4TU4 A;  5HFR A;  3Q2F A;  4Q0O A;  2L85 A;  4NUE A;  5FH8 A;  1ZS5 A;  4HBW A;  5L8T A;  5EWD A;  5FFV A;  5ENB A;  5DY7 A;  5HM0 A;  4J0S A;  5H85 A;  1F68 A;  3MUL A;  5H1V A;  5F1H A;  4PCI A;  4UIU A;  3RCW A;  4NRA A;  4TYL A;  2WP1 A;  5CQ3 A;  3LJW A;  4YBT A;  5EQ1 A;  4O75 A;  4QSW A;  5I89 A;  4YYN A;  2YEL A;  4LYI A;  2DVV A;  5F2P A;  2RO1 A;  5F25 A;  4PTB A;  3U5O A;  4NYW A;  4WHW A;  4C67 A;  5FE8 A;  3LQI A;  4MEN A;  4YAD A;  5DYX A;  3JVL A;  1WUM A;  4QSR A;  2RS9 B;  4YAX A;  5ENI A;  4YYD A;  4NXJ A;  4LZ2 A;  5EIS A;  4CL9 A;  5HLS A;  4O7B A;  3QZS A;  5FE3 A;  2RNY A;  4YC9 A;  5DKC A;  2YW5 A;  3HME A;  4BW2 A;  4CFK A;  3O37 A;  3O34 A;  5I7X A;  5KO4 A;  5CU8 A;  5FB0 A;  4QNS A;  3DWY A;  4MR6 A;  5EVA A;  3U5J A;  5C7N A;  4NUC A;  5J0D A;  4HXP A;  4QUT A;  5ENH A;  4UIV A;  4QZS A;  4A9J A;  5DKH A;  4IR3 A;  4XY9 A;  2DAT A;  2LSP B;  4NYX A;  4TTE A;  4MEO A;  3QZV A;  2D9E A;  4NR9 A;  5E9I A;  5A5N A;  5F1L A;  4UYG A;  5EWW A;  4LZR A;  4ZW1 A;  4CUS A;  4OGI A;  2YQD A;  5HRV A;  4YYK A;  5F61 A;  3SVH A;  5F60 A;  5D24 A;  4CUR A;  4FLP A;  4KV1 A;  4XUA A;  5KHM A;  5BT3 A;  5COI A;  4J3I A;  4QEW A;  5FE1 A;  4O7E A;  5LJ0 A;  4A9I A;  4BW1 A;  4HXR A;  4PS5 A;  2RFJ A;  3MQM A;  4MEP A;  5K29 A;  5FG4 A;  4A9M A;  5HRX A;  4DON A;  5CQ5 A;  4MEQ A;  5CUC A;  5EIC A;  4Z1Q A;  5I7Y A;  5L8U A;  3ZYU A;  4A9K A;  4YAT A;  5CPE A;  3S92 A;  5ETD A;  5I40 A;  3LQJ A;  4KV4 A;  5CY9 A;  5DYU A;  3O36 A;  4QC1 A;  4J1P A;  5CQA A;  3Q2E A;  5LUU A;  5IGK A;  4XY8 A;  4NUD A;  5DFD A;  3D7C A;  2F6N A;  4N4G A;  4LRG A;  2MJV B;  3U5M A;  3SVF A;  4NR7 A;  5F63 A;  5KTW A;  5LVQ A;  4CUP A;  5FE0 A;  4KCX A;  3AQA A;  3P5O A;  1WUG A;  4QYD A;  4X2I A;  3LXJ A;  5ENJ A;  3UV5 A;  5EM3 A;  4XYA A;  5JWM A;  5E73 A;  5EWC A;  5FDZ A;  3ONI A;  4QEU A;  4YYH A;  3O33 A;  5KTU A;  2RNW A;  3U5L A;  5DYC A;  4NR5 A;  2I7K A;  5DFC A;  3MB3 A;  4UIY A;  5CGP A;  5D26 A;  4QUU A;  3DAI A;  4YY4 A;  2FSA A;  4NRB A;  4QB3 A;  3GG3 A;  4XUB A;  3I3J A;  1X0J A;  4WHU A;  3P1D A;  5HCL A;  4Z6H A;  3U5K A;  4YYJ A;  4UYF A;  4TU6 A;  5E0R A;  5DW2 A;  4LC2 A;  5CUA A;  5EPB A;  5FBX A;  5CS8 A;  5IG6 A;  5FE5 A;  3NXB A;  4Z1S A;  2L84 A;  4CLB A;  4YBM A;  2DKW A;  5DLZ A;  3U5N A;  4HXO A;  5IGL A;  4TZ2 A;  5A5R A;  5G4R A;  5EPS A;  5DX4 A;  5CQ6 A;  4NYV A;  5D3T A;  4BW4 A;  5A5Q A;  5DKD A;  2WP2 A;  5C8G A;  4CFL A;  5JI8 A;  1JM4 B;  4CUU A;  4O72 A;  4GPJ A;  4UIX A;  4TZ8 A;  2E3K A;  4LDF A;  4QSU A;  4A9F A;  2DVR A;  5EGU A;  5E3D A;  5F62 A;  4A9H A;  2L5E A;  4OGJ A;  4Z6I A;  5LKZ A;  3TLP A;  4CUT A;  4YYI A;  5EWH A;  4UIW A;  3P1E A;  5EWV A;  3UVX A;  2R0Y A;  4HBY A;  3QZT A;  5E9K A;  2YYN A;  4HXN A;  2H60 A;  5FH6 A;  4UYD A;  2NXB A;  4NQM A;  4A9O A;  5IGM A;  3MUK A;  3P1C A;  5AMF A;  1E6I A;  5LKT A;  3G0J A;  1N72 A;  5L98 A;  4O70 A;  5ENG A;  5IGN A;  3UV2 A;  4O76 A;  5FE9 A;  5E9V A;  4NQN A;  4YY6 A;  4IR6 A;  3UVD A;  5LJ2 A;  4BJX A;  4A9L A;  5LKX A;  5D3P A;  5CP5 A;  5D7X A;  5E74 A;  4QST A;  4F3I A;  5E7D A;  5L97 A;  4YAB A;  3SVG A;  4Z93 A;  2YDW A;  4LYW A;  2KTB B;  5EA1 A;  5C4Q A;  3G0L A;  5I83 A;  4O7F A;  4AKN A;  5C85 A;  4TS8 A;  5EPR A;  4MR4 A;  4WIV A;  5HFQ A;  5D3N A;  4QSV A;  3MB4 A;  4YYM A;  4E96 A;  5A5S A;  5HEM A;  4UYH A;  5CUE A;  5A85 A;  2DVQ A;  4TQN A;  5CQ8 A;  4ZQL A;  3S91 A;  4HXM A;  4N4H A;  4BHW A;  2R0S A;  5F36 A;  4NR8 A;  5EI4 A;  5CQ7 A;  4LR6 A;  5II1 A;  5ENE A;  2F6J A;  5FE6 A;  5BT4 A;  4RVR A;  2E7O A;  5C87 A;  2RNX A;  3JVK A;  4J0R A;  4OUF A;  5LVR A;  5D0C A;  3O35 A;  5D3R A;  5L96 A;  5A7C A;  2R10 A;  5D3H A;  2E7N A;  5HEL A;  5L99 A;  4QSP A;  5I1Q A;  5DYA A;  4LYS A;  5C89 A;  3IU6 A;  4TT4 A;  4O71 A;  2OSS A;  4HXK A;  4ALH A;  5IID A;  4IOO A;  4O7C A;  3UW9 A;  5TB6 A;  2D82 A;  4HXS A;  5HRW A;  5EU1 A;  5FH7 A;  2RI7 A;  4HXL A;  5DBM A;  5F3A A;  2R0V A;  5D3J A;  5FE2 A;  3UVY A;  4PKL A;  5FFY A;  5IBN A;  4O78 A;  4PY6 A;  5F5Z A;  4QR3 A;  3LQH A;  3HMH A;  5CRZ A;  4YYG A;  5A5O A;  4O74 A;  5CFW A;  4Y03 A;  4QSX A;  4QC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...