5DKCA

Crystal structure of the bromodomain of human brm (smarca2) in complex with pfi-3 chemical probe
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
110
structure length
110
Chain Sequence
PKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Probable global transcription activator SNF2L2
publication title Crystal structure of the bromodomain of human BRM (SMARCA2) in complex with PFI-3 chemical probe
rcsb
source organism Homo sapiens
total genus 40
structure length 110
sequence length 110
ec nomenclature ec 3.6.4.-:
pdb deposition date 2015-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dkcA00
5A85A 5E9KA 4Z93A 5D3PA 5D7XA 5LJ1A 4PCIA 5DFDA 5EPRA 5D3NA 5CQ7A 5ETDA 3I3JA 4A9EA 5CP5A 4LYSA 4YC9A 5CRZA 4YY6A 4TQNA 5FE8A 4O7FA 5FE6A 5EPSA 4FLPA 5D3RA 4CURA 3ONIA 4Z6IA 5ENEA 3K2JA 5DYAA 4UITA 4TYLA 5CU8A 4TU6A 4PTBA 2RFJA 5FE3A 5EV9A 2N9GA 5F63A 4XY8A 2LSPB 5G4SA 5I29A 4YH3A 4C67A 5H1UA 5A5NA 4PCEA 5FBXA 4A9OA 4TS8A 5KHMA 3UVYA 5E9MA 5IIDA 5HLSA 5EI4A 4LRGA 4CUUA 4XUBA 5L8UA 1JSPB 4UYFB 5D24A 5F1LA 4PY6A 4J0RA 4CUPA 5A5OA 4QEVA 5IG6A 5A81A 1WUGA 5CQAA 4X2IA 5D3LA 4A9NA 4QC3A 3LQIA 5E9VA 4YATA 4BW2A 4QSTA 4QYLA 3O34A 4CUSA 3LQJA 5FDZA 2L5EA 5DFBA 4YAXA 4XYAA 4YYGA 5JWMA 4WHWA 2KTBB 5EWCA 4UYGA 4NR4A 5A5PA 1E6IA 4OGJA 5EA1A 5EWDA 5L97A 5IGLA 4NYWA 5CQTA 5E9IA 2YW5A 4HXMA 4XY9A 4A9LA 5CQ5A 5CQ8A 4NR9A 5D3HA 4ZC9A 5IGMA 5II2A 4IOQA 1F68A 4QSQA 5HJCA 4ZW1A 4BJXA 5KTUA 4UIZA 5EISA 4IOOA 5EPBA 5EWHA 5L98A 3U5JA 2RI7A 4O74A 4PKLA 5F5ZA 4YYMA 5DW2A 2R10A 3U5PA 4NR7A 5K29A 3U5OA 5EWWA 2H60A 5CUCA 4TT2A 3O37A 4KV1A 5ENIA 5F61A 5KTXA 3NXBA 5E3DA 5FE2A 5LJ2A 3QZTA 5I83A 2E7OA 5CQ3A 3P1DA 5D26A 3AQAA 4LZSA 3Q2FA 5CQ6A 2MJVB 4UIXA 4QSWA 5E9YA 2GRCA 4HXOA 5ENFA 5EM3A 5A5RA 3P5OA 4UYDA 5TCMA 5CUGA 5HFQA 4NUDA 5LUUA 5LVRA 4O70A 4YK0A 4MEQA 4NR8A 3UVXA 4UYHA 5I7YA 5HCLA 4YYNA 4LZ2A 5CZGA 4N4HA 4C66A 4HXSA 4A9HA 4HBXA 4MEPA 4HXNA 4N4FA 5DW1A 5A82A 3HMHA 5HQ5A 3LXJA 4NR6A 4O71A 5EVAA 5FB0A 4UIVA 4NYXA 3SVHA 4HBVA 2RNXA 3O33A 4J0SA 5HFRA 5CTLA 3AADA 5C7NA 3HMEA 4E96A 2YEMA 5CQ4A 5E0RA 4O77A 3S91A 4YADA 4BHWA 3TLPA 2I7KA 3P1FA 4Y03A 5DKCA 3DAIA 4HXKA 5AMFA 4MEOA 5FE4A 5D3TA 4WIVA 5C8GA 5FFWA 4YABA 5ENHA 4TTEA 5F3AA 5FH6A 4CLBA 5I88A 4QNSA 5DLXA 4NQMA 4QSUA 4CL9A 5F36A 3UVDA 3MXFA 4ZQLA 4CFKA 5EICA 4OUFA 5F62A 5LKZA 5F1HA 4HXRA 5BT3A 5HENA 4N4IA 2RNYA 5I1QA 3JVKA 5DKDA 5CRMA 5A83A 5I40A 4YYIA 2G4AA 4A9FA 4LYWA 4NRAA 4UIUA 2YQDA 4QSPA 4PS5A 3IU5A 4HXPA 4LC2A 5DBMA 4BW3A 3D7CA 5CUAA 4QR5A 5FH7A 1ZS5A 2OSSA 5ENCA 5KO4A 3O36A 4HBYA 4O72A 5F25A 4N4GA 4XUAA 3JVMA 5A5SA 5HRXA 4Z6HA 5EQ1A 2DATA 5EGUA 5ACYA 3MB3A 3MUKA 4BW1A 5HRWA 4QEWA 5FB1A 4YY4A 3U5KA 2OUOA 4YH4A 2L84A 4OGIA 4QUUA 5LKXA 5C87A 5KU3A 5H1TA 5LKTA 4YBMA 4NYVA 5D3SA 2WP2A 5BT4A 3MB4A 5BT5A 4ALHA 5HELA 5I86A 5L8TA 1X0JA 5DFCA 3SVFA 4TT4A 5II1A 3UV2A 5ENGA 4QR4A 5FG5A 5CUDA 5FFVA 2L85A 5G4RA 4Q0NA 5LKUA 4QR3A 4YBTA 3QZSA 5C4QA 2DVVA 4YYDA 5AD2A 2RNWA 3P1EA 4QUTA 5IBNA 3GG3A 4MR3A 5FE7A 2YELA 4Q0OA 2OO1A 5J0DA 3MQMA 5COIA 3P1CA 4O76A 4O7AA 5FH8A 4IR3A 3LJWA 2DVSA 5AD3A 4WHUA 5E3GA 3ZYUA 5FG6A 5E74A 1JM4B 4A9KA 5EP7A 2YEKA 4O7CA 5F60A 2E3KA 4KCXA 2RS9B 4LDFA 4QEUA 3S92A 4BW4A 4YYKA 5A5QA 3QZVA 5ETBA 5DY7A 3SVGA 1WUMA 3IU6A 4UIYA 5E73A 5ENJA 5E9LA 4LR6A 5H85A 5AMEA 2FSAA 5IGNA 4HBWA 5HQ6A 4QSXA 2I8NA 4NR5A 1N72A 4RVRA 5HEMA 2YYNA 4QBMA 5CPEA 5TB6A 4AKNA 2DVRA 2D9EA 5CY9A 4LYIA 4Z1SA 4YYHA 4KV4A 4A9JA 5F2PA 5HM0A 4O7EA 4O7BA 5DYCA 5LJ0A 3HMFA 4N3WA 4NS5A 2R0VA 4YBSA 1EQFA 3JVJA 2NXBA 4F3IA 5ENBA 3UV4A 4O75A 5DLZA 4QYDA 4QB3A 2RO1A 5DYUA 5EU1A 4UIWA 4IR4A 4A9MA 5CS8A 4CUQA 3U5MA 5DX4A 3UW9A 3RCWA 4QSVA 5C85A 5CFWA 2DKWA 3MULA 4MENA 3UVWA 5CUBA 2DVQA 4O78A 2E7NA 4NQNA 4QSSA 4A9IA 5IGKA 4LZRA 4Z1QA 4TU4A 3DWYA 4HXLA 5C89A 5H1VA 5L99A 4QZSA 5FE1A 4ALGA 5FE5A 4UYFA 4UYEA 5CGPA 4CUTA 3LQHA 5FG4A 5HRVA 5D3JA 4MR6A 4TT6A 4TZ8A 3G0JA 4NXJA 4NUCA 3Q2EA 5I80A 4CFLA 2DWWA 2F6JA 4IORA 5L96A 5JI8A 5EWVA 3JVLA 4YYJA 5FE0A 2D82A 5E7DA 5HQ7A 5FE9A 4IR6A 4NUEA 5I7XA 4NRCA 3U5NA 3O35A 5LVQA 4J1PA 4MR5A 5FFYA 5I89A 5KTWA 4J3IA 4NRBA 4MR4A 5DYXA 4GPJA 5CUEA 4QY4A 4DONA 2WP1A 2R0SA 3G0LA 5D0CA 3FKMX 2F6NA 4QSRA 2YDWA 2R0YA 3UV5A 4TZ2A 5D25A 5DKHA 4QC1A 5EK9A 4IR5A 5A7CA 3U5LA
chains in the Genus database with same CATH superfamily
5A85A 5E9KA 4Z93A 5D3PA 5D7XA 5LJ1A 4PCIA 5DFDA 5EPRA 5D3NA 5CQ7A 5ETDA 3I3JA 4A9EA 5CP5A 4LYSA 4YC9A 5CRZA 4YY6A 4TQNA 5FE8A 4O7FA 5FE6A 5EPSA 4FLPA 5D3RA 4CURA 3ONIA 4Z6IA 5ENEA 3K2JA 5DYAA 4UITA 4TYLA 5CU8A 4TU6A 4PTBA 2RFJA 5FE3A 5EV9A 2N9GA 5F63A 4XY8A 2LSPB 5G4SA 5I29A 4YH3A 4C67A 5H1UA 5A5NA 4PCEA 5FBXA 4A9OA 4TS8A 5KHMA 3UVYA 5E9MA 5IIDA 5HLSA 5EI4A 4LRGA 4CUUA 4XUBA 5L8UA 1JSPB 4UYFB 3VKGA 5D24A 5F1LA 4PY6A 4J0RA 4CUPA 5A5OA 4QEVA 5IG6A 5A81A 1WUGA 5CQAA 4X2IA 5D3LA 4A9NA 4QC3A 3LQIA 3D1DA 5E9VA 4YATA 3ERRA 4BW2A 4QSTA 4QYLA 3O34A 4CUSA 3LQJA 5FDZA 2L5EA 5DFBA 4YAXA 4XYAA 4YYGA 5JWMA 4WHWA 2KTBB 5EWCA 4UYGA 4NR4A 5A5PA 1E6IA 4OGJA 5EA1A 5EWDA 5L97A 5IGLA 4NYWA 5CQTA 5E9IA 2YW5A 4HXMA 4XY9A 4A9LA 5CQ5A 5CQ8A 4NR9A 5D3HA 4ZC9A 5IGMA 5II2A 4IOQA 1F68A 4QSQA 5HJCA 4ZW1A 4BJXA 5KTUA 4UIZA 5EISA 4IOOA 5EPBA 5EWHA 5L98A 3U5JA 2RI7A 4O74A 4PKLA 5F5ZA 4YYMA 5DW2A 2R10A 3U5PA 4NR7A 5K29A 3U5OA 5EWWA 2H60A 5CUCA 4TT2A 3O37A 4KV1A 5ENIA 5F61A 5KTXA 3NXBA 5E3DA 5FE2A 5LJ2A 3QZTA 5I83A 2E7OA 5CQ3A 3P1DA 5D26A 3AQAA 4LZSA 3Q2FA 5CQ6A 2MJVB 4UIXA 4QSWA 5E9YA 2GRCA 4HXOA 5ENFA 5EM3A 5A5RA 3P5OA 4UYDA 5TCMA 5CUGA 5HFQA 4NUDA 5LUUA 5LVRA 4O70A 4YK0A 4MEQA 4NR8A 3UVXA 4UYHA 5I7YA 5HCLA 4YYNA 4LZ2A 5CZGA 4N4HA 4C66A 4HXSA 4A9HA 4HBXA 4MEPA 4HXNA 4N4FA 5DW1A 5A82A 3HMHA 5HQ5A 3LXJA 4NR6A 4O71A 5EVAA 5FB0A 4UIVA 4NYXA 3SVHA 4HBVA 2RNXA 3O33A 4J0SA 5HFRA 5CTLA 3AADA 5C7NA 3HMEA 4E96A 2YEMA 5CQ4A 5E0RA 4O77A 3S91A 4YADA 4BHWA 3TLPA 2I7KA 3P1FA 4Y03A 5DKCA 3DAIA 4HXKA 5AMFA 4MEOA 5FE4A 5D3TA 4WIVA 5C8GA 5FFWA 4YABA 5ENHA 4TTEA 5F3AA 5FH6A 4CLBA 5I88A 4QNSA 5DLXA 4NQMA 4QSUA 4CL9A 5F36A 3UVDA 3MXFA 4ZQLA 4AKGA 1PUOA 4CFKA 5EICA 4OUFA 5F62A 5LKZA 5F1HA 4HXRA 5BT3A 5HENA 4N4IA 2RNYA 5I1QA 3JVKA 5DKDA 5CRMA 5A83A 5I40A 4YYIA 2G4AA 4A9FA 4LYWA 4NRAA 4UIUA 2YQDA 4QSPA 4PS5A 3IU5A 4HXPA 4LC2A 5DBMA 4BW3A 3D7CA 5CUAA 4QR5A 5FH7A 1ZS5A 2OSSA 5ENCA 5KO4A 3O36A 4HBYA 4O72A 5F25A 4N4GA 4XUAA 3JVMA 5A5SA 5HRXA 4Z6HA 5EQ1A 2DATA 5EGUA 5ACYA 3MB3A 3MUKA 4BW1A 5HRWA 4QEWA 5FB1A 4YY4A 3U5KA 2OUOA 4YH4A 2L84A 4OGIA 4QUUA 5LKXA 5C87A 5KU3A 5H1TA 5LKTA 4YBMA 4NYVA 5D3SA 2WP2A 5BT4A 3MB4A 5BT5A 4ALHA 5HELA 5I86A 5L8TA 1X0JA 5DFCA 3SVFA 4TT4A 5II1A 3UV2A 5ENGA 4QR4A 5FG5A 5CUDA 5FFVA 2L85A 5G4RA 4Q0NA 5LKUA 4QR3A 4YBTA 3QZSA 5C4QA 2DVVA 4YYDA 5AD2A 2RNWA 3P1EA 4QUTA 5IBNA 3GG3A 4MR3A 5FE7A 2YELA 4Q0OA 2OO1A 5J0DA 3MQMA 5COIA 3P1CA 4O76A 4AKHA 4O7AA 5FH8A 4IR3A 3LJWA 2DVSA 5AD3A 4WHUA 5E3GA 3ZYUA 5FG6A 5E74A 1JM4B 4A9KA 5EP7A 3VKHA 2YEKA 4O7CA 5F60A 2E3KA 4KCXA 2RS9B 4LDFA 4QEUA 3S92A 4BW4A 4YYKA 5A5QA 3QZVA 5ETBA 5DY7A 3SVGA 1WUMA 3IU6A 4UIYA 5E73A 5ENJA 5E9LA 4LR6A 5H85A 5AMEA 2FSAA 5IGNA 4HBWA 5HQ6A 4QSXA 2I8NA 4NR5A 1N72A 4RVRA 4AI6A 5HEMA 2YYNA 4QBMA 5CPEA 5TB6A 4AKNA 2DVRA 2D9EA 5CY9A 4LYIA 4Z1SA 4YYHA 4KV4A 4A9JA 5F2PA 5HM0A 4O7EA 4O7BA 5DYCA 5LJ0A 3HMFA 4N3WA 4NS5A 2R0VA 4YBSA 1EQFA 2NXBA 3JVJA 4F3IA 5ENBA 3UV4A 4O75A 1ZKRA 4QYDA 5DLZA 4QB3A 2RO1A 5DYUA 5EU1A 4UIWA 4IR4A 4A9MA 5CS8A 4CUQA 3U5MA 5DX4A 2EJNA 3UW9A 3RCWA 4QSVA 5C85A 5CFWA 2DKWA 3MULA 4MENA 3UVWA 5CUBA 2DVQA 4O78A 2E7NA 4NQNA 4QSSA 4A9IA 5IGKA 4LZRA 4Z1QA 4TU4A 3DWYA 4HXLA 5C89A 5H1VA 5L99A 4QZSA 5FE1A 4ALGA 5FE5A 4UYFA 4UYEA 5CGPA 4CUTA 3LQHA 5FG4A 5HRVA 5D3JA 4MR6A 4TT6A 4TZ8A 3G0JA 4NXJA 4NUCA 3Q2EA 5I80A 4CFLA 2DWWA 2F6JA 4IORA 5L96A 3D1BA 5JI8A 5EWVA 3JVLA 4YYJA 5FE0A 2D82A 5E7DA 5HQ7A 5FE9A 4IR6A 4NUEA 5I7XA 4NRCA 3U5NA 3O35A 5LVQA 4J1PA 4MR5A 5FFYA 5I89A 5KTWA 4J3IA 4NRBA 4MR4A 5DYXA 4GPJA 5CUEA 4QY4A 4DONA 2WP1A 2R0SA 3G0LA 5D0CA 3FKMX 2F6NA 4QSRA 2YDWA 2R0YA 3UV5A 4AKIA 4TZ2A 5D25A 5DKHA 4QC1A 5EK9A 4IR5A 5A7CA 3U5LA
chains in the Genus database with same CATH topology
5A85A 5E9KA 4Z93A 5D3PA 5D7XA 5LJ1A 4PCIA 5DFDA 5EPRA 5D3NA 5CQ7A 5ETDA 3I3JA 4A9EA 5CP5A 4LYSA 4YC9A 5CRZA 4YY6A 4TQNA 5FE8A 4O7FA 5FE6A 5EPSA 4FLPA 5D3RA 4CURA 3ONIA 4Z6IA 5ENEA 3K2JA 5DYAA 4UITA 4TYLA 5CU8A 4TU6A 4PTBA 2RFJA 5FE3A 5EV9A 2N9GA 5F63A 4XY8A 2LSPB 5G4SA 5I29A 4YH3A 4C67A 5H1UA 5A5NA 4PCEA 5FBXA 4A9OA 4TS8A 5KHMA 3UVYA 5E9MA 5IIDA 5HLSA 5EI4A 4LRGA 4CUUA 4XUBA 5L8UA 1JSPB 4UYFB 5D24A 5F1LA 4PY6A 4J0RA 4CUPA 5A5OA 4QEVA 5IG6A 5A81A 1WUGA 5CQAA 4X2IA 5D3LA 4A9NA 4QC3A 3LQIA 5E9VA 4YATA 4BW2A 4QSTA 4QYLA 3O34A 4CUSA 3LQJA 5FDZA 2L5EA 5DFBA 4YAXA 4XYAA 4YYGA 5JWMA 4WHWA 2KTBB 5EWCA 4UYGA 4NR4A 5A5PA 1E6IA 4OGJA 5EA1A 5EWDA 5L97A 5IGLA 4NYWA 5CQTA 5E9IA 2YW5A 4HXMA 4XY9A 4A9LA 5CQ5A 5CQ8A 4NR9A 5D3HA 4ZC9A 5IGMA 5II2A 4IOQA 1F68A 4QSQA 5HJCA 4ZW1A 4BJXA 5KTUA 4UIZA 5EISA 4IOOA 5EPBA 5EWHA 5L98A 3U5JA 2RI7A 4O74A 4PKLA 5F5ZA 4YYMA 5DW2A 2R10A 3U5PA 4NR7A 5K29A 3U5OA 5EWWA 2H60A 5CUCA 4TT2A 3O37A 4KV1A 5ENIA 5F61A 5KTXA 3NXBA 5E3DA 5FE2A 5LJ2A 3QZTA 5I83A 2E7OA 5CQ3A 3P1DA 5D26A 3AQAA 4LZSA 3Q2FA 5CQ6A 2MJVB 4UIXA 4QSWA 5E9YA 2GRCA 4HXOA 5ENFA 5EM3A 5A5RA 3P5OA 4UYDA 5TCMA 5CUGA 5HFQA 4NUDA 5LUUA 5LVRA 4O70A 4YK0A 4MEQA 4NR8A 3UVXA 4UYHA 5I7YA 5HCLA 4YYNA 4LZ2A 5CZGA 4N4HA 4C66A 4HXSA 4A9HA 4HBXA 4MEPA 4HXNA 4N4FA 5DW1A 5A82A 3HMHA 5HQ5A 3LXJA 4NR6A 4O71A 5EVAA 5FB0A 4UIVA 4NYXA 3SVHA 4HBVA 2RNXA 3O33A 4J0SA 5HFRA 5CTLA 3AADA 5C7NA 3HMEA 4E96A 2YEMA 5CQ4A 5E0RA 4O77A 3S91A 4YADA 4BHWA 3TLPA 2I7KA 3P1FA 4Y03A 5DKCA 3DAIA 4HXKA 5AMFA 4MEOA 5FE4A 5D3TA 4WIVA 5C8GA 5FFWA 4YABA 5ENHA 4TTEA 5F3AA 5FH6A 4CLBA 5I88A 4QNSA 5DLXA 4NQMA 4QSUA 4CL9A 5F36A 3UVDA 3MXFA 4ZQLA 4CFKA 5EICA 4OUFA 5F62A 5LKZA 5F1HA 4HXRA 5BT3A 5HENA 4N4IA 2RNYA 5I1QA 3JVKA 5DKDA 5CRMA 5A83A 5I40A 4YYIA 2G4AA 4A9FA 4LYWA 4NRAA 4UIUA 2YQDA 4QSPA 4PS5A 3IU5A 4HXPA 4LC2A 5DBMA 4BW3A 3D7CA 5CUAA 4QR5A 5FH7A 1ZS5A 2OSSA 5ENCA 5KO4A 3O36A 4HBYA 4O72A 5F25A 4N4GA 4XUAA 3JVMA 5A5SA 5HRXA 4Z6HA 5EQ1A 2DATA 5EGUA 5ACYA 3MB3A 3MUKA 4BW1A 5HRWA 4QEWA 5FB1A 4YY4A 3U5KA 2OUOA 4YH4A 2L84A 4OGIA 4QUUA 5LKXA 5C87A 5KU3A 5H1TA 5LKTA 4YBMA 4NYVA 5D3SA 2WP2A 5BT4A 3MB4A 5BT5A 4ALHA 5HELA 5I86A 5L8TA 1X0JA 5DFCA 3SVFA 4TT4A 5II1A 3UV2A 5ENGA 4QR4A 5FG5A 5CUDA 5FFVA 2L85A 5G4RA 4Q0NA 5LKUA 4QR3A 4YBTA 3QZSA 5C4QA 2DVVA 4YYDA 5AD2A 2RNWA 3P1EA 4QUTA 5IBNA 3GG3A 4MR3A 5FE7A 2YELA 4Q0OA 2OO1A 5J0DA 3MQMA 5COIA 3P1CA 4O76A 4O7AA 5FH8A 4IR3A 3LJWA 2DVSA 5AD3A 4WHUA 5E3GA 3ZYUA 5FG6A 5E74A 1JM4B 4A9KA 5EP7A 2YEKA 4O7CA 5F60A 2E3KA 4KCXA 2RS9B 4LDFA 4QEUA 3S92A 4BW4A 4YYKA 5A5QA 3QZVA 5ETBA 5DY7A 3SVGA 1WUMA 3IU6A 4UIYA 5E73A 5ENJA 5E9LA 4LR6A 5H85A 5AMEA 2FSAA 5IGNA 4HBWA 5HQ6A 4QSXA 2I8NA 4NR5A 1N72A 4RVRA 5HEMA 2YYNA 4QBMA 5CPEA 5TB6A 4AKNA 2DVRA 2D9EA 5CY9A 4LYIA 4Z1SA 4YYHA 4KV4A 4A9JA 5F2PA 5HM0A 4O7EA 4O7BA 5DYCA 5LJ0A 3HMFA 4N3WA 4NS5A 2R0VA 4YBSA 1EQFA 3JVJA 2NXBA 4F3IA 5ENBA 3UV4A 4O75A 5DLZA 4QYDA 4QB3A 2RO1A 5DYUA 5EU1A 4UIWA 4IR4A 4A9MA 5CS8A 4CUQA 3U5MA 5DX4A 3UW9A 3RCWA 4QSVA 5C85A 5CFWA 2DKWA 3MULA 4MENA 3UVWA 5CUBA 2DVQA 4O78A 2E7NA 4NQNA 4QSSA 4A9IA 5IGKA 4LZRA 4Z1QA 4TU4A 3DWYA 4HXLA 5C89A 5H1VA 5L99A 4QZSA 5FE1A 4ALGA 5FE5A 4UYFA 4UYEA 5CGPA 4CUTA 3LQHA 5FG4A 5HRVA 5D3JA 4MR6A 4TT6A 4TZ8A 3G0JA 4NXJA 4NUCA 3Q2EA 5I80A 4CFLA 2DWWA 2F6JA 4IORA 5L96A 5JI8A 5EWVA 3JVLA 4YYJA 5FE0A 2D82A 5E7DA 5HQ7A 5FE9A 4IR6A 4NUEA 5I7XA 4NRCA 3U5NA 3O35A 5LVQA 4J1PA 4MR5A 5FFYA 5I89A 5KTWA 4J3IA 4NRBA 4MR4A 5DYXA 4GPJA 5CUEA 4QY4A 4DONA 2WP1A 2R0SA 3G0LA 5D0CA 3FKMX 2F6NA 4QSRA 2YDWA 2R0YA 3UV5A 4TZ2A 5D25A 5DKHA 4QC1A 5EK9A 4IR5A 5A7CA 3U5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A85 A;  5E9K A;  4Z93 A;  5D3P A;  5D7X A;  5LJ1 A;  4PCI A;  5DFD A;  5EPR A;  5D3N A;  5CQ7 A;  5ETD A;  3I3J A;  4A9E A;  5CP5 A;  4LYS A;  4YC9 A;  5CRZ A;  4YY6 A;  4TQN A;  5FE8 A;  4O7F A;  5FE6 A;  5EPS A;  4FLP A;  5D3R A;  4CUR A;  3ONI A;  4Z6I A;  5ENE A;  3K2J A;  5DYA A;  4UIT A;  4TYL A;  5CU8 A;  4TU6 A;  4PTB A;  2RFJ A;  5FE3 A;  5EV9 A;  2N9G A;  5F63 A;  4XY8 A;  2LSP B;  5G4S A;  5I29 A;  4YH3 A;  4C67 A;  5H1U A;  5A5N A;  4PCE A;  5FBX A;  4A9O A;  4TS8 A;  5KHM A;  3UVY A;  5E9M A;  5IID A;  5HLS A;  5EI4 A;  4LRG A;  4CUU A;  4XUB A;  5L8U A;  1JSP B;  4UYF B;  5D24 A;  5F1L A;  4PY6 A;  4J0R A;  4CUP A;  5A5O A;  4QEV A;  5IG6 A;  5A81 A;  1WUG A;  5CQA A;  4X2I A;  5D3L A;  4A9N A;  4QC3 A;  3LQI A;  5E9V A;  4YAT A;  4BW2 A;  4QST A;  4QYL A;  3O34 A;  4CUS A;  3LQJ A;  5FDZ A;  2L5E A;  5DFB A;  4YAX A;  4XYA A;  4YYG A;  5JWM A;  4WHW A;  2KTB B;  5EWC A;  4UYG A;  4NR4 A;  5A5P A;  1E6I A;  4OGJ A;  5EA1 A;  5EWD A;  5L97 A;  5IGL A;  4NYW A;  5CQT A;  5E9I A;  2YW5 A;  4HXM A;  4XY9 A;  4A9L A;  5CQ5 A;  5CQ8 A;  4NR9 A;  5D3H A;  4ZC9 A;  5IGM A;  5II2 A;  4IOQ A;  1F68 A;  4QSQ A;  5HJC A;  4ZW1 A;  4BJX A;  5KTU A;  4UIZ A;  5EIS A;  4IOO A;  5EPB A;  5EWH A;  5L98 A;  3U5J A;  2RI7 A;  4O74 A;  4PKL A;  5F5Z A;  4YYM A;  5DW2 A;  2R10 A;  3U5P A;  4NR7 A;  5K29 A;  3U5O A;  5EWW A;  2H60 A;  5CUC A;  4TT2 A;  3O37 A;  4KV1 A;  5ENI A;  5F61 A;  5KTX A;  3NXB A;  5E3D A;  5FE2 A;  5LJ2 A;  3QZT A;  5I83 A;  2E7O A;  5CQ3 A;  3P1D A;  5D26 A;  3AQA A;  4LZS A;  3Q2F A;  5CQ6 A;  2MJV B;  4UIX A;  4QSW A;  5E9Y A;  2GRC A;  4HXO A;  5ENF A;  5EM3 A;  5A5R A;  3P5O A;  4UYD A;  5TCM A;  5CUG A;  5HFQ A;  4NUD A;  5LUU A;  5LVR A;  4O70 A;  4YK0 A;  4MEQ A;  4NR8 A;  3UVX A;  4UYH A;  5I7Y A;  5HCL A;  4YYN A;  4LZ2 A;  5CZG A;  4N4H A;  4C66 A;  4HXS A;  4A9H A;  4HBX A;  4MEP A;  4HXN A;  4N4F A;  5DW1 A;  5A82 A;  3HMH A;  5HQ5 A;  3LXJ A;  4NR6 A;  4O71 A;  5EVA A;  5FB0 A;  4UIV A;  4NYX A;  3SVH A;  4HBV A;  2RNX A;  3O33 A;  4J0S A;  5HFR A;  5CTL A;  3AAD A;  5C7N A;  3HME A;  4E96 A;  2YEM A;  5CQ4 A;  5E0R A;  4O77 A;  3S91 A;  4YAD A;  4BHW A;  3TLP A;  2I7K A;  3P1F A;  4Y03 A;  5DKC A;  3DAI A;  4HXK A;  5AMF A;  4MEO A;  5FE4 A;  5D3T A;  4WIV A;  5C8G A;  5FFW A;  4YAB A;  5ENH A;  4TTE A;  5F3A A;  5FH6 A;  4CLB A;  5I88 A;  4QNS A;  5DLX A;  4NQM A;  4QSU A;  4CL9 A;  5F36 A;  3UVD A;  3MXF A;  4ZQL A;  4CFK A;  5EIC A;  4OUF A;  5F62 A;  5LKZ A;  5F1H A;  4HXR A;  5BT3 A;  5HEN A;  4N4I A;  2RNY A;  5I1Q A;  3JVK A;  5DKD A;  5CRM A;  5A83 A;  5I40 A;  4YYI A;  2G4A A;  4A9F A;  4LYW A;  4NRA A;  4UIU A;  2YQD A;  4QSP A;  4PS5 A;  3IU5 A;  4HXP A;  4LC2 A;  5DBM A;  4BW3 A;  3D7C A;  5CUA A;  4QR5 A;  5FH7 A;  1ZS5 A;  2OSS A;  5ENC A;  5KO4 A;  3O36 A;  4HBY A;  4O72 A;  5F25 A;  4N4G A;  4XUA A;  3JVM A;  5A5S A;  5HRX A;  4Z6H A;  5EQ1 A;  2DAT A;  5EGU A;  5ACY A;  3MB3 A;  3MUK A;  4BW1 A;  5HRW A;  4QEW A;  5FB1 A;  4YY4 A;  3U5K A;  2OUO A;  4YH4 A;  2L84 A;  4OGI A;  4QUU A;  5LKX A;  5C87 A;  5KU3 A;  5H1T A;  5LKT A;  4YBM A;  4NYV A;  5D3S A;  2WP2 A;  5BT4 A;  3MB4 A;  5BT5 A;  4ALH A;  5HEL A;  5I86 A;  5L8T A;  1X0J A;  5DFC A;  3SVF A;  4TT4 A;  5II1 A;  3UV2 A;  5ENG A;  4QR4 A;  5FG5 A;  5CUD A;  5FFV A;  2L85 A;  5G4R A;  4Q0N A;  5LKU A;  4QR3 A;  4YBT A;  3QZS A;  5C4Q A;  2DVV A;  4YYD A;  5AD2 A;  2RNW A;  3P1E A;  4QUT A;  5IBN A;  3GG3 A;  4MR3 A;  5FE7 A;  2YEL A;  4Q0O A;  2OO1 A;  5J0D A;  3MQM A;  5COI A;  3P1C A;  4O76 A;  4O7A A;  5FH8 A;  4IR3 A;  3LJW A;  2DVS A;  5AD3 A;  4WHU A;  5E3G A;  3ZYU A;  5FG6 A;  5E74 A;  1JM4 B;  4A9K A;  5EP7 A;  2YEK A;  4O7C A;  5F60 A;  2E3K A;  4KCX A;  2RS9 B;  4LDF A;  4QEU A;  3S92 A;  4BW4 A;  4YYK A;  5A5Q A;  3QZV A;  5ETB A;  5DY7 A;  3SVG A;  1WUM A;  3IU6 A;  4UIY A;  5E73 A;  5ENJ A;  5E9L A;  4LR6 A;  5H85 A;  5AME A;  2FSA A;  5IGN A;  4HBW A;  5HQ6 A;  4QSX A;  2I8N A;  4NR5 A;  1N72 A;  4RVR A;  5HEM A;  2YYN A;  4QBM A;  5CPE A;  5TB6 A;  4AKN A;  2DVR A;  2D9E A;  5CY9 A;  4LYI A;  4Z1S A;  4YYH A;  4KV4 A;  4A9J A;  5F2P A;  5HM0 A;  4O7E A;  4O7B A;  5DYC A;  5LJ0 A;  3HMF A;  4N3W A;  4NS5 A;  2R0V A;  4YBS A;  1EQF A;  3JVJ A;  2NXB A;  4F3I A;  5ENB A;  3UV4 A;  4O75 A;  5DLZ A;  4QYD A;  4QB3 A;  2RO1 A;  5DYU A;  5EU1 A;  4UIW A;  4IR4 A;  4A9M A;  5CS8 A;  4CUQ A;  3U5M A;  5DX4 A;  3UW9 A;  3RCW A;  4QSV A;  5C85 A;  5CFW A;  2DKW A;  3MUL A;  4MEN A;  3UVW A;  5CUB A;  2DVQ A;  4O78 A;  2E7N A;  4NQN A;  4QSS A;  4A9I A;  5IGK A;  4LZR A;  4Z1Q A;  4TU4 A;  3DWY A;  4HXL A;  5C89 A;  5H1V A;  5L99 A;  4QZS A;  5FE1 A;  4ALG A;  5FE5 A;  4UYF A;  4UYE A;  5CGP A;  4CUT A;  3LQH A;  5FG4 A;  5HRV A;  5D3J A;  4MR6 A;  4TT6 A;  4TZ8 A;  3G0J A;  4NXJ A;  4NUC A;  3Q2E A;  5I80 A;  4CFL A;  2DWW A;  2F6J A;  4IOR A;  5L96 A;  5JI8 A;  5EWV A;  3JVL A;  4YYJ A;  5FE0 A;  2D82 A;  5E7D A;  5HQ7 A;  5FE9 A;  4IR6 A;  4NUE A;  5I7X A;  4NRC A;  3U5N A;  3O35 A;  5LVQ A;  4J1P A;  4MR5 A;  5FFY A;  5I89 A;  5KTW A;  4J3I A;  4NRB A;  4MR4 A;  5DYX A;  4GPJ A;  5CUE A;  4QY4 A;  4DON A;  2WP1 A;  2R0S A;  3G0L A;  5D0C A;  3FKM X;  2F6N A;  4QSR A;  2YDW A;  2R0Y A;  3UV5 A;  4TZ2 A;  5D25 A;  5DKH A;  4QC1 A;  5EK9 A;  4IR5 A;  5A7C A;  3U5L A; 
#chains in the Genus database with same CATH topology
 5A85 A;  5E9K A;  4Z93 A;  5D3P A;  5D7X A;  5LJ1 A;  4PCI A;  5DFD A;  5EPR A;  5D3N A;  5CQ7 A;  5ETD A;  3I3J A;  4A9E A;  5CP5 A;  4LYS A;  4YC9 A;  5CRZ A;  4YY6 A;  4TQN A;  5FE8 A;  4O7F A;  5FE6 A;  5EPS A;  4FLP A;  5D3R A;  4CUR A;  3ONI A;  4Z6I A;  5ENE A;  3K2J A;  5DYA A;  4UIT A;  4TYL A;  5CU8 A;  4TU6 A;  4PTB A;  2RFJ A;  5FE3 A;  5EV9 A;  2N9G A;  5F63 A;  4XY8 A;  2LSP B;  5G4S A;  5I29 A;  4YH3 A;  4C67 A;  5H1U A;  5A5N A;  4PCE A;  5FBX A;  4A9O A;  4TS8 A;  5KHM A;  3UVY A;  5E9M A;  5IID A;  5HLS A;  5EI4 A;  4LRG A;  4CUU A;  4XUB A;  5L8U A;  1JSP B;  4UYF B;  3VKG A;  5D24 A;  5F1L A;  4PY6 A;  4J0R A;  4CUP A;  5A5O A;  4QEV A;  5IG6 A;  5A81 A;  1WUG A;  5CQA A;  4X2I A;  5D3L A;  4A9N A;  4QC3 A;  3LQI A;  3D1D A;  5E9V A;  4YAT A;  3ERR A;  4BW2 A;  4QST A;  4QYL A;  3O34 A;  4CUS A;  3LQJ A;  5FDZ A;  2L5E A;  5DFB A;  4YAX A;  4XYA A;  4YYG A;  5JWM A;  4WHW A;  2KTB B;  5EWC A;  4UYG A;  4NR4 A;  5A5P A;  1E6I A;  4OGJ A;  5EA1 A;  5EWD A;  5L97 A;  5IGL A;  4NYW A;  5CQT A;  5E9I A;  2YW5 A;  4HXM A;  4XY9 A;  4A9L A;  5CQ5 A;  5CQ8 A;  4NR9 A;  5D3H A;  4ZC9 A;  5IGM A;  5II2 A;  4IOQ A;  1F68 A;  4QSQ A;  5HJC A;  4ZW1 A;  4BJX A;  5KTU A;  4UIZ A;  5EIS A;  4IOO A;  5EPB A;  5EWH A;  5L98 A;  3U5J A;  2RI7 A;  4O74 A;  4PKL A;  5F5Z A;  4YYM A;  5DW2 A;  2R10 A;  3U5P A;  4NR7 A;  5K29 A;  3U5O A;  5EWW A;  2H60 A;  5CUC A;  4TT2 A;  3O37 A;  4KV1 A;  5ENI A;  5F61 A;  5KTX A;  3NXB A;  5E3D A;  5FE2 A;  5LJ2 A;  3QZT A;  5I83 A;  2E7O A;  5CQ3 A;  3P1D A;  5D26 A;  3AQA A;  4LZS A;  3Q2F A;  5CQ6 A;  2MJV B;  4UIX A;  4QSW A;  5E9Y A;  2GRC A;  4HXO A;  5ENF A;  5EM3 A;  5A5R A;  3P5O A;  4UYD A;  5TCM A;  5CUG A;  5HFQ A;  4NUD A;  5LUU A;  5LVR A;  4O70 A;  4YK0 A;  4MEQ A;  4NR8 A;  3UVX A;  4UYH A;  5I7Y A;  5HCL A;  4YYN A;  4LZ2 A;  5CZG A;  4N4H A;  4C66 A;  4HXS A;  4A9H A;  4HBX A;  4MEP A;  4HXN A;  4N4F A;  5DW1 A;  5A82 A;  3HMH A;  5HQ5 A;  3LXJ A;  4NR6 A;  4O71 A;  5EVA A;  5FB0 A;  4UIV A;  4NYX A;  3SVH A;  4HBV A;  2RNX A;  3O33 A;  4J0S A;  5HFR A;  5CTL A;  3AAD A;  5C7N A;  3HME A;  4E96 A;  2YEM A;  5CQ4 A;  5E0R A;  4O77 A;  3S91 A;  4YAD A;  4BHW A;  3TLP A;  2I7K A;  3P1F A;  4Y03 A;  5DKC A;  3DAI A;  4HXK A;  5AMF A;  4MEO A;  5FE4 A;  5D3T A;  4WIV A;  5C8G A;  5FFW A;  4YAB A;  5ENH A;  4TTE A;  5F3A A;  5FH6 A;  4CLB A;  5I88 A;  4QNS A;  5DLX A;  4NQM A;  4QSU A;  4CL9 A;  5F36 A;  3UVD A;  3MXF A;  4ZQL A;  4AKG A;  1PUO A;  4CFK A;  5EIC A;  4OUF A;  5F62 A;  5LKZ A;  5F1H A;  4HXR A;  5BT3 A;  5HEN A;  4N4I A;  2RNY A;  5I1Q A;  3JVK A;  5DKD A;  5CRM A;  5A83 A;  5I40 A;  4YYI A;  2G4A A;  4A9F A;  4LYW A;  4NRA A;  4UIU A;  2YQD A;  4QSP A;  4PS5 A;  3IU5 A;  4HXP A;  4LC2 A;  5DBM A;  4BW3 A;  3D7C A;  5CUA A;  4QR5 A;  5FH7 A;  1ZS5 A;  2OSS A;  5ENC A;  5KO4 A;  3O36 A;  4HBY A;  4O72 A;  5F25 A;  4N4G A;  4XUA A;  3JVM A;  5A5S A;  5HRX A;  4Z6H A;  5EQ1 A;  2DAT A;  5EGU A;  5ACY A;  3MB3 A;  3MUK A;  4BW1 A;  5HRW A;  4QEW A;  5FB1 A;  4YY4 A;  3U5K A;  2OUO A;  4YH4 A;  2L84 A;  4OGI A;  4QUU A;  5LKX A;  5C87 A;  5KU3 A;  5H1T A;  5LKT A;  4YBM A;  4NYV A;  5D3S A;  2WP2 A;  5BT4 A;  3MB4 A;  5BT5 A;  4ALH A;  5HEL A;  5I86 A;  5L8T A;  1X0J A;  5DFC A;  3SVF A;  4TT4 A;  5II1 A;  3UV2 A;  5ENG A;  4QR4 A;  5FG5 A;  5CUD A;  5FFV A;  2L85 A;  5G4R A;  4Q0N A;  5LKU A;  4QR3 A;  4YBT A;  3QZS A;  5C4Q A;  2DVV A;  4YYD A;  5AD2 A;  2RNW A;  3P1E A;  4QUT A;  5IBN A;  3GG3 A;  4MR3 A;  5FE7 A;  2YEL A;  4Q0O A;  2OO1 A;  5J0D A;  3MQM A;  5COI A;  3P1C A;  4O76 A;  4AKH A;  4O7A A;  5FH8 A;  4IR3 A;  3LJW A;  2DVS A;  5AD3 A;  4WHU A;  5E3G A;  3ZYU A;  5FG6 A;  5E74 A;  1JM4 B;  4A9K A;  5EP7 A;  3VKH A;  2YEK A;  4O7C A;  5F60 A;  2E3K A;  4KCX A;  2RS9 B;  4LDF A;  4QEU A;  3S92 A;  4BW4 A;  4YYK A;  5A5Q A;  3QZV A;  5ETB A;  5DY7 A;  3SVG A;  1WUM A;  3IU6 A;  4UIY A;  5E73 A;  5ENJ A;  5E9L A;  4LR6 A;  5H85 A;  5AME A;  2FSA A;  5IGN A;  4HBW A;  5HQ6 A;  4QSX A;  2I8N A;  4NR5 A;  1N72 A;  4RVR A;  4AI6 A;  5HEM A;  2YYN A;  4QBM A;  5CPE A;  5TB6 A;  4AKN A;  2DVR A;  2D9E A;  5CY9 A;  4LYI A;  4Z1S A;  4YYH A;  4KV4 A;  4A9J A;  5F2P A;  5HM0 A;  4O7E A;  4O7B A;  5DYC A;  5LJ0 A;  3HMF A;  4N3W A;  4NS5 A;  2R0V A;  4YBS A;  1EQF A;  2NXB A;  3JVJ A;  4F3I A;  5ENB A;  3UV4 A;  4O75 A;  1ZKR A;  4QYD A;  5DLZ A;  4QB3 A;  2RO1 A;  5DYU A;  5EU1 A;  4UIW A;  4IR4 A;  4A9M A;  5CS8 A;  4CUQ A;  3U5M A;  5DX4 A;  2EJN A;  3UW9 A;  3RCW A;  4QSV A;  5C85 A;  5CFW A;  2DKW A;  3MUL A;  4MEN A;  3UVW A;  5CUB A;  2DVQ A;  4O78 A;  2E7N A;  4NQN A;  4QSS A;  4A9I A;  5IGK A;  4LZR A;  4Z1Q A;  4TU4 A;  3DWY A;  4HXL A;  5C89 A;  5H1V A;  5L99 A;  4QZS A;  5FE1 A;  4ALG A;  5FE5 A;  4UYF A;  4UYE A;  5CGP A;  4CUT A;  3LQH A;  5FG4 A;  5HRV A;  5D3J A;  4MR6 A;  4TT6 A;  4TZ8 A;  3G0J A;  4NXJ A;  4NUC A;  3Q2E A;  5I80 A;  4CFL A;  2DWW A;  2F6J A;  4IOR A;  5L96 A;  3D1B A;  5JI8 A;  5EWV A;  3JVL A;  4YYJ A;  5FE0 A;  2D82 A;  5E7D A;  5HQ7 A;  5FE9 A;  4IR6 A;  4NUE A;  5I7X A;  4NRC A;  3U5N A;  3O35 A;  5LVQ A;  4J1P A;  4MR5 A;  5FFY A;  5I89 A;  5KTW A;  4J3I A;  4NRB A;  4MR4 A;  5DYX A;  4GPJ A;  5CUE A;  4QY4 A;  4DON A;  2WP1 A;  2R0S A;  3G0L A;  5D0C A;  3FKM X;  2F6N A;  4QSR A;  2YDW A;  2R0Y A;  3UV5 A;  4AKI A;  4TZ2 A;  5D25 A;  5DKH A;  4QC1 A;  5EK9 A;  4IR5 A;  5A7C A;  3U5L A; 
#chains in the Genus database with same CATH homology
 5A85 A;  5E9K A;  4Z93 A;  5D3P A;  5D7X A;  5LJ1 A;  4PCI A;  5DFD A;  5EPR A;  5D3N A;  5CQ7 A;  5ETD A;  3I3J A;  4A9E A;  5CP5 A;  4LYS A;  4YC9 A;  5CRZ A;  4YY6 A;  4TQN A;  5FE8 A;  4O7F A;  5FE6 A;  5EPS A;  4FLP A;  5D3R A;  4CUR A;  3ONI A;  4Z6I A;  5ENE A;  3K2J A;  5DYA A;  4UIT A;  4TYL A;  5CU8 A;  4TU6 A;  4PTB A;  2RFJ A;  5FE3 A;  5EV9 A;  2N9G A;  5F63 A;  4XY8 A;  2LSP B;  5G4S A;  5I29 A;  4YH3 A;  4C67 A;  5H1U A;  5A5N A;  4PCE A;  5FBX A;  4A9O A;  4TS8 A;  5KHM A;  3UVY A;  5E9M A;  5IID A;  5HLS A;  5EI4 A;  4LRG A;  4CUU A;  4XUB A;  5L8U A;  1JSP B;  4UYF B;  5D24 A;  5F1L A;  4PY6 A;  4J0R A;  4CUP A;  5A5O A;  4QEV A;  5IG6 A;  5A81 A;  1WUG A;  5CQA A;  4X2I A;  5D3L A;  4A9N A;  4QC3 A;  3LQI A;  5E9V A;  4YAT A;  4BW2 A;  4QST A;  4QYL A;  3O34 A;  4CUS A;  3LQJ A;  5FDZ A;  2L5E A;  5DFB A;  4YAX A;  4XYA A;  4YYG A;  5JWM A;  4WHW A;  2KTB B;  5EWC A;  4UYG A;  4NR4 A;  5A5P A;  1E6I A;  4OGJ A;  5EA1 A;  5EWD A;  5L97 A;  5IGL A;  4NYW A;  5CQT A;  5E9I A;  2YW5 A;  4HXM A;  4XY9 A;  4A9L A;  5CQ5 A;  5CQ8 A;  4NR9 A;  5D3H A;  4ZC9 A;  5IGM A;  5II2 A;  4IOQ A;  1F68 A;  4QSQ A;  5HJC A;  4ZW1 A;  4BJX A;  5KTU A;  4UIZ A;  5EIS A;  4IOO A;  5EPB A;  5EWH A;  5L98 A;  3U5J A;  2RI7 A;  4O74 A;  4PKL A;  5F5Z A;  4YYM A;  5DW2 A;  2R10 A;  3U5P A;  4NR7 A;  5K29 A;  3U5O A;  5EWW A;  2H60 A;  5CUC A;  4TT2 A;  3O37 A;  4KV1 A;  5ENI A;  5F61 A;  5KTX A;  3NXB A;  5E3D A;  5FE2 A;  5LJ2 A;  3QZT A;  5I83 A;  2E7O A;  5CQ3 A;  3P1D A;  5D26 A;  3AQA A;  4LZS A;  3Q2F A;  5CQ6 A;  2MJV B;  4UIX A;  4QSW A;  5E9Y A;  2GRC A;  4HXO A;  5ENF A;  5EM3 A;  5A5R A;  3P5O A;  4UYD A;  5TCM A;  5CUG A;  5HFQ A;  4NUD A;  5LUU A;  5LVR A;  4O70 A;  4YK0 A;  4MEQ A;  4NR8 A;  3UVX A;  4UYH A;  5I7Y A;  5HCL A;  4YYN A;  4LZ2 A;  5CZG A;  4N4H A;  4C66 A;  4HXS A;  4A9H A;  4HBX A;  4MEP A;  4HXN A;  4N4F A;  5DW1 A;  5A82 A;  3HMH A;  5HQ5 A;  3LXJ A;  4NR6 A;  4O71 A;  5EVA A;  5FB0 A;  4UIV A;  4NYX A;  3SVH A;  4HBV A;  2RNX A;  3O33 A;  4J0S A;  5HFR A;  5CTL A;  3AAD A;  5C7N A;  3HME A;  4E96 A;  2YEM A;  5CQ4 A;  5E0R A;  4O77 A;  3S91 A;  4YAD A;  4BHW A;  3TLP A;  2I7K A;  3P1F A;  4Y03 A;  5DKC A;  3DAI A;  4HXK A;  5AMF A;  4MEO A;  5FE4 A;  5D3T A;  4WIV A;  5C8G A;  5FFW A;  4YAB A;  5ENH A;  4TTE A;  5F3A A;  5FH6 A;  4CLB A;  5I88 A;  4QNS A;  5DLX A;  4NQM A;  4QSU A;  4CL9 A;  5F36 A;  3UVD A;  3MXF A;  4ZQL A;  4CFK A;  5EIC A;  4OUF A;  5F62 A;  5LKZ A;  5F1H A;  4HXR A;  5BT3 A;  5HEN A;  4N4I A;  2RNY A;  5I1Q A;  3JVK A;  5DKD A;  5CRM A;  5A83 A;  5I40 A;  4YYI A;  2G4A A;  4A9F A;  4LYW A;  4NRA A;  4UIU A;  2YQD A;  4QSP A;  4PS5 A;  3IU5 A;  4HXP A;  4LC2 A;  5DBM A;  4BW3 A;  3D7C A;  5CUA A;  4QR5 A;  5FH7 A;  1ZS5 A;  2OSS A;  5ENC A;  5KO4 A;  3O36 A;  4HBY A;  4O72 A;  5F25 A;  4N4G A;  4XUA A;  3JVM A;  5A5S A;  5HRX A;  4Z6H A;  5EQ1 A;  2DAT A;  5EGU A;  5ACY A;  3MB3 A;  3MUK A;  4BW1 A;  5HRW A;  4QEW A;  5FB1 A;  4YY4 A;  3U5K A;  2OUO A;  4YH4 A;  2L84 A;  4OGI A;  4QUU A;  5LKX A;  5C87 A;  5KU3 A;  5H1T A;  5LKT A;  4YBM A;  4NYV A;  5D3S A;  2WP2 A;  5BT4 A;  3MB4 A;  5BT5 A;  4ALH A;  5HEL A;  5I86 A;  5L8T A;  1X0J A;  5DFC A;  3SVF A;  4TT4 A;  5II1 A;  3UV2 A;  5ENG A;  4QR4 A;  5FG5 A;  5CUD A;  5FFV A;  2L85 A;  5G4R A;  4Q0N A;  5LKU A;  4QR3 A;  4YBT A;  3QZS A;  5C4Q A;  2DVV A;  4YYD A;  5AD2 A;  2RNW A;  3P1E A;  4QUT A;  5IBN A;  3GG3 A;  4MR3 A;  5FE7 A;  2YEL A;  4Q0O A;  2OO1 A;  5J0D A;  3MQM A;  5COI A;  3P1C A;  4O76 A;  4O7A A;  5FH8 A;  4IR3 A;  3LJW A;  2DVS A;  5AD3 A;  4WHU A;  5E3G A;  3ZYU A;  5FG6 A;  5E74 A;  1JM4 B;  4A9K A;  5EP7 A;  2YEK A;  4O7C A;  5F60 A;  2E3K A;  4KCX A;  2RS9 B;  4LDF A;  4QEU A;  3S92 A;  4BW4 A;  4YYK A;  5A5Q A;  3QZV A;  5ETB A;  5DY7 A;  3SVG A;  1WUM A;  3IU6 A;  4UIY A;  5E73 A;  5ENJ A;  5E9L A;  4LR6 A;  5H85 A;  5AME A;  2FSA A;  5IGN A;  4HBW A;  5HQ6 A;  4QSX A;  2I8N A;  4NR5 A;  1N72 A;  4RVR A;  5HEM A;  2YYN A;  4QBM A;  5CPE A;  5TB6 A;  4AKN A;  2DVR A;  2D9E A;  5CY9 A;  4LYI A;  4Z1S A;  4YYH A;  4KV4 A;  4A9J A;  5F2P A;  5HM0 A;  4O7E A;  4O7B A;  5DYC A;  5LJ0 A;  3HMF A;  4N3W A;  4NS5 A;  2R0V A;  4YBS A;  1EQF A;  3JVJ A;  2NXB A;  4F3I A;  5ENB A;  3UV4 A;  4O75 A;  5DLZ A;  4QYD A;  4QB3 A;  2RO1 A;  5DYU A;  5EU1 A;  4UIW A;  4IR4 A;  4A9M A;  5CS8 A;  4CUQ A;  3U5M A;  5DX4 A;  3UW9 A;  3RCW A;  4QSV A;  5C85 A;  5CFW A;  2DKW A;  3MUL A;  4MEN A;  3UVW A;  5CUB A;  2DVQ A;  4O78 A;  2E7N A;  4NQN A;  4QSS A;  4A9I A;  5IGK A;  4LZR A;  4Z1Q A;  4TU4 A;  3DWY A;  4HXL A;  5C89 A;  5H1V A;  5L99 A;  4QZS A;  5FE1 A;  4ALG A;  5FE5 A;  4UYF A;  4UYE A;  5CGP A;  4CUT A;  3LQH A;  5FG4 A;  5HRV A;  5D3J A;  4MR6 A;  4TT6 A;  4TZ8 A;  3G0J A;  4NXJ A;  4NUC A;  3Q2E A;  5I80 A;  4CFL A;  2DWW A;  2F6J A;  4IOR A;  5L96 A;  5JI8 A;  5EWV A;  3JVL A;  4YYJ A;  5FE0 A;  2D82 A;  5E7D A;  5HQ7 A;  5FE9 A;  4IR6 A;  4NUE A;  5I7X A;  4NRC A;  3U5N A;  3O35 A;  5LVQ A;  4J1P A;  4MR5 A;  5FFY A;  5I89 A;  5KTW A;  4J3I A;  4NRB A;  4MR4 A;  5DYX A;  4GPJ A;  5CUE A;  4QY4 A;  4DON A;  2WP1 A;  2R0S A;  3G0L A;  5D0C A;  3FKM X;  2F6N A;  4QSR A;  2YDW A;  2R0Y A;  3UV5 A;  4TZ2 A;  5D25 A;  5DKH A;  4QC1 A;  5EK9 A;  4IR5 A;  5A7C A;  3U5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...