3QZTA

Crystal structure of bptf bromo in complex with histone h4k16ac - form ii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
LTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/nuclear protein
molecule keywords Nucleosome-remodeling factor subunit BPTF
publication title Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3qztA00
4TZ2A 5DW2A 5HM0A 4FLPA 3P5OA 5LKZA 5CP5A 1N72A 2WP1A 5E9VA 2DVVA 5ETDA 5JWMA 4PY6A 4YYNA 2DVSA 5HLSA 5ENIA 5DFCA 4A9HA 5EPRA 3IU5A 1WUGA 5CQ8A 3LXJA 5F2PA 5HRVA 4IOOA 4MR5A 5II1A 3SVGA 4YYHA 5FE8A 4QR5A 2RO1A 3P1FA 4NR4A 4UYHA 5A5RA 5FFYA 4CURA 5HQ7A 5LKXA 5FFVA 4O78A 5CPEA 5D26A 5KU3A 5HELA 5I1QA 2R0YA 5EVAA 5EWWA 5EWVA 5H85A 2YELA 4O70A 4C66A 4RVRA 5AD2A 3UVDA 3ZYUA 5I89A 5ETBA 4Z1SA 4UITA 5F61A 5A7CA 4Z6HA 4YAXA 5CS8A 4IR4A 4BHWA 4Y03A 4X2IA 4UIWA 5HRWA 4HBXA 5F62A 4F3IA 5EWHA 3UW9A 3Q2FA 3HMHA 4CL9A 5E9MA 5A5OA 4LZ2A 1X0JA 5FB0A 4O7BA 4NQNA 5I86A 5ENBA 5DW1A 2WP2A 5COIA 4YBTA 3U5NA 5DKCA 4O7FA 3UVYA 2L5EA 5DLZA 2OUOA 4CUPA 5HQ6A 4QSWA 3O34A 5CRMA 5E9YA 2YQDA 5DKDA 4QR3A 2YW5A 4QSPA 5D3RA 5LKUA 3O33A 5E9IA 2N9GA 4NR9A 4NQMA 5CUAA 4MENA 5C89A 2E3KA 4UIYA 5A5PA 3MB4A 5D3JA 5CQ7A 5A85A 5LVQA 5ENGA 3I3JA 4IR3A 2YEKA 4TS8A 5ENFA 4UYGA 5L8TA 3P1EA 2FSAA 1JSPB 3UV5A 4QEWA 5EICA 5F25A 4WHWA 5EPBA 5FE1A 5L98A 5FE6A 4A9EA 4LYSA 5L96A 4QSVA 2GRCA 4Q0OA 4MEQA 2R0SA 4N4GA 4XUAA 5A83A 5LJ1A 3MUKA 4QSRA 5FE4A 5CQ5A 2DVQA 5I83A 3AADA 3SVFA 5CUEA 5FH8A 5DFBA 4NYVA 5DFDA 5HJCA 5I7YA 4OGIA 3MQMA 5HFRA 4IOQA 4YYIA 3UV4A 3JVLA 4XYAA 3G0LA 5FG4A 5FE0A 4J3IA 5H1TA 5ACYA 5IIDA 4DONA 4O77A 4UYFA 5A82A 5IGLA 3NXBA 5FE3A 3UVWA 5LKTA 4ALGA 3LQHA 4O75A 5H1VA 5E7DA 3TLPA 4TT4A 2DATA 5DX4A 5DKHA 3U5KA 4O7AA 5DBMA 5E0RA 4PTBA 3U5JA 5EWCA 3LQIA 4MR6A 2F6JA 5CQAA 3AQAA 4NR5A 5C87A 5D24A 4LZSA 4XY9A 5D3LA 5CTLA 1JM4B 3SVHA 5FG6A 3QZSA 2L85A 4O76A 4LDFA 5FB1A 5CUCA 4A9IA 5EV9A 3ONIA 4YH3A 2YEMA 5KHMA 3G0JA 4J0RA 5II2A 5HFQA 5G4RA 4KV1A 5EK9A 3P1DA 4NS5A 5IBNA 4J1PA 4MR4A 5I7XA 5LJ0A 5FDZA 4A9KA 4ZW1A 3HMFA 5A5SA 4YC9A 2MJVB 5CUDA 3DWYA 4HXLA 4LZRA 5ENHA 3U5OA 4BW2A 2F6NA 3GG3A 4WIVA 5EQ1A 4CLBA 3MB3A 3QZVA 2LSPB 5CUBA 3UVXA 2E7NA 5A81A 4N4HA 5EPSA 5IGKA 2R10A 4YYGA 2DWWA 5FFWA 5LUUA 4HXOA 5DYUA 5I80A 4TZ8A 4HXNA 5F3AA 5I40A 4LC2A 4YYJA 4O72A 4UYDA 4LRGA 4MR3A 3S92A 4A9FA 2D9EA 5C4QA 5BT4A 4IR5A 3U5PA 5ENCA 4CUTA 5HRXA 5DLXA 5G4SA 5E74A 4QSXA 5FG5A 4UIZA 5IG6A 5CQ4A 4UIUA 5C85A 4YY4A 5FE9A 5EU1A 4YYDA 5E73A 4HXPA 2OO1A 5D3PA 3O37A 4NYXA 5HENA 5HCLA 5CUGA 4C67A 4CUUA 5K29A 4IORA 5F1HA 5I29A 4LYIA 1ZS5A 4ZQLA 4TTEA 4NYWA 4YK0A 3HMEA 4KV4A 4OUFA 4BW1A 4GPJA 4IR6A 2H60A 2E7OA 4QB3A 5J0DA 4Z1QA 5EA1A 4QNSA 5EI4A 3O36A 5FH6A 4CUQA 4YATA 4N3WA 5FH7A 2L84A 4NRCA 4YBMA 2I8NA 2OSSA 3JVMA 5KTWA 5CRZA 3P1CA 5E9KA 5FBXA 4ZC9A 4O7EA 5BT5A 4QY4A 3RCWA 5CQTA 5CU8A 5JI8A 4QC1A 4YYKA 5DYXA 4MEPA 4NR7A 4HBWA 4HXRA 4QSTA 4A9OA 4LR6A 4UYEA 3D7CA 5D0CA 4TT2A 5L97A 5D3HA 4CFLA 4TT6A 4QEUA 5IGNA 2I7KA 4YABA 4A9LA 4PCEA 4OGJA 4QSQA 4O71A 2DVRA 4CUSA 4O74A 5CGPA 4XY8A 4NUEA 3DAIA 5D25A 5E3DA 5TB6A 4HBYA 4A9MA 4NUCA 4PCIA 5L99A 4QR4A 4CFKA 5D3TA 5IGMA 5LJ2A 4NXJA 4UIVA 5F60A 2D82A 5EWDA 4PS5A 5H1UA 4KCXA 3FKMX 5F5ZA 5CZGA 5LVRA 5CFWA 5D3SA 4YYMA 4Z93A 5DYCA 4AKNA 4YADA 5A5QA 4PKLA 1EQFA 3LJWA 4ALHA 3MULA 2YDWA 5HEMA 4NRBA 3UV2A 2RNXA 5EISA 3O35A 5CQ3A 3U5MA 3MXFA 5FE7A 4A9JA 5C7NA 5A5NA 5HQ5A 4UYFB 4BW3A 4QEVA 5DY7A 3LQJA 4QSUA 4Q0NA 5ENJA 2RS9B 2R0VA 4QBMA 5F1LA 4NR8A 4WHUA 4N4FA 5FE2A 3Q2EA 5EGUA 3JVKA 5KTXA 2NXBA 4TU4A 4TYLA 4YH4A 5KO4A 5E9LA 1F68A 5L8UA 4LYWA 5AMEA 2RNWA 4TU6A 4MEOA 3JVJA 4UIXA 4QSSA 4A9NA 4QYLA 5DYAA 4J0SA 1WUMA 5CY9A 3U5LA 5ENEA 5EP7A 4HXMA 4QYDA 5C8GA 4O7CA 2RNYA 5AMFA 4QUTA 5AD3A 5D3NA 2KTBB 4N4IA 3IU6A 2RI7A 5D7XA 4QUUA 2DKWA 5KTUA 4QZSA 4E96A 3S91A 5TCMA 1E6IA 3QZTA 4YY6A 4XUBA 4Z6IA 5EM3A 4TQNA 2YYNA 3K2JA 4HXSA 4NR6A 5E3GA 4QC3A 5F36A 4HBVA 5CQ6A 5I88A 4NUDA 5F63A 4NRAA 5FE5A 5BT3A 2G4AA 4BJXA 4BW4A 4YBSA 4HXKA 2RFJA
chains in the Genus database with same CATH superfamily
4TZ2A 5DW2A 5HM0A 4FLPA 3P5OA 5LKZA 5CP5A 1N72A 2WP1A 5E9VA 2DVVA 5ETDA 5JWMA 4PY6A 4YYNA 2DVSA 5HLSA 5ENIA 5DFCA 4A9HA 5EPRA 3IU5A 1WUGA 5CQ8A 3LXJA 5F2PA 5HRVA 4AKGA 4IOOA 4MR5A 5II1A 3SVGA 4YYHA 5FE8A 4QR5A 2RO1A 3P1FA 4NR4A 4UYHA 5A5RA 5FFYA 4CURA 5HQ7A 5LKXA 5FFVA 4O78A 5CPEA 5D26A 5KU3A 5HELA 5I1QA 2R0YA 5EVAA 5EWWA 5EWVA 5H85A 2YELA 4O70A 4C66A 4RVRA 5AD2A 3UVDA 3ZYUA 5I89A 5ETBA 4Z1SA 4UITA 5F61A 5A7CA 4Z6HA 4YAXA 5CS8A 4IR4A 4BHWA 4Y03A 4X2IA 4UIWA 5HRWA 4HBXA 5F62A 4F3IA 5EWHA 3UW9A 3Q2FA 3HMHA 4CL9A 5E9MA 5A5OA 4LZ2A 1X0JA 5FB0A 4O7BA 4NQNA 5I86A 5ENBA 5DW1A 2WP2A 5COIA 4YBTA 3U5NA 5DKCA 4O7FA 3UVYA 2L5EA 5DLZA 2OUOA 4CUPA 5HQ6A 4QSWA 3O34A 5CRMA 5E9YA 2YQDA 5DKDA 4QR3A 2YW5A 4QSPA 5D3RA 5LKUA 3O33A 5E9IA 2N9GA 4NR9A 4AKHA 4NQMA 5CUAA 4MENA 5C89A 2E3KA 4UIYA 5A5PA 3MB4A 5D3JA 5CQ7A 5A85A 5LVQA 5ENGA 3I3JA 4IR3A 2YEKA 4TS8A 1PUOA 5ENFA 4UYGA 5L8TA 3D1DA 3P1EA 2FSAA 1JSPB 3UV5A 4QEWA 5EICA 5F25A 4WHWA 5EPBA 5FE1A 5L98A 5FE6A 4A9EA 4LYSA 5L96A 4QSVA 2GRCA 4Q0OA 4MEQA 2R0SA 4N4GA 4XUAA 5A83A 5LJ1A 3MUKA 4QSRA 5FE4A 5CQ5A 2DVQA 5I83A 3AADA 3SVFA 5CUEA 5FH8A 5DFBA 4NYVA 5DFDA 5HJCA 5I7YA 4OGIA 3MQMA 5HFRA 4IOQA 4YYIA 3UV4A 3JVLA 4XYAA 3G0LA 5FG4A 5FE0A 4J3IA 5H1TA 5ACYA 5IIDA 4DONA 4O77A 4UYFA 5A82A 5IGLA 3NXBA 5FE3A 3UVWA 5LKTA 4ALGA 3LQHA 4O75A 5H1VA 5E7DA 3TLPA 4TT4A 2DATA 5DX4A 5DKHA 3U5KA 4O7AA 5DBMA 5E0RA 4PTBA 3U5JA 5EWCA 3LQIA 4MR6A 2F6JA 5CQAA 3AQAA 4NR5A 5C87A 5D24A 4LZSA 4XY9A 5D3LA 5CTLA 1JM4B 3SVHA 5FG6A 3QZSA 2EJNA 2L85A 4O76A 4LDFA 5FB1A 5CUCA 4A9IA 5EV9A 3VKHA 3ONIA 4YH3A 2YEMA 5KHMA 3G0JA 4J0RA 5II2A 5HFQA 5G4RA 4KV1A 5EK9A 3P1DA 4NS5A 5IBNA 4J1PA 4MR4A 5I7XA 5LJ0A 5FDZA 4A9KA 4ZW1A 3HMFA 5A5SA 4YC9A 2MJVB 5CUDA 3DWYA 4HXLA 4LZRA 5ENHA 3U5OA 4BW2A 2F6NA 3GG3A 4WIVA 5EQ1A 4CLBA 3MB3A 3QZVA 2LSPB 5CUBA 3UVXA 2E7NA 5A81A 4N4HA 5EPSA 5IGKA 2R10A 4YYGA 2DWWA 5FFWA 5LUUA 4HXOA 5DYUA 5I80A 4TZ8A 4HXNA 5F3AA 5I40A 4LC2A 4YYJA 4O72A 4UYDA 4LRGA 4MR3A 3S92A 4A9FA 2D9EA 5C4QA 5BT4A 4IR5A 3U5PA 5ENCA 4CUTA 5HRXA 5DLXA 5G4SA 5E74A 4QSXA 5FG5A 4UIZA 5IG6A 5CQ4A 4UIUA 5C85A 4YY4A 5FE9A 5EU1A 4YYDA 5E73A 4HXPA 2OO1A 5D3PA 3O37A 4NYXA 5HENA 5HCLA 5CUGA 4C67A 4CUUA 5K29A 4IORA 5F1HA 5I29A 4LYIA 1ZS5A 4ZQLA 4TTEA 4NYWA 4YK0A 3HMEA 4KV4A 4OUFA 4BW1A 4GPJA 4IR6A 2H60A 2E7OA 4QB3A 5J0DA 4Z1QA 5EA1A 4QNSA 5EI4A 3O36A 5FH6A 4CUQA 4YATA 4N3WA 5FH7A 2L84A 4NRCA 4YBMA 2I8NA 2OSSA 3JVMA 5KTWA 5CRZA 3P1CA 5E9KA 5FBXA 4ZC9A 4O7EA 5BT5A 4QY4A 3RCWA 5CQTA 5CU8A 5JI8A 4QC1A 4YYKA 5DYXA 4MEPA 4NR7A 4HBWA 4HXRA 4QSTA 4A9OA 4LR6A 4UYEA 3D7CA 5D0CA 4TT2A 5L97A 5D3HA 4CFLA 4TT6A 4QEUA 3D1BA 5IGNA 2I7KA 4YABA 4A9LA 3VKGA 4PCEA 4OGJA 4QSQA 4O71A 2DVRA 4CUSA 4O74A 5CGPA 4XY8A 4NUEA 3DAIA 5D25A 4AI6A 5E3DA 5TB6A 4HBYA 4A9MA 4NUCA 4PCIA 5L99A 4QR4A 4CFKA 5D3TA 5IGMA 5LJ2A 4NXJA 4UIVA 5F60A 2D82A 5EWDA 4PS5A 5H1UA 4KCXA 3FKMX 5F5ZA 5CZGA 5LVRA 5CFWA 5D3SA 4YYMA 4Z93A 5DYCA 4AKNA 4YADA 5A5QA 3ERRA 4PKLA 1EQFA 3LJWA 4ALHA 3MULA 2YDWA 5HEMA 4NRBA 3UV2A 2RNXA 5EISA 3O35A 5CQ3A 3U5MA 3MXFA 5FE7A 4A9JA 5C7NA 5A5NA 5HQ5A 4UYFB 4BW3A 4QEVA 5DY7A 3LQJA 4QSUA 4Q0NA 5ENJA 2RS9B 2R0VA 4QBMA 5F1LA 4NR8A 4WHUA 4N4FA 5FE2A 3Q2EA 5EGUA 3JVKA 5KTXA 2NXBA 4TU4A 4TYLA 4YH4A 5KO4A 5E9LA 1F68A 5L8UA 4LYWA 5AMEA 4AKIA 2RNWA 4TU6A 4MEOA 3JVJA 4UIXA 4QSSA 4A9NA 4QYLA 5DYAA 4J0SA 1WUMA 5CY9A 3U5LA 5ENEA 5EP7A 4HXMA 4QYDA 5C8GA 4O7CA 2RNYA 5AMFA 4QUTA 5AD3A 5D3NA 2KTBB 4N4IA 2RI7A 3IU6A 4QUUA 5D7XA 2DKWA 5KTUA 4QZSA 4E96A 3S91A 5TCMA 1E6IA 3QZTA 4YY6A 4XUBA 4Z6IA 5EM3A 4TQNA 2YYNA 3K2JA 4HXSA 4NR6A 5E3GA 1ZKRA 4QC3A 5F36A 4HBVA 5CQ6A 5I88A 4NUDA 5F63A 4NRAA 5FE5A 5BT3A 2G4AA 4BJXA 4BW4A 4YBSA 4HXKA 2RFJA
chains in the Genus database with same CATH topology
4TZ2A 5DW2A 5HM0A 4FLPA 3P5OA 5LKZA 5CP5A 1N72A 2WP1A 5E9VA 2DVVA 5ETDA 5JWMA 4PY6A 4YYNA 2DVSA 5HLSA 5ENIA 5DFCA 4A9HA 5EPRA 3IU5A 1WUGA 5CQ8A 3LXJA 5F2PA 5HRVA 4IOOA 4MR5A 5II1A 3SVGA 4YYHA 5FE8A 4QR5A 2RO1A 3P1FA 4NR4A 4UYHA 5A5RA 5FFYA 4CURA 5HQ7A 5LKXA 5FFVA 4O78A 5CPEA 5D26A 5KU3A 5HELA 5I1QA 2R0YA 5EVAA 5EWWA 5EWVA 5H85A 2YELA 4O70A 4C66A 4RVRA 5AD2A 3UVDA 3ZYUA 5I89A 5ETBA 4Z1SA 4UITA 5F61A 5A7CA 4Z6HA 4YAXA 5CS8A 4IR4A 4BHWA 4Y03A 4X2IA 4UIWA 5HRWA 4HBXA 5F62A 4F3IA 5EWHA 3UW9A 3Q2FA 3HMHA 4CL9A 5E9MA 5A5OA 4LZ2A 1X0JA 5FB0A 4O7BA 4NQNA 5I86A 5ENBA 5DW1A 2WP2A 5COIA 4YBTA 3U5NA 5DKCA 4O7FA 3UVYA 2L5EA 5DLZA 2OUOA 4CUPA 5HQ6A 4QSWA 3O34A 5CRMA 5E9YA 2YQDA 5DKDA 4QR3A 2YW5A 4QSPA 5D3RA 5LKUA 3O33A 5E9IA 2N9GA 4NR9A 4NQMA 5CUAA 4MENA 5C89A 2E3KA 4UIYA 5A5PA 3MB4A 5D3JA 5CQ7A 5A85A 5LVQA 5ENGA 3I3JA 4IR3A 2YEKA 4TS8A 5ENFA 4UYGA 5L8TA 3P1EA 2FSAA 1JSPB 3UV5A 4QEWA 5EICA 5F25A 4WHWA 5EPBA 5FE1A 5L98A 5FE6A 4A9EA 4LYSA 5L96A 4QSVA 2GRCA 4Q0OA 4MEQA 2R0SA 4N4GA 4XUAA 5A83A 5LJ1A 3MUKA 4QSRA 5FE4A 5CQ5A 2DVQA 5I83A 3AADA 3SVFA 5CUEA 5FH8A 5DFBA 4NYVA 5DFDA 5HJCA 5I7YA 4OGIA 3MQMA 5HFRA 4IOQA 4YYIA 3UV4A 3JVLA 4XYAA 3G0LA 5FG4A 5FE0A 4J3IA 5H1TA 5ACYA 5IIDA 4DONA 4O77A 4UYFA 5A82A 5IGLA 3NXBA 5FE3A 3UVWA 5LKTA 4ALGA 3LQHA 4O75A 5H1VA 5E7DA 3TLPA 4TT4A 2DATA 5DX4A 5DKHA 3U5KA 4O7AA 5DBMA 5E0RA 4PTBA 3U5JA 5EWCA 3LQIA 4MR6A 2F6JA 5CQAA 3AQAA 4NR5A 5C87A 5D24A 4LZSA 4XY9A 5D3LA 5CTLA 1JM4B 3SVHA 5FG6A 3QZSA 2L85A 4O76A 4LDFA 5FB1A 5CUCA 4A9IA 5EV9A 3ONIA 4YH3A 2YEMA 5KHMA 3G0JA 4J0RA 5II2A 5HFQA 5G4RA 4KV1A 5EK9A 3P1DA 4NS5A 5IBNA 4J1PA 4MR4A 5I7XA 5LJ0A 5FDZA 4A9KA 4ZW1A 3HMFA 5A5SA 4YC9A 2MJVB 5CUDA 3DWYA 4HXLA 4LZRA 5ENHA 3U5OA 4BW2A 2F6NA 3GG3A 4WIVA 5EQ1A 4CLBA 3MB3A 3QZVA 2LSPB 5CUBA 3UVXA 2E7NA 5A81A 4N4HA 5EPSA 5IGKA 2R10A 4YYGA 2DWWA 5FFWA 5LUUA 4HXOA 5DYUA 5I80A 4TZ8A 4HXNA 5F3AA 5I40A 4LC2A 4YYJA 4O72A 4UYDA 4LRGA 4MR3A 3S92A 4A9FA 2D9EA 5C4QA 5BT4A 4IR5A 3U5PA 5ENCA 4CUTA 5HRXA 5DLXA 5G4SA 5E74A 4QSXA 5FG5A 4UIZA 5IG6A 5CQ4A 4UIUA 5C85A 4YY4A 5FE9A 5EU1A 4YYDA 5E73A 4HXPA 2OO1A 5D3PA 3O37A 4NYXA 5HENA 5HCLA 5CUGA 4C67A 4CUUA 5K29A 4IORA 5F1HA 5I29A 4LYIA 1ZS5A 4ZQLA 4TTEA 4NYWA 4YK0A 3HMEA 4KV4A 4OUFA 4BW1A 4GPJA 4IR6A 2H60A 2E7OA 4QB3A 5J0DA 4Z1QA 5EA1A 4QNSA 5EI4A 3O36A 5FH6A 4CUQA 4YATA 4N3WA 5FH7A 2L84A 4NRCA 4YBMA 2I8NA 2OSSA 3JVMA 5KTWA 5CRZA 3P1CA 5E9KA 5FBXA 4ZC9A 4O7EA 5BT5A 4QY4A 3RCWA 5CQTA 5CU8A 5JI8A 4QC1A 4YYKA 5DYXA 4MEPA 4NR7A 4HBWA 4HXRA 4QSTA 4A9OA 4LR6A 4UYEA 3D7CA 5D0CA 4TT2A 5L97A 5D3HA 4CFLA 4TT6A 4QEUA 5IGNA 2I7KA 4YABA 4A9LA 4PCEA 4OGJA 4QSQA 4O71A 2DVRA 4CUSA 4O74A 5CGPA 4XY8A 4NUEA 3DAIA 5D25A 5E3DA 5TB6A 4HBYA 4A9MA 4NUCA 4PCIA 5L99A 4QR4A 4CFKA 5D3TA 5IGMA 5LJ2A 4NXJA 4UIVA 5F60A 2D82A 5EWDA 4PS5A 5H1UA 4KCXA 3FKMX 5F5ZA 5CZGA 5LVRA 5CFWA 5D3SA 4YYMA 4Z93A 5DYCA 4AKNA 4YADA 5A5QA 4PKLA 1EQFA 3LJWA 4ALHA 3MULA 2YDWA 5HEMA 4NRBA 3UV2A 2RNXA 5EISA 3O35A 5CQ3A 3U5MA 3MXFA 5FE7A 4A9JA 5C7NA 5A5NA 5HQ5A 4UYFB 4BW3A 4QEVA 5DY7A 3LQJA 4QSUA 4Q0NA 5ENJA 2RS9B 2R0VA 4QBMA 5F1LA 4NR8A 4WHUA 4N4FA 5FE2A 3Q2EA 5EGUA 3JVKA 5KTXA 2NXBA 4TU4A 4TYLA 4YH4A 5KO4A 5E9LA 1F68A 5L8UA 4LYWA 5AMEA 2RNWA 4TU6A 4MEOA 3JVJA 4UIXA 4QSSA 4A9NA 4QYLA 5DYAA 4J0SA 1WUMA 5CY9A 3U5LA 5ENEA 5EP7A 4HXMA 4QYDA 5C8GA 4O7CA 2RNYA 5AMFA 4QUTA 5AD3A 5D3NA 2KTBB 4N4IA 3IU6A 2RI7A 5D7XA 4QUUA 2DKWA 5KTUA 4QZSA 4E96A 3S91A 5TCMA 1E6IA 3QZTA 4YY6A 4XUBA 4Z6IA 5EM3A 4TQNA 2YYNA 3K2JA 4HXSA 4NR6A 5E3GA 4QC3A 5F36A 4HBVA 5CQ6A 5I88A 4NUDA 5F63A 4NRAA 5FE5A 5BT3A 2G4AA 4BJXA 4BW4A 4YBSA 4HXKA 2RFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZ2 A;  5DW2 A;  5HM0 A;  4FLP A;  3P5O A;  5LKZ A;  5CP5 A;  1N72 A;  2WP1 A;  5E9V A;  2DVV A;  5ETD A;  5JWM A;  4PY6 A;  4YYN A;  2DVS A;  5HLS A;  5ENI A;  5DFC A;  4A9H A;  5EPR A;  3IU5 A;  1WUG A;  5CQ8 A;  3LXJ A;  5F2P A;  5HRV A;  4IOO A;  4MR5 A;  5II1 A;  3SVG A;  4YYH A;  5FE8 A;  4QR5 A;  2RO1 A;  3P1F A;  4NR4 A;  4UYH A;  5A5R A;  5FFY A;  4CUR A;  5HQ7 A;  5LKX A;  5FFV A;  4O78 A;  5CPE A;  5D26 A;  5KU3 A;  5HEL A;  5I1Q A;  2R0Y A;  5EVA A;  5EWW A;  5EWV A;  5H85 A;  2YEL A;  4O70 A;  4C66 A;  4RVR A;  5AD2 A;  3UVD A;  3ZYU A;  5I89 A;  5ETB A;  4Z1S A;  4UIT A;  5F61 A;  5A7C A;  4Z6H A;  4YAX A;  5CS8 A;  4IR4 A;  4BHW A;  4Y03 A;  4X2I A;  4UIW A;  5HRW A;  4HBX A;  5F62 A;  4F3I A;  5EWH A;  3UW9 A;  3Q2F A;  3HMH A;  4CL9 A;  5E9M A;  5A5O A;  4LZ2 A;  1X0J A;  5FB0 A;  4O7B A;  4NQN A;  5I86 A;  5ENB A;  5DW1 A;  2WP2 A;  5COI A;  4YBT A;  3U5N A;  5DKC A;  4O7F A;  3UVY A;  2L5E A;  5DLZ A;  2OUO A;  4CUP A;  5HQ6 A;  4QSW A;  3O34 A;  5CRM A;  5E9Y A;  2YQD A;  5DKD A;  4QR3 A;  2YW5 A;  4QSP A;  5D3R A;  5LKU A;  3O33 A;  5E9I A;  2N9G A;  4NR9 A;  4NQM A;  5CUA A;  4MEN A;  5C89 A;  2E3K A;  4UIY A;  5A5P A;  3MB4 A;  5D3J A;  5CQ7 A;  5A85 A;  5LVQ A;  5ENG A;  3I3J A;  4IR3 A;  2YEK A;  4TS8 A;  5ENF A;  4UYG A;  5L8T A;  3P1E A;  2FSA A;  1JSP B;  3UV5 A;  4QEW A;  5EIC A;  5F25 A;  4WHW A;  5EPB A;  5FE1 A;  5L98 A;  5FE6 A;  4A9E A;  4LYS A;  5L96 A;  4QSV A;  2GRC A;  4Q0O A;  4MEQ A;  2R0S A;  4N4G A;  4XUA A;  5A83 A;  5LJ1 A;  3MUK A;  4QSR A;  5FE4 A;  5CQ5 A;  2DVQ A;  5I83 A;  3AAD A;  3SVF A;  5CUE A;  5FH8 A;  5DFB A;  4NYV A;  5DFD A;  5HJC A;  5I7Y A;  4OGI A;  3MQM A;  5HFR A;  4IOQ A;  4YYI A;  3UV4 A;  3JVL A;  4XYA A;  3G0L A;  5FG4 A;  5FE0 A;  4J3I A;  5H1T A;  5ACY A;  5IID A;  4DON A;  4O77 A;  4UYF A;  5A82 A;  5IGL A;  3NXB A;  5FE3 A;  3UVW A;  5LKT A;  4ALG A;  3LQH A;  4O75 A;  5H1V A;  5E7D A;  3TLP A;  4TT4 A;  2DAT A;  5DX4 A;  5DKH A;  3U5K A;  4O7A A;  5DBM A;  5E0R A;  4PTB A;  3U5J A;  5EWC A;  3LQI A;  4MR6 A;  2F6J A;  5CQA A;  3AQA A;  4NR5 A;  5C87 A;  5D24 A;  4LZS A;  4XY9 A;  5D3L A;  5CTL A;  1JM4 B;  3SVH A;  5FG6 A;  3QZS A;  2L85 A;  4O76 A;  4LDF A;  5FB1 A;  5CUC A;  4A9I A;  5EV9 A;  3ONI A;  4YH3 A;  2YEM A;  5KHM A;  3G0J A;  4J0R A;  5II2 A;  5HFQ A;  5G4R A;  4KV1 A;  5EK9 A;  3P1D A;  4NS5 A;  5IBN A;  4J1P A;  4MR4 A;  5I7X A;  5LJ0 A;  5FDZ A;  4A9K A;  4ZW1 A;  3HMF A;  5A5S A;  4YC9 A;  2MJV B;  5CUD A;  3DWY A;  4HXL A;  4LZR A;  5ENH A;  3U5O A;  4BW2 A;  2F6N A;  3GG3 A;  4WIV A;  5EQ1 A;  4CLB A;  3MB3 A;  3QZV A;  2LSP B;  5CUB A;  3UVX A;  2E7N A;  5A81 A;  4N4H A;  5EPS A;  5IGK A;  2R10 A;  4YYG A;  2DWW A;  5FFW A;  5LUU A;  4HXO A;  5DYU A;  5I80 A;  4TZ8 A;  4HXN A;  5F3A A;  5I40 A;  4LC2 A;  4YYJ A;  4O72 A;  4UYD A;  4LRG A;  4MR3 A;  3S92 A;  4A9F A;  2D9E A;  5C4Q A;  5BT4 A;  4IR5 A;  3U5P A;  5ENC A;  4CUT A;  5HRX A;  5DLX A;  5G4S A;  5E74 A;  4QSX A;  5FG5 A;  4UIZ A;  5IG6 A;  5CQ4 A;  4UIU A;  5C85 A;  4YY4 A;  5FE9 A;  5EU1 A;  4YYD A;  5E73 A;  4HXP A;  2OO1 A;  5D3P A;  3O37 A;  4NYX A;  5HEN A;  5HCL A;  5CUG A;  4C67 A;  4CUU A;  5K29 A;  4IOR A;  5F1H A;  5I29 A;  4LYI A;  1ZS5 A;  4ZQL A;  4TTE A;  4NYW A;  4YK0 A;  3HME A;  4KV4 A;  4OUF A;  4BW1 A;  4GPJ A;  4IR6 A;  2H60 A;  2E7O A;  4QB3 A;  5J0D A;  4Z1Q A;  5EA1 A;  4QNS A;  5EI4 A;  3O36 A;  5FH6 A;  4CUQ A;  4YAT A;  4N3W A;  5FH7 A;  2L84 A;  4NRC A;  4YBM A;  2I8N A;  2OSS A;  3JVM A;  5KTW A;  5CRZ A;  3P1C A;  5E9K A;  5FBX A;  4ZC9 A;  4O7E A;  5BT5 A;  4QY4 A;  3RCW A;  5CQT A;  5CU8 A;  5JI8 A;  4QC1 A;  4YYK A;  5DYX A;  4MEP A;  4NR7 A;  4HBW A;  4HXR A;  4QST A;  4A9O A;  4LR6 A;  4UYE A;  3D7C A;  5D0C A;  4TT2 A;  5L97 A;  5D3H A;  4CFL A;  4TT6 A;  4QEU A;  5IGN A;  2I7K A;  4YAB A;  4A9L A;  4PCE A;  4OGJ A;  4QSQ A;  4O71 A;  2DVR A;  4CUS A;  4O74 A;  5CGP A;  4XY8 A;  4NUE A;  3DAI A;  5D25 A;  5E3D A;  5TB6 A;  4HBY A;  4A9M A;  4NUC A;  4PCI A;  5L99 A;  4QR4 A;  4CFK A;  5D3T A;  5IGM A;  5LJ2 A;  4NXJ A;  4UIV A;  5F60 A;  2D82 A;  5EWD A;  4PS5 A;  5H1U A;  4KCX A;  3FKM X;  5F5Z A;  5CZG A;  5LVR A;  5CFW A;  5D3S A;  4YYM A;  4Z93 A;  5DYC A;  4AKN A;  4YAD A;  5A5Q A;  4PKL A;  1EQF A;  3LJW A;  4ALH A;  3MUL A;  2YDW A;  5HEM A;  4NRB A;  3UV2 A;  2RNX A;  5EIS A;  3O35 A;  5CQ3 A;  3U5M A;  3MXF A;  5FE7 A;  4A9J A;  5C7N A;  5A5N A;  5HQ5 A;  4UYF B;  4BW3 A;  4QEV A;  5DY7 A;  3LQJ A;  4QSU A;  4Q0N A;  5ENJ A;  2RS9 B;  2R0V A;  4QBM A;  5F1L A;  4NR8 A;  4WHU A;  4N4F A;  5FE2 A;  3Q2E A;  5EGU A;  3JVK A;  5KTX A;  2NXB A;  4TU4 A;  4TYL A;  4YH4 A;  5KO4 A;  5E9L A;  1F68 A;  5L8U A;  4LYW A;  5AME A;  2RNW A;  4TU6 A;  4MEO A;  3JVJ A;  4UIX A;  4QSS A;  4A9N A;  4QYL A;  5DYA A;  4J0S A;  1WUM A;  5CY9 A;  3U5L A;  5ENE A;  5EP7 A;  4HXM A;  4QYD A;  5C8G A;  4O7C A;  2RNY A;  5AMF A;  4QUT A;  5AD3 A;  5D3N A;  2KTB B;  4N4I A;  3IU6 A;  2RI7 A;  5D7X A;  4QUU A;  2DKW A;  5KTU A;  4QZS A;  4E96 A;  3S91 A;  5TCM A;  1E6I A;  3QZT A;  4YY6 A;  4XUB A;  4Z6I A;  5EM3 A;  4TQN A;  2YYN A;  3K2J A;  4HXS A;  4NR6 A;  5E3G A;  4QC3 A;  5F36 A;  4HBV A;  5CQ6 A;  5I88 A;  4NUD A;  5F63 A;  4NRA A;  5FE5 A;  5BT3 A;  2G4A A;  4BJX A;  4BW4 A;  4YBS A;  4HXK A;  2RFJ A; 
#chains in the Genus database with same CATH topology
 4TZ2 A;  5DW2 A;  5HM0 A;  4FLP A;  3P5O A;  5LKZ A;  5CP5 A;  1N72 A;  2WP1 A;  5E9V A;  2DVV A;  5ETD A;  5JWM A;  4PY6 A;  4YYN A;  2DVS A;  5HLS A;  5ENI A;  5DFC A;  4A9H A;  5EPR A;  3IU5 A;  1WUG A;  5CQ8 A;  3LXJ A;  5F2P A;  5HRV A;  4AKG A;  4IOO A;  4MR5 A;  5II1 A;  3SVG A;  4YYH A;  5FE8 A;  4QR5 A;  2RO1 A;  3P1F A;  4NR4 A;  4UYH A;  5A5R A;  5FFY A;  4CUR A;  5HQ7 A;  5LKX A;  5FFV A;  4O78 A;  5CPE A;  5D26 A;  5KU3 A;  5HEL A;  5I1Q A;  2R0Y A;  5EVA A;  5EWW A;  5EWV A;  5H85 A;  2YEL A;  4O70 A;  4C66 A;  4RVR A;  5AD2 A;  3UVD A;  3ZYU A;  5I89 A;  5ETB A;  4Z1S A;  4UIT A;  5F61 A;  5A7C A;  4Z6H A;  4YAX A;  5CS8 A;  4IR4 A;  4BHW A;  4Y03 A;  4X2I A;  4UIW A;  5HRW A;  4HBX A;  5F62 A;  4F3I A;  5EWH A;  3UW9 A;  3Q2F A;  3HMH A;  4CL9 A;  5E9M A;  5A5O A;  4LZ2 A;  1X0J A;  5FB0 A;  4O7B A;  4NQN A;  5I86 A;  5ENB A;  5DW1 A;  2WP2 A;  5COI A;  4YBT A;  3U5N A;  5DKC A;  4O7F A;  3UVY A;  2L5E A;  5DLZ A;  2OUO A;  4CUP A;  5HQ6 A;  4QSW A;  3O34 A;  5CRM A;  5E9Y A;  2YQD A;  5DKD A;  4QR3 A;  2YW5 A;  4QSP A;  5D3R A;  5LKU A;  3O33 A;  5E9I A;  2N9G A;  4NR9 A;  4AKH A;  4NQM A;  5CUA A;  4MEN A;  5C89 A;  2E3K A;  4UIY A;  5A5P A;  3MB4 A;  5D3J A;  5CQ7 A;  5A85 A;  5LVQ A;  5ENG A;  3I3J A;  4IR3 A;  2YEK A;  4TS8 A;  1PUO A;  5ENF A;  4UYG A;  5L8T A;  3D1D A;  3P1E A;  2FSA A;  1JSP B;  3UV5 A;  4QEW A;  5EIC A;  5F25 A;  4WHW A;  5EPB A;  5FE1 A;  5L98 A;  5FE6 A;  4A9E A;  4LYS A;  5L96 A;  4QSV A;  2GRC A;  4Q0O A;  4MEQ A;  2R0S A;  4N4G A;  4XUA A;  5A83 A;  5LJ1 A;  3MUK A;  4QSR A;  5FE4 A;  5CQ5 A;  2DVQ A;  5I83 A;  3AAD A;  3SVF A;  5CUE A;  5FH8 A;  5DFB A;  4NYV A;  5DFD A;  5HJC A;  5I7Y A;  4OGI A;  3MQM A;  5HFR A;  4IOQ A;  4YYI A;  3UV4 A;  3JVL A;  4XYA A;  3G0L A;  5FG4 A;  5FE0 A;  4J3I A;  5H1T A;  5ACY A;  5IID A;  4DON A;  4O77 A;  4UYF A;  5A82 A;  5IGL A;  3NXB A;  5FE3 A;  3UVW A;  5LKT A;  4ALG A;  3LQH A;  4O75 A;  5H1V A;  5E7D A;  3TLP A;  4TT4 A;  2DAT A;  5DX4 A;  5DKH A;  3U5K A;  4O7A A;  5DBM A;  5E0R A;  4PTB A;  3U5J A;  5EWC A;  3LQI A;  4MR6 A;  2F6J A;  5CQA A;  3AQA A;  4NR5 A;  5C87 A;  5D24 A;  4LZS A;  4XY9 A;  5D3L A;  5CTL A;  1JM4 B;  3SVH A;  5FG6 A;  3QZS A;  2EJN A;  2L85 A;  4O76 A;  4LDF A;  5FB1 A;  5CUC A;  4A9I A;  5EV9 A;  3VKH A;  3ONI A;  4YH3 A;  2YEM A;  5KHM A;  3G0J A;  4J0R A;  5II2 A;  5HFQ A;  5G4R A;  4KV1 A;  5EK9 A;  3P1D A;  4NS5 A;  5IBN A;  4J1P A;  4MR4 A;  5I7X A;  5LJ0 A;  5FDZ A;  4A9K A;  4ZW1 A;  3HMF A;  5A5S A;  4YC9 A;  2MJV B;  5CUD A;  3DWY A;  4HXL A;  4LZR A;  5ENH A;  3U5O A;  4BW2 A;  2F6N A;  3GG3 A;  4WIV A;  5EQ1 A;  4CLB A;  3MB3 A;  3QZV A;  2LSP B;  5CUB A;  3UVX A;  2E7N A;  5A81 A;  4N4H A;  5EPS A;  5IGK A;  2R10 A;  4YYG A;  2DWW A;  5FFW A;  5LUU A;  4HXO A;  5DYU A;  5I80 A;  4TZ8 A;  4HXN A;  5F3A A;  5I40 A;  4LC2 A;  4YYJ A;  4O72 A;  4UYD A;  4LRG A;  4MR3 A;  3S92 A;  4A9F A;  2D9E A;  5C4Q A;  5BT4 A;  4IR5 A;  3U5P A;  5ENC A;  4CUT A;  5HRX A;  5DLX A;  5G4S A;  5E74 A;  4QSX A;  5FG5 A;  4UIZ A;  5IG6 A;  5CQ4 A;  4UIU A;  5C85 A;  4YY4 A;  5FE9 A;  5EU1 A;  4YYD A;  5E73 A;  4HXP A;  2OO1 A;  5D3P A;  3O37 A;  4NYX A;  5HEN A;  5HCL A;  5CUG A;  4C67 A;  4CUU A;  5K29 A;  4IOR A;  5F1H A;  5I29 A;  4LYI A;  1ZS5 A;  4ZQL A;  4TTE A;  4NYW A;  4YK0 A;  3HME A;  4KV4 A;  4OUF A;  4BW1 A;  4GPJ A;  4IR6 A;  2H60 A;  2E7O A;  4QB3 A;  5J0D A;  4Z1Q A;  5EA1 A;  4QNS A;  5EI4 A;  3O36 A;  5FH6 A;  4CUQ A;  4YAT A;  4N3W A;  5FH7 A;  2L84 A;  4NRC A;  4YBM A;  2I8N A;  2OSS A;  3JVM A;  5KTW A;  5CRZ A;  3P1C A;  5E9K A;  5FBX A;  4ZC9 A;  4O7E A;  5BT5 A;  4QY4 A;  3RCW A;  5CQT A;  5CU8 A;  5JI8 A;  4QC1 A;  4YYK A;  5DYX A;  4MEP A;  4NR7 A;  4HBW A;  4HXR A;  4QST A;  4A9O A;  4LR6 A;  4UYE A;  3D7C A;  5D0C A;  4TT2 A;  5L97 A;  5D3H A;  4CFL A;  4TT6 A;  4QEU A;  3D1B A;  5IGN A;  2I7K A;  4YAB A;  4A9L A;  3VKG A;  4PCE A;  4OGJ A;  4QSQ A;  4O71 A;  2DVR A;  4CUS A;  4O74 A;  5CGP A;  4XY8 A;  4NUE A;  3DAI A;  5D25 A;  4AI6 A;  5E3D A;  5TB6 A;  4HBY A;  4A9M A;  4NUC A;  4PCI A;  5L99 A;  4QR4 A;  4CFK A;  5D3T A;  5IGM A;  5LJ2 A;  4NXJ A;  4UIV A;  5F60 A;  2D82 A;  5EWD A;  4PS5 A;  5H1U A;  4KCX A;  3FKM X;  5F5Z A;  5CZG A;  5LVR A;  5CFW A;  5D3S A;  4YYM A;  4Z93 A;  5DYC A;  4AKN A;  4YAD A;  5A5Q A;  3ERR A;  4PKL A;  1EQF A;  3LJW A;  4ALH A;  3MUL A;  2YDW A;  5HEM A;  4NRB A;  3UV2 A;  2RNX A;  5EIS A;  3O35 A;  5CQ3 A;  3U5M A;  3MXF A;  5FE7 A;  4A9J A;  5C7N A;  5A5N A;  5HQ5 A;  4UYF B;  4BW3 A;  4QEV A;  5DY7 A;  3LQJ A;  4QSU A;  4Q0N A;  5ENJ A;  2RS9 B;  2R0V A;  4QBM A;  5F1L A;  4NR8 A;  4WHU A;  4N4F A;  5FE2 A;  3Q2E A;  5EGU A;  3JVK A;  5KTX A;  2NXB A;  4TU4 A;  4TYL A;  4YH4 A;  5KO4 A;  5E9L A;  1F68 A;  5L8U A;  4LYW A;  5AME A;  4AKI A;  2RNW A;  4TU6 A;  4MEO A;  3JVJ A;  4UIX A;  4QSS A;  4A9N A;  4QYL A;  5DYA A;  4J0S A;  1WUM A;  5CY9 A;  3U5L A;  5ENE A;  5EP7 A;  4HXM A;  4QYD A;  5C8G A;  4O7C A;  2RNY A;  5AMF A;  4QUT A;  5AD3 A;  5D3N A;  2KTB B;  4N4I A;  2RI7 A;  3IU6 A;  4QUU A;  5D7X A;  2DKW A;  5KTU A;  4QZS A;  4E96 A;  3S91 A;  5TCM A;  1E6I A;  3QZT A;  4YY6 A;  4XUB A;  4Z6I A;  5EM3 A;  4TQN A;  2YYN A;  3K2J A;  4HXS A;  4NR6 A;  5E3G A;  1ZKR A;  4QC3 A;  5F36 A;  4HBV A;  5CQ6 A;  5I88 A;  4NUD A;  5F63 A;  4NRA A;  5FE5 A;  5BT3 A;  2G4A A;  4BJX A;  4BW4 A;  4YBS A;  4HXK A;  2RFJ A; 
#chains in the Genus database with same CATH homology
 4TZ2 A;  5DW2 A;  5HM0 A;  4FLP A;  3P5O A;  5LKZ A;  5CP5 A;  1N72 A;  2WP1 A;  5E9V A;  2DVV A;  5ETD A;  5JWM A;  4PY6 A;  4YYN A;  2DVS A;  5HLS A;  5ENI A;  5DFC A;  4A9H A;  5EPR A;  3IU5 A;  1WUG A;  5CQ8 A;  3LXJ A;  5F2P A;  5HRV A;  4IOO A;  4MR5 A;  5II1 A;  3SVG A;  4YYH A;  5FE8 A;  4QR5 A;  2RO1 A;  3P1F A;  4NR4 A;  4UYH A;  5A5R A;  5FFY A;  4CUR A;  5HQ7 A;  5LKX A;  5FFV A;  4O78 A;  5CPE A;  5D26 A;  5KU3 A;  5HEL A;  5I1Q A;  2R0Y A;  5EVA A;  5EWW A;  5EWV A;  5H85 A;  2YEL A;  4O70 A;  4C66 A;  4RVR A;  5AD2 A;  3UVD A;  3ZYU A;  5I89 A;  5ETB A;  4Z1S A;  4UIT A;  5F61 A;  5A7C A;  4Z6H A;  4YAX A;  5CS8 A;  4IR4 A;  4BHW A;  4Y03 A;  4X2I A;  4UIW A;  5HRW A;  4HBX A;  5F62 A;  4F3I A;  5EWH A;  3UW9 A;  3Q2F A;  3HMH A;  4CL9 A;  5E9M A;  5A5O A;  4LZ2 A;  1X0J A;  5FB0 A;  4O7B A;  4NQN A;  5I86 A;  5ENB A;  5DW1 A;  2WP2 A;  5COI A;  4YBT A;  3U5N A;  5DKC A;  4O7F A;  3UVY A;  2L5E A;  5DLZ A;  2OUO A;  4CUP A;  5HQ6 A;  4QSW A;  3O34 A;  5CRM A;  5E9Y A;  2YQD A;  5DKD A;  4QR3 A;  2YW5 A;  4QSP A;  5D3R A;  5LKU A;  3O33 A;  5E9I A;  2N9G A;  4NR9 A;  4NQM A;  5CUA A;  4MEN A;  5C89 A;  2E3K A;  4UIY A;  5A5P A;  3MB4 A;  5D3J A;  5CQ7 A;  5A85 A;  5LVQ A;  5ENG A;  3I3J A;  4IR3 A;  2YEK A;  4TS8 A;  5ENF A;  4UYG A;  5L8T A;  3P1E A;  2FSA A;  1JSP B;  3UV5 A;  4QEW A;  5EIC A;  5F25 A;  4WHW A;  5EPB A;  5FE1 A;  5L98 A;  5FE6 A;  4A9E A;  4LYS A;  5L96 A;  4QSV A;  2GRC A;  4Q0O A;  4MEQ A;  2R0S A;  4N4G A;  4XUA A;  5A83 A;  5LJ1 A;  3MUK A;  4QSR A;  5FE4 A;  5CQ5 A;  2DVQ A;  5I83 A;  3AAD A;  3SVF A;  5CUE A;  5FH8 A;  5DFB A;  4NYV A;  5DFD A;  5HJC A;  5I7Y A;  4OGI A;  3MQM A;  5HFR A;  4IOQ A;  4YYI A;  3UV4 A;  3JVL A;  4XYA A;  3G0L A;  5FG4 A;  5FE0 A;  4J3I A;  5H1T A;  5ACY A;  5IID A;  4DON A;  4O77 A;  4UYF A;  5A82 A;  5IGL A;  3NXB A;  5FE3 A;  3UVW A;  5LKT A;  4ALG A;  3LQH A;  4O75 A;  5H1V A;  5E7D A;  3TLP A;  4TT4 A;  2DAT A;  5DX4 A;  5DKH A;  3U5K A;  4O7A A;  5DBM A;  5E0R A;  4PTB A;  3U5J A;  5EWC A;  3LQI A;  4MR6 A;  2F6J A;  5CQA A;  3AQA A;  4NR5 A;  5C87 A;  5D24 A;  4LZS A;  4XY9 A;  5D3L A;  5CTL A;  1JM4 B;  3SVH A;  5FG6 A;  3QZS A;  2L85 A;  4O76 A;  4LDF A;  5FB1 A;  5CUC A;  4A9I A;  5EV9 A;  3ONI A;  4YH3 A;  2YEM A;  5KHM A;  3G0J A;  4J0R A;  5II2 A;  5HFQ A;  5G4R A;  4KV1 A;  5EK9 A;  3P1D A;  4NS5 A;  5IBN A;  4J1P A;  4MR4 A;  5I7X A;  5LJ0 A;  5FDZ A;  4A9K A;  4ZW1 A;  3HMF A;  5A5S A;  4YC9 A;  2MJV B;  5CUD A;  3DWY A;  4HXL A;  4LZR A;  5ENH A;  3U5O A;  4BW2 A;  2F6N A;  3GG3 A;  4WIV A;  5EQ1 A;  4CLB A;  3MB3 A;  3QZV A;  2LSP B;  5CUB A;  3UVX A;  2E7N A;  5A81 A;  4N4H A;  5EPS A;  5IGK A;  2R10 A;  4YYG A;  2DWW A;  5FFW A;  5LUU A;  4HXO A;  5DYU A;  5I80 A;  4TZ8 A;  4HXN A;  5F3A A;  5I40 A;  4LC2 A;  4YYJ A;  4O72 A;  4UYD A;  4LRG A;  4MR3 A;  3S92 A;  4A9F A;  2D9E A;  5C4Q A;  5BT4 A;  4IR5 A;  3U5P A;  5ENC A;  4CUT A;  5HRX A;  5DLX A;  5G4S A;  5E74 A;  4QSX A;  5FG5 A;  4UIZ A;  5IG6 A;  5CQ4 A;  4UIU A;  5C85 A;  4YY4 A;  5FE9 A;  5EU1 A;  4YYD A;  5E73 A;  4HXP A;  2OO1 A;  5D3P A;  3O37 A;  4NYX A;  5HEN A;  5HCL A;  5CUG A;  4C67 A;  4CUU A;  5K29 A;  4IOR A;  5F1H A;  5I29 A;  4LYI A;  1ZS5 A;  4ZQL A;  4TTE A;  4NYW A;  4YK0 A;  3HME A;  4KV4 A;  4OUF A;  4BW1 A;  4GPJ A;  4IR6 A;  2H60 A;  2E7O A;  4QB3 A;  5J0D A;  4Z1Q A;  5EA1 A;  4QNS A;  5EI4 A;  3O36 A;  5FH6 A;  4CUQ A;  4YAT A;  4N3W A;  5FH7 A;  2L84 A;  4NRC A;  4YBM A;  2I8N A;  2OSS A;  3JVM A;  5KTW A;  5CRZ A;  3P1C A;  5E9K A;  5FBX A;  4ZC9 A;  4O7E A;  5BT5 A;  4QY4 A;  3RCW A;  5CQT A;  5CU8 A;  5JI8 A;  4QC1 A;  4YYK A;  5DYX A;  4MEP A;  4NR7 A;  4HBW A;  4HXR A;  4QST A;  4A9O A;  4LR6 A;  4UYE A;  3D7C A;  5D0C A;  4TT2 A;  5L97 A;  5D3H A;  4CFL A;  4TT6 A;  4QEU A;  5IGN A;  2I7K A;  4YAB A;  4A9L A;  4PCE A;  4OGJ A;  4QSQ A;  4O71 A;  2DVR A;  4CUS A;  4O74 A;  5CGP A;  4XY8 A;  4NUE A;  3DAI A;  5D25 A;  5E3D A;  5TB6 A;  4HBY A;  4A9M A;  4NUC A;  4PCI A;  5L99 A;  4QR4 A;  4CFK A;  5D3T A;  5IGM A;  5LJ2 A;  4NXJ A;  4UIV A;  5F60 A;  2D82 A;  5EWD A;  4PS5 A;  5H1U A;  4KCX A;  3FKM X;  5F5Z A;  5CZG A;  5LVR A;  5CFW A;  5D3S A;  4YYM A;  4Z93 A;  5DYC A;  4AKN A;  4YAD A;  5A5Q A;  4PKL A;  1EQF A;  3LJW A;  4ALH A;  3MUL A;  2YDW A;  5HEM A;  4NRB A;  3UV2 A;  2RNX A;  5EIS A;  3O35 A;  5CQ3 A;  3U5M A;  3MXF A;  5FE7 A;  4A9J A;  5C7N A;  5A5N A;  5HQ5 A;  4UYF B;  4BW3 A;  4QEV A;  5DY7 A;  3LQJ A;  4QSU A;  4Q0N A;  5ENJ A;  2RS9 B;  2R0V A;  4QBM A;  5F1L A;  4NR8 A;  4WHU A;  4N4F A;  5FE2 A;  3Q2E A;  5EGU A;  3JVK A;  5KTX A;  2NXB A;  4TU4 A;  4TYL A;  4YH4 A;  5KO4 A;  5E9L A;  1F68 A;  5L8U A;  4LYW A;  5AME A;  2RNW A;  4TU6 A;  4MEO A;  3JVJ A;  4UIX A;  4QSS A;  4A9N A;  4QYL A;  5DYA A;  4J0S A;  1WUM A;  5CY9 A;  3U5L A;  5ENE A;  5EP7 A;  4HXM A;  4QYD A;  5C8G A;  4O7C A;  2RNY A;  5AMF A;  4QUT A;  5AD3 A;  5D3N A;  2KTB B;  4N4I A;  3IU6 A;  2RI7 A;  5D7X A;  4QUU A;  2DKW A;  5KTU A;  4QZS A;  4E96 A;  3S91 A;  5TCM A;  1E6I A;  3QZT A;  4YY6 A;  4XUB A;  4Z6I A;  5EM3 A;  4TQN A;  2YYN A;  3K2J A;  4HXS A;  4NR6 A;  5E3G A;  4QC3 A;  5F36 A;  4HBV A;  5CQ6 A;  5I88 A;  4NUD A;  5F63 A;  4NRA A;  5FE5 A;  5BT3 A;  2G4A A;  4BJX A;  4BW4 A;  4YBS A;  4HXK A;  2RFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...