5EWCA

Crystal structure of the human brpf1 bromodomain in complex with seed17
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ewcA00
4PS5A 3LXJA 3IU5A 2RNXA 5L8UA 4A9NA 5C87A 5E9LA 5E3GA 4A9LA 4QC3A 5D3JA 2DKWA 3NXBA 5H1VA 4LYWA 1N72A 5CQ8A 5CUAA 5A82A 4MEOA 4E96A 4IOOA 4HXNA 5CRZA 3U5KA 5LKZA 4BW1A 5CZGA 4WHWA 5LJ2A 5DYAA 5E9VA 4XY8A 5EICA 4PCIA 4YH4A 4CFKA 5I89A 4MR6A 5F1HA 4HBYA 5I1QA 2R0YA 5EWVA 5DKDA 4QNSA 3GG3A 5F36A 5HFQA 4IR4A 4QEUA 4NS5A 3JVKA 3U5OA 4UYDA 2YW5A 3P1DA 5D3PA 4MR5A 4NQNA 4YYHA 5I83A 5F25A 4BHWA 4J0SA 4XUAA 4A9MA 5LKXA 5FH8A 5E9MA 2N9GA 4AKNA 5I80A 4TTEA 4Z93A 2GRCA 4NR5A 4YYNA 5EV9A 3O34A 5AMFA 5F2PA 4Z6HA 5ENEA 5FE9A 4WIVA 5ENIA 3JVLA 4O74A 4HXLA 5KTUA 5E9KA 2YDWA 4UIXA 5EM3A 4CUTA 5COIA 1JM4B 4DONA 5LJ0A 3P5OA 4QC1A 5A5RA 4UYFB 5D26A 4QUTA 5C89A 5FG5A 3JVJA 4YABA 5A5SA 4Z6IA 5D25A 4HXSA 2I8NA 4YATA 5ENHA 5D24A 5L96A 5F63A 3U5JA 3UV2A 3LQIA 3UVYA 5CUCA 5E0RA 4C66A 5CY9A 5CUEA 5EGUA 3FKMX 5FE7A 4TQNA 5A5QA 4QR3A 4ZQLA 5EPRA 3UVWA 4FLPA 1WUMA 4YH3A 5DBMA 4CFLA 5HRXA 2DVSA 5FE1A 4YYMA 5AD3A 5L97A 4O7FA 4UYEA 5E73A 5ENBA 4BW2A 5LKUA 4IOQA 4J1PA 4NQMA 2WP1A 5DFCA 5IGNA 4GPJA 3JVMA 4QYLA 4O78A 4OUFA 2DWWA 4PY6A 5AD2A 3P1CA 4BW3A 3D7CA 5D7XA 5FDZA 1EQFA 5EISA 5IGKA 3AADA 5TB6A 3U5MA 5EU1A 5FFYA 5KHMA 4NXJA 5CGPA 5HFRA 4QSWA 2MJVB 5ENFA 3U5PA 4NR6A 5HEMA 3S91A 5I88A 3AQAA 5ETBA 4MR4A 5CUGA 4YBTA 2YQDA 5DLZA 4IR6A 3RCWA 4XY9A 4ALHA 4UIUA 4NR7A 5DYXA 5ENJA 2DVQA 5DFDA 1WUGA 4O72A 5FFWA 4O70A 4YBSA 4QSVA 4TT4A 4UIVA 2OUOA 5EWCA 2E7OA 5II2A 5L99A 5I86A 5FBXA 4NYWA 2YEMA 5HQ6A 5LVQA 2R0SA 5D0CA 3I3JA 5DYUA 4NR4A 4YK0A 4QSQA 4N4FA 2H60A 4J0RA 5D3RA 4IR3A 3Q2EA 5EK9A 3MXFA 4NYXA 4HXPA 4QEVA 4BW4A 4QSRA 5KTXA 5C85A 5CRMA 5E3DA 5EQ1A 5DW1A 5CQAA 4HBXA 5DFBA 3DAIA 4TZ2A 2RO1A 5H1TA 4UYGA 4YBMA 5CS8A 5CU8A 5BT4A 4QSXA 5FE5A 3DWYA 2RI7A 3IU6A 4A9HA 5HRWA 4UYHA 5I29A 4TZ8A 5HRVA 4C67A 5KTWA 4O75A 4CUSA 3MB3A 5H85A 5FE0A 5LVRA 4KV4A 2RNYA 2NXBA 3HMEA 5EA1A 4O7EA 5FH7A 2E3KA 3SVGA 5EWHA 5JI8A 4X2IA 5EWDA 4UITA 4QR4A 5II1A 5D3SA 3HMHA 5F1LA 4TYLA 4PTBA 4LZ2A 3O37A 4NUDA 3P1EA 5CP5A 3UW9A 3QZSA 1ZS5A 4A9JA 4A9IA 5FE4A 5FH6A 5A81A 5EP7A 3S92A 3U5NA 3LQJA 4O77A 5HLSA 5F5ZA 3U5LA 4N4IA 4Q0OA 5G4RA 5G4SA 5I7XA 2YEKA 2G4AA 4N4HA 5CQTA 3ZYUA 2FSAA 5CUDA 4CUQA 3QZTA 5CQ5A 2YYNA 4O7BA 5DKCA 5FG6A 2R10A 5DX4A 4LR6A 5CQ4A 5CQ7A 4UIZA 4QEWA 5F60A 4QYDA 4BJXA 3P1FA 5DY7A 5BT3A 4HBWA 5FB1A 3G0LA 4NR9A 3SVFA 4TU4A 5LKTA 3LQHA 5CUBA 3MUKA 4Q0NA 5DLXA 5IGLA 5D3LA 5HQ5A 5F62A 5CPEA 5EVAA 5CTLA 5E74A 4F3IA 5C8GA 4ZW1A 4Z1QA 5KU3A 4PKLA 4N3WA 4QR5A 5CQ3A 4QSTA 4TU6A 4QSUA 4UIWA 5FFVA 2D82A 4KCXA 4QZSA 4YADA 5D3HA 5C4QA 5F61A 4O7CA 4HXOA 5E7DA 5AMEA 5HCLA 4MR3A 5DW2A 2DVVA 5A85A 5LJ1A 2F6JA 4QUUA 4LYSA 4KV1A 4RVRA 5BT5A 4YC9A 2D9EA 5EWWA 3UV5A 5I7YA 5FG4A 4YYGA 4A9EA 5LUUA 4HBVA 4MEPA 4XYAA 5K29A 2L5EA 4IORA 4HXKA 4YYJA 2RFJA 2E7NA 2L84A 2R0VA 4NR8A 2RNWA 4NUEA 5L8TA 5DKHA 5HENA 3K2JA 3TLPA 5A5PA 3HMFA 4O71A 3UVDA 5ENCA 4YY6A 4NUCA 5A5NA 5HM0A 4QY4A 5ETDA 4A9FA 4MEQA 4J3IA 3SVHA 5A5OA 5I40A 5HQ7A 2DVRA 2RS9B 5CQ6A 4CL9A 5CFWA 2OO1A 1F68A 4YAXA 4O7AA 3Q2FA 4Y03A 5IBNA 1E6IA 4UYFA 3LJWA 2L85A 3MULA 4ZC9A 3UVXA 3O33A 5IGMA 5FE2A 4LZSA 4QSPA 4QBMA 5A7CA 5E9IA 4QB3A 4QSSA 4CURA 3O36A 3O35A 4YYKA 2F6NA 4ALGA 4N4GA 4NRBA 5TCMA 4NRCA 5E9YA 1X0JA 3ONIA 4TT2A 4HXRA 5HJCA 2LSPB 4NRAA 3MQMA 4CUPA 4CUUA 5ACYA 5EI4A 5FE8A 5FE6A 3UV4A 4UIYA 5JWMA 5J0DA 5FE3A 5A83A 5H1UA 4YYIA 5FB0A 5ENGA 4OGJA 4LYIA 4LDFA 1JSPB 4TS8A 4YY4A 3MB4A 4Z1SA 5EPSA 5HELA 4OGIA 4A9KA 5IIDA 4TT6A 3G0JA 4LC2A 5DYCA 5EPBA 5C7NA 4LZRA 4MENA 4IR5A 5D3NA 4A9OA 4YYDA 2I7KA 5IG6A 4O76A 2WP2A 4CLBA 2OSSA 5F3AA 4PCEA 5L98A 5KO4A 2KTBB 2DATA 4LRGA 4XUBA 2YELA 5D3TA 3QZVA 4NYVA 4WHUA 4HXMA
chains in the Genus database with same CATH superfamily
4PS5A 3LXJA 3IU5A 2RNXA 5L8UA 4A9NA 5C87A 4AKIA 5E9LA 5E3GA 4A9LA 4QC3A 5D3JA 2DKWA 3NXBA 5H1VA 4LYWA 1N72A 5CQ8A 5CUAA 5A82A 4MEOA 4E96A 4IOOA 4HXNA 5CRZA 3U5KA 5LKZA 4BW1A 5CZGA 4WHWA 5LJ2A 5DYAA 5E9VA 4XY8A 5EICA 4PCIA 4YH4A 4CFKA 5I89A 4MR6A 5F1HA 4HBYA 5I1QA 2EJNA 2R0YA 5EWVA 5DKDA 4QNSA 3GG3A 5F36A 5HFQA 4IR4A 4QEUA 4NS5A 3JVKA 3U5OA 4UYDA 2YW5A 3P1DA 5D3PA 4MR5A 4NQNA 4YYHA 5I83A 3D1DA 5F25A 4BHWA 4J0SA 1PUOA 4XUAA 4A9MA 5LKXA 5FH8A 5E9MA 2N9GA 4AKNA 5I80A 4TTEA 4Z93A 2GRCA 4NR5A 4YYNA 5EV9A 3O34A 5AMFA 5F2PA 4Z6HA 5ENEA 5FE9A 4WIVA 5ENIA 3JVLA 4O74A 4HXLA 5KTUA 5E9KA 2YDWA 4UIXA 5EM3A 4CUTA 5COIA 1JM4B 4DONA 5LJ0A 3P5OA 4QC1A 5A5RA 4UYFB 5D26A 4QUTA 5C89A 5FG5A 3JVJA 4YABA 5A5SA 4Z6IA 5D25A 4HXSA 2I8NA 4YATA 5ENHA 5D24A 5L96A 5F63A 3U5JA 3UV2A 3LQIA 3UVYA 5CUCA 5E0RA 4C66A 5CY9A 5CUEA 5EGUA 3D1BA 3FKMX 4TQNA 5FE7A 5A5QA 4QR3A 4ZQLA 5EPRA 3UVWA 4FLPA 1WUMA 4YH3A 5DBMA 4CFLA 5HRXA 2DVSA 5FE1A 4YYMA 5AD3A 5L97A 4O7FA 4UYEA 5E73A 5ENBA 4BW2A 5LKUA 4IOQA 4J1PA 4NQMA 2WP1A 5DFCA 5IGNA 4GPJA 3JVMA 4QYLA 4O78A 4OUFA 2DWWA 4PY6A 5AD2A 3P1CA 4BW3A 3D7CA 5D7XA 5FDZA 1EQFA 5EISA 5IGKA 3AADA 5TB6A 3U5MA 5EU1A 5FFYA 5KHMA 4NXJA 5CGPA 5HFRA 4QSWA 2MJVB 5ENFA 3U5PA 4NR6A 5HEMA 3S91A 5I88A 3AQAA 5ETBA 4MR4A 5CUGA 4YBTA 2YQDA 5DLZA 4IR6A 3RCWA 4XY9A 4ALHA 4UIUA 4NR7A 5DYXA 5ENJA 2DVQA 5DFDA 1WUGA 4O72A 5FFWA 4O70A 4YBSA 4QSVA 4TT4A 4UIVA 2OUOA 5EWCA 2E7OA 5II2A 5L99A 5I86A 5FBXA 4NYWA 2YEMA 5HQ6A 5LVQA 2R0SA 5D0CA 3I3JA 5DYUA 4NR4A 4YK0A 4QSQA 4N4FA 2H60A 4J0RA 5D3RA 4IR3A 3Q2EA 5EK9A 3MXFA 4NYXA 4HXPA 4QEVA 4BW4A 4QSRA 5KTXA 5C85A 5CRMA 5E3DA 5EQ1A 5DW1A 5CQAA 4HBXA 5DFBA 3DAIA 4TZ2A 2RO1A 5H1TA 4UYGA 4YBMA 5CS8A 5CU8A 5BT4A 4QSXA 5FE5A 3DWYA 2RI7A 3IU6A 4A9HA 5HRWA 4UYHA 5I29A 4TZ8A 5HRVA 4C67A 5KTWA 4O75A 4CUSA 3MB3A 5H85A 5FE0A 5LVRA 4KV4A 2RNYA 2NXBA 3HMEA 5EA1A 4O7EA 5FH7A 2E3KA 3SVGA 5EWHA 5JI8A 4X2IA 5EWDA 4UITA 4QR4A 5II1A 5D3SA 3HMHA 5F1LA 4TYLA 4PTBA 4LZ2A 3O37A 4NUDA 3P1EA 5CP5A 3UW9A 3QZSA 1ZS5A 4A9JA 4A9IA 3VKHA 5FE4A 5FH6A 5A81A 5EP7A 3S92A 3U5NA 3LQJA 4O77A 5HLSA 5F5ZA 3U5LA 4AKHA 4N4IA 4Q0OA 5G4RA 5G4SA 5I7XA 2YEKA 2G4AA 4N4HA 5CQTA 3ZYUA 2FSAA 3VKGA 5CUDA 4CUQA 3QZTA 5CQ5A 2YYNA 4O7BA 5DKCA 5FG6A 2R10A 5DX4A 4LR6A 5CQ4A 5CQ7A 4UIZA 4QEWA 5F60A 4QYDA 4BJXA 3P1FA 5DY7A 5BT3A 4HBWA 5FB1A 3G0LA 4NR9A 3SVFA 4TU4A 5LKTA 3LQHA 5CUBA 3MUKA 4Q0NA 5DLXA 5IGLA 5D3LA 5HQ5A 4AKGA 5F62A 5CPEA 5EVAA 5CTLA 5E74A 4F3IA 5C8GA 4ZW1A 4Z1QA 5KU3A 4PKLA 4N3WA 4QR5A 5CQ3A 4QSTA 4TU6A 4QSUA 4UIWA 5FFVA 2D82A 4KCXA 4QZSA 4YADA 5D3HA 5C4QA 5F61A 4O7CA 4HXOA 5E7DA 5AMEA 5HCLA 4MR3A 5DW2A 2DVVA 5A85A 5LJ1A 2F6JA 4QUUA 4LYSA 4KV1A 4RVRA 5BT5A 4YC9A 2D9EA 5EWWA 3UV5A 5I7YA 5FG4A 4YYGA 4A9EA 5LUUA 4HBVA 4MEPA 4XYAA 5K29A 2L5EA 4IORA 4HXKA 4YYJA 2RFJA 2E7NA 2L84A 2R0VA 4NR8A 2RNWA 4NUEA 5L8TA 5DKHA 5HENA 3K2JA 3TLPA 5A5PA 3HMFA 4O71A 3UVDA 5ENCA 4YY6A 4NUCA 5A5NA 5HM0A 4QY4A 5ETDA 4A9FA 4MEQA 4J3IA 3SVHA 5A5OA 5I40A 5HQ7A 2DVRA 2RS9B 5CQ6A 4CL9A 5CFWA 2OO1A 1F68A 4YAXA 4O7AA 3Q2FA 4Y03A 5IBNA 1E6IA 4UYFA 3LJWA 2L85A 3MULA 4ZC9A 3UVXA 3O33A 5IGMA 5FE2A 4LZSA 4QSPA 4QBMA 5A7CA 3ERRA 5E9IA 4QB3A 4QSSA 4CURA 3O36A 3O35A 4YYKA 2F6NA 4ALGA 4N4GA 4AI6A 4NRBA 5TCMA 1ZKRA 4NRCA 5E9YA 1X0JA 3ONIA 4TT2A 4HXRA 5HJCA 2LSPB 4NRAA 3MQMA 4CUPA 4CUUA 5ACYA 5EI4A 5FE8A 5FE6A 3UV4A 4UIYA 5JWMA 5J0DA 5FE3A 5A83A 5H1UA 4YYIA 5FB0A 5ENGA 4OGJA 4LYIA 4LDFA 1JSPB 4TS8A 4YY4A 3MB4A 4Z1SA 5EPSA 5HELA 4OGIA 4A9KA 5IIDA 4TT6A 3G0JA 4LC2A 5DYCA 5EPBA 5C7NA 4LZRA 4MENA 4IR5A 5D3NA 4A9OA 4YYDA 2I7KA 5IG6A 4O76A 2WP2A 4CLBA 2OSSA 5F3AA 4PCEA 5L98A 5KO4A 2KTBB 2DATA 4LRGA 4XUBA 2YELA 5D3TA 3QZVA 4NYVA 4WHUA 4HXMA
chains in the Genus database with same CATH topology
4PS5A 3LXJA 3IU5A 2RNXA 5L8UA 4A9NA 5C87A 5E9LA 5E3GA 4A9LA 4QC3A 5D3JA 2DKWA 3NXBA 5H1VA 4LYWA 1N72A 5CQ8A 5CUAA 5A82A 4MEOA 4E96A 4IOOA 4HXNA 5CRZA 3U5KA 5LKZA 4BW1A 5CZGA 4WHWA 5LJ2A 5DYAA 5E9VA 4XY8A 5EICA 4PCIA 4YH4A 4CFKA 5I89A 4MR6A 5F1HA 4HBYA 5I1QA 2R0YA 5EWVA 5DKDA 4QNSA 3GG3A 5F36A 5HFQA 4IR4A 4QEUA 4NS5A 3JVKA 3U5OA 4UYDA 2YW5A 3P1DA 5D3PA 4MR5A 4NQNA 4YYHA 5I83A 5F25A 4BHWA 4J0SA 4XUAA 4A9MA 5LKXA 5FH8A 5E9MA 2N9GA 4AKNA 5I80A 4TTEA 4Z93A 2GRCA 4NR5A 4YYNA 5EV9A 3O34A 5AMFA 5F2PA 4Z6HA 5ENEA 5FE9A 4WIVA 5ENIA 3JVLA 4O74A 4HXLA 5KTUA 5E9KA 2YDWA 4UIXA 5EM3A 4CUTA 5COIA 1JM4B 4DONA 5LJ0A 3P5OA 4QC1A 5A5RA 4UYFB 5D26A 4QUTA 5C89A 5FG5A 3JVJA 4YABA 5A5SA 4Z6IA 5D25A 4HXSA 2I8NA 4YATA 5ENHA 5D24A 5L96A 5F63A 3U5JA 3UV2A 3LQIA 3UVYA 5CUCA 5E0RA 4C66A 5CY9A 5CUEA 5EGUA 3FKMX 5FE7A 4TQNA 5A5QA 4QR3A 4ZQLA 5EPRA 3UVWA 4FLPA 1WUMA 4YH3A 5DBMA 4CFLA 5HRXA 2DVSA 5FE1A 4YYMA 5AD3A 5L97A 4O7FA 4UYEA 5E73A 5ENBA 4BW2A 5LKUA 4IOQA 4J1PA 4NQMA 2WP1A 5DFCA 5IGNA 4GPJA 3JVMA 4QYLA 4O78A 4OUFA 2DWWA 4PY6A 5AD2A 3P1CA 4BW3A 3D7CA 5D7XA 5FDZA 1EQFA 5EISA 5IGKA 3AADA 5TB6A 3U5MA 5EU1A 5FFYA 5KHMA 4NXJA 5CGPA 5HFRA 4QSWA 2MJVB 5ENFA 3U5PA 4NR6A 5HEMA 3S91A 5I88A 3AQAA 5ETBA 4MR4A 5CUGA 4YBTA 2YQDA 5DLZA 4IR6A 3RCWA 4XY9A 4ALHA 4UIUA 4NR7A 5DYXA 5ENJA 2DVQA 5DFDA 1WUGA 4O72A 5FFWA 4O70A 4YBSA 4QSVA 4TT4A 4UIVA 2OUOA 5EWCA 2E7OA 5II2A 5L99A 5I86A 5FBXA 4NYWA 2YEMA 5HQ6A 5LVQA 2R0SA 5D0CA 3I3JA 5DYUA 4NR4A 4YK0A 4QSQA 4N4FA 2H60A 4J0RA 5D3RA 4IR3A 3Q2EA 5EK9A 3MXFA 4NYXA 4HXPA 4QEVA 4BW4A 4QSRA 5KTXA 5C85A 5CRMA 5E3DA 5EQ1A 5DW1A 5CQAA 4HBXA 5DFBA 3DAIA 4TZ2A 2RO1A 5H1TA 4UYGA 4YBMA 5CS8A 5CU8A 5BT4A 4QSXA 5FE5A 3DWYA 2RI7A 3IU6A 4A9HA 5HRWA 4UYHA 5I29A 4TZ8A 5HRVA 4C67A 5KTWA 4O75A 4CUSA 3MB3A 5H85A 5FE0A 5LVRA 4KV4A 2RNYA 2NXBA 3HMEA 5EA1A 4O7EA 5FH7A 2E3KA 3SVGA 5EWHA 5JI8A 4X2IA 5EWDA 4UITA 4QR4A 5II1A 5D3SA 3HMHA 5F1LA 4TYLA 4PTBA 4LZ2A 3O37A 4NUDA 3P1EA 5CP5A 3UW9A 3QZSA 1ZS5A 4A9JA 4A9IA 5FE4A 5FH6A 5A81A 5EP7A 3S92A 3U5NA 3LQJA 4O77A 5HLSA 5F5ZA 3U5LA 4N4IA 4Q0OA 5G4RA 5G4SA 5I7XA 2YEKA 2G4AA 4N4HA 5CQTA 3ZYUA 2FSAA 5CUDA 4CUQA 3QZTA 5CQ5A 2YYNA 4O7BA 5DKCA 5FG6A 2R10A 5DX4A 4LR6A 5CQ4A 5CQ7A 4UIZA 4QEWA 5F60A 4QYDA 4BJXA 3P1FA 5DY7A 5BT3A 4HBWA 5FB1A 3G0LA 4NR9A 3SVFA 4TU4A 5LKTA 3LQHA 5CUBA 3MUKA 4Q0NA 5DLXA 5IGLA 5D3LA 5HQ5A 5F62A 5CPEA 5EVAA 5CTLA 5E74A 4F3IA 5C8GA 4ZW1A 4Z1QA 5KU3A 4PKLA 4N3WA 4QR5A 5CQ3A 4QSTA 4TU6A 4QSUA 4UIWA 5FFVA 2D82A 4KCXA 4QZSA 4YADA 5D3HA 5C4QA 5F61A 4O7CA 4HXOA 5E7DA 5AMEA 5HCLA 4MR3A 5DW2A 2DVVA 5A85A 5LJ1A 2F6JA 4QUUA 4LYSA 4KV1A 4RVRA 5BT5A 4YC9A 2D9EA 5EWWA 3UV5A 5I7YA 5FG4A 4YYGA 4A9EA 5LUUA 4HBVA 4MEPA 4XYAA 5K29A 2L5EA 4IORA 4HXKA 4YYJA 2RFJA 2E7NA 2L84A 2R0VA 4NR8A 2RNWA 4NUEA 5L8TA 5DKHA 5HENA 3K2JA 3TLPA 5A5PA 3HMFA 4O71A 3UVDA 5ENCA 4YY6A 4NUCA 5A5NA 5HM0A 4QY4A 5ETDA 4A9FA 4MEQA 4J3IA 3SVHA 5A5OA 5I40A 5HQ7A 2DVRA 2RS9B 5CQ6A 4CL9A 5CFWA 2OO1A 1F68A 4YAXA 4O7AA 3Q2FA 4Y03A 5IBNA 1E6IA 4UYFA 3LJWA 2L85A 3MULA 4ZC9A 3UVXA 3O33A 5IGMA 5FE2A 4LZSA 4QSPA 4QBMA 5A7CA 5E9IA 4QB3A 4QSSA 4CURA 3O36A 3O35A 4YYKA 2F6NA 4ALGA 4N4GA 4NRBA 5TCMA 4NRCA 5E9YA 1X0JA 3ONIA 4TT2A 4HXRA 5HJCA 2LSPB 4NRAA 3MQMA 4CUPA 4CUUA 5ACYA 5EI4A 5FE8A 5FE6A 3UV4A 4UIYA 5JWMA 5J0DA 5FE3A 5A83A 5H1UA 4YYIA 5FB0A 5ENGA 4OGJA 4LYIA 4LDFA 1JSPB 4TS8A 4YY4A 3MB4A 4Z1SA 5EPSA 5HELA 4OGIA 4A9KA 5IIDA 4TT6A 3G0JA 4LC2A 5DYCA 5EPBA 5C7NA 4LZRA 4MENA 4IR5A 5D3NA 4A9OA 4YYDA 2I7KA 5IG6A 4O76A 2WP2A 4CLBA 2OSSA 5F3AA 4PCEA 5L98A 5KO4A 2KTBB 2DATA 4LRGA 4XUBA 2YELA 5D3TA 3QZVA 4NYVA 4WHUA 4HXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PS5 A;  3LXJ A;  3IU5 A;  2RNX A;  5L8U A;  4A9N A;  5C87 A;  5E9L A;  5E3G A;  4A9L A;  4QC3 A;  5D3J A;  2DKW A;  3NXB A;  5H1V A;  4LYW A;  1N72 A;  5CQ8 A;  5CUA A;  5A82 A;  4MEO A;  4E96 A;  4IOO A;  4HXN A;  5CRZ A;  3U5K A;  5LKZ A;  4BW1 A;  5CZG A;  4WHW A;  5LJ2 A;  5DYA A;  5E9V A;  4XY8 A;  5EIC A;  4PCI A;  4YH4 A;  4CFK A;  5I89 A;  4MR6 A;  5F1H A;  4HBY A;  5I1Q A;  2R0Y A;  5EWV A;  5DKD A;  4QNS A;  3GG3 A;  5F36 A;  5HFQ A;  4IR4 A;  4QEU A;  4NS5 A;  3JVK A;  3U5O A;  4UYD A;  2YW5 A;  3P1D A;  5D3P A;  4MR5 A;  4NQN A;  4YYH A;  5I83 A;  5F25 A;  4BHW A;  4J0S A;  4XUA A;  4A9M A;  5LKX A;  5FH8 A;  5E9M A;  2N9G A;  4AKN A;  5I80 A;  4TTE A;  4Z93 A;  2GRC A;  4NR5 A;  4YYN A;  5EV9 A;  3O34 A;  5AMF A;  5F2P A;  4Z6H A;  5ENE A;  5FE9 A;  4WIV A;  5ENI A;  3JVL A;  4O74 A;  4HXL A;  5KTU A;  5E9K A;  2YDW A;  4UIX A;  5EM3 A;  4CUT A;  5COI A;  1JM4 B;  4DON A;  5LJ0 A;  3P5O A;  4QC1 A;  5A5R A;  4UYF B;  5D26 A;  4QUT A;  5C89 A;  5FG5 A;  3JVJ A;  4YAB A;  5A5S A;  4Z6I A;  5D25 A;  4HXS A;  2I8N A;  4YAT A;  5ENH A;  5D24 A;  5L96 A;  5F63 A;  3U5J A;  3UV2 A;  3LQI A;  3UVY A;  5CUC A;  5E0R A;  4C66 A;  5CY9 A;  5CUE A;  5EGU A;  3FKM X;  5FE7 A;  4TQN A;  5A5Q A;  4QR3 A;  4ZQL A;  5EPR A;  3UVW A;  4FLP A;  1WUM A;  4YH3 A;  5DBM A;  4CFL A;  5HRX A;  2DVS A;  5FE1 A;  4YYM A;  5AD3 A;  5L97 A;  4O7F A;  4UYE A;  5E73 A;  5ENB A;  4BW2 A;  5LKU A;  4IOQ A;  4J1P A;  4NQM A;  2WP1 A;  5DFC A;  5IGN A;  4GPJ A;  3JVM A;  4QYL A;  4O78 A;  4OUF A;  2DWW A;  4PY6 A;  5AD2 A;  3P1C A;  4BW3 A;  3D7C A;  5D7X A;  5FDZ A;  1EQF A;  5EIS A;  5IGK A;  3AAD A;  5TB6 A;  3U5M A;  5EU1 A;  5FFY A;  5KHM A;  4NXJ A;  5CGP A;  5HFR A;  4QSW A;  2MJV B;  5ENF A;  3U5P A;  4NR6 A;  5HEM A;  3S91 A;  5I88 A;  3AQA A;  5ETB A;  4MR4 A;  5CUG A;  4YBT A;  2YQD A;  5DLZ A;  4IR6 A;  3RCW A;  4XY9 A;  4ALH A;  4UIU A;  4NR7 A;  5DYX A;  5ENJ A;  2DVQ A;  5DFD A;  1WUG A;  4O72 A;  5FFW A;  4O70 A;  4YBS A;  4QSV A;  4TT4 A;  4UIV A;  2OUO A;  5EWC A;  2E7O A;  5II2 A;  5L99 A;  5I86 A;  5FBX A;  4NYW A;  2YEM A;  5HQ6 A;  5LVQ A;  2R0S A;  5D0C A;  3I3J A;  5DYU A;  4NR4 A;  4YK0 A;  4QSQ A;  4N4F A;  2H60 A;  4J0R A;  5D3R A;  4IR3 A;  3Q2E A;  5EK9 A;  3MXF A;  4NYX A;  4HXP A;  4QEV A;  4BW4 A;  4QSR A;  5KTX A;  5C85 A;  5CRM A;  5E3D A;  5EQ1 A;  5DW1 A;  5CQA A;  4HBX A;  5DFB A;  3DAI A;  4TZ2 A;  2RO1 A;  5H1T A;  4UYG A;  4YBM A;  5CS8 A;  5CU8 A;  5BT4 A;  4QSX A;  5FE5 A;  3DWY A;  2RI7 A;  3IU6 A;  4A9H A;  5HRW A;  4UYH A;  5I29 A;  4TZ8 A;  5HRV A;  4C67 A;  5KTW A;  4O75 A;  4CUS A;  3MB3 A;  5H85 A;  5FE0 A;  5LVR A;  4KV4 A;  2RNY A;  2NXB A;  3HME A;  5EA1 A;  4O7E A;  5FH7 A;  2E3K A;  3SVG A;  5EWH A;  5JI8 A;  4X2I A;  5EWD A;  4UIT A;  4QR4 A;  5II1 A;  5D3S A;  3HMH A;  5F1L A;  4TYL A;  4PTB A;  4LZ2 A;  3O37 A;  4NUD A;  3P1E A;  5CP5 A;  3UW9 A;  3QZS A;  1ZS5 A;  4A9J A;  4A9I A;  5FE4 A;  5FH6 A;  5A81 A;  5EP7 A;  3S92 A;  3U5N A;  3LQJ A;  4O77 A;  5HLS A;  5F5Z A;  3U5L A;  4N4I A;  4Q0O A;  5G4R A;  5G4S A;  5I7X A;  2YEK A;  2G4A A;  4N4H A;  5CQT A;  3ZYU A;  2FSA A;  5CUD A;  4CUQ A;  3QZT A;  5CQ5 A;  2YYN A;  4O7B A;  5DKC A;  5FG6 A;  2R10 A;  5DX4 A;  4LR6 A;  5CQ4 A;  5CQ7 A;  4UIZ A;  4QEW A;  5F60 A;  4QYD A;  4BJX A;  3P1F A;  5DY7 A;  5BT3 A;  4HBW A;  5FB1 A;  3G0L A;  4NR9 A;  3SVF A;  4TU4 A;  5LKT A;  3LQH A;  5CUB A;  3MUK A;  4Q0N A;  5DLX A;  5IGL A;  5D3L A;  5HQ5 A;  5F62 A;  5CPE A;  5EVA A;  5CTL A;  5E74 A;  4F3I A;  5C8G A;  4ZW1 A;  4Z1Q A;  5KU3 A;  4PKL A;  4N3W A;  4QR5 A;  5CQ3 A;  4QST A;  4TU6 A;  4QSU A;  4UIW A;  5FFV A;  2D82 A;  4KCX A;  4QZS A;  4YAD A;  5D3H A;  5C4Q A;  5F61 A;  4O7C A;  4HXO A;  5E7D A;  5AME A;  5HCL A;  4MR3 A;  5DW2 A;  2DVV A;  5A85 A;  5LJ1 A;  2F6J A;  4QUU A;  4LYS A;  4KV1 A;  4RVR A;  5BT5 A;  4YC9 A;  2D9E A;  5EWW A;  3UV5 A;  5I7Y A;  5FG4 A;  4YYG A;  4A9E A;  5LUU A;  4HBV A;  4MEP A;  4XYA A;  5K29 A;  2L5E A;  4IOR A;  4HXK A;  4YYJ A;  2RFJ A;  2E7N A;  2L84 A;  2R0V A;  4NR8 A;  2RNW A;  4NUE A;  5L8T A;  5DKH A;  5HEN A;  3K2J A;  3TLP A;  5A5P A;  3HMF A;  4O71 A;  3UVD A;  5ENC A;  4YY6 A;  4NUC A;  5A5N A;  5HM0 A;  4QY4 A;  5ETD A;  4A9F A;  4MEQ A;  4J3I A;  3SVH A;  5A5O A;  5I40 A;  5HQ7 A;  2DVR A;  2RS9 B;  5CQ6 A;  4CL9 A;  5CFW A;  2OO1 A;  1F68 A;  4YAX A;  4O7A A;  3Q2F A;  4Y03 A;  5IBN A;  1E6I A;  4UYF A;  3LJW A;  2L85 A;  3MUL A;  4ZC9 A;  3UVX A;  3O33 A;  5IGM A;  5FE2 A;  4LZS A;  4QSP A;  4QBM A;  5A7C A;  5E9I A;  4QB3 A;  4QSS A;  4CUR A;  3O36 A;  3O35 A;  4YYK A;  2F6N A;  4ALG A;  4N4G A;  4NRB A;  5TCM A;  4NRC A;  5E9Y A;  1X0J A;  3ONI A;  4TT2 A;  4HXR A;  5HJC A;  2LSP B;  4NRA A;  3MQM A;  4CUP A;  4CUU A;  5ACY A;  5EI4 A;  5FE8 A;  5FE6 A;  3UV4 A;  4UIY A;  5JWM A;  5J0D A;  5FE3 A;  5A83 A;  5H1U A;  4YYI A;  5FB0 A;  5ENG A;  4OGJ A;  4LYI A;  4LDF A;  1JSP B;  4TS8 A;  4YY4 A;  3MB4 A;  4Z1S A;  5EPS A;  5HEL A;  4OGI A;  4A9K A;  5IID A;  4TT6 A;  3G0J A;  4LC2 A;  5DYC A;  5EPB A;  5C7N A;  4LZR A;  4MEN A;  4IR5 A;  5D3N A;  4A9O A;  4YYD A;  2I7K A;  5IG6 A;  4O76 A;  2WP2 A;  4CLB A;  2OSS A;  5F3A A;  4PCE A;  5L98 A;  5KO4 A;  2KTB B;  2DAT A;  4LRG A;  4XUB A;  2YEL A;  5D3T A;  3QZV A;  4NYV A;  4WHU A;  4HXM A; 
#chains in the Genus database with same CATH topology
 4PS5 A;  3LXJ A;  3IU5 A;  2RNX A;  5L8U A;  4A9N A;  5C87 A;  4AKI A;  5E9L A;  5E3G A;  4A9L A;  4QC3 A;  5D3J A;  2DKW A;  3NXB A;  5H1V A;  4LYW A;  1N72 A;  5CQ8 A;  5CUA A;  5A82 A;  4MEO A;  4E96 A;  4IOO A;  4HXN A;  5CRZ A;  3U5K A;  5LKZ A;  4BW1 A;  5CZG A;  4WHW A;  5LJ2 A;  5DYA A;  5E9V A;  4XY8 A;  5EIC A;  4PCI A;  4YH4 A;  4CFK A;  5I89 A;  4MR6 A;  5F1H A;  4HBY A;  5I1Q A;  2EJN A;  2R0Y A;  5EWV A;  5DKD A;  4QNS A;  3GG3 A;  5F36 A;  5HFQ A;  4IR4 A;  4QEU A;  4NS5 A;  3JVK A;  3U5O A;  4UYD A;  2YW5 A;  3P1D A;  5D3P A;  4MR5 A;  4NQN A;  4YYH A;  5I83 A;  3D1D A;  5F25 A;  4BHW A;  4J0S A;  1PUO A;  4XUA A;  4A9M A;  5LKX A;  5FH8 A;  5E9M A;  2N9G A;  4AKN A;  5I80 A;  4TTE A;  4Z93 A;  2GRC A;  4NR5 A;  4YYN A;  5EV9 A;  3O34 A;  5AMF A;  5F2P A;  4Z6H A;  5ENE A;  5FE9 A;  4WIV A;  5ENI A;  3JVL A;  4O74 A;  4HXL A;  5KTU A;  5E9K A;  2YDW A;  4UIX A;  5EM3 A;  4CUT A;  5COI A;  1JM4 B;  4DON A;  5LJ0 A;  3P5O A;  4QC1 A;  5A5R A;  4UYF B;  5D26 A;  4QUT A;  5C89 A;  5FG5 A;  3JVJ A;  4YAB A;  5A5S A;  4Z6I A;  5D25 A;  4HXS A;  2I8N A;  4YAT A;  5ENH A;  5D24 A;  5L96 A;  5F63 A;  3U5J A;  3UV2 A;  3LQI A;  3UVY A;  5CUC A;  5E0R A;  4C66 A;  5CY9 A;  5CUE A;  5EGU A;  3D1B A;  3FKM X;  4TQN A;  5FE7 A;  5A5Q A;  4QR3 A;  4ZQL A;  5EPR A;  3UVW A;  4FLP A;  1WUM A;  4YH3 A;  5DBM A;  4CFL A;  5HRX A;  2DVS A;  5FE1 A;  4YYM A;  5AD3 A;  5L97 A;  4O7F A;  4UYE A;  5E73 A;  5ENB A;  4BW2 A;  5LKU A;  4IOQ A;  4J1P A;  4NQM A;  2WP1 A;  5DFC A;  5IGN A;  4GPJ A;  3JVM A;  4QYL A;  4O78 A;  4OUF A;  2DWW A;  4PY6 A;  5AD2 A;  3P1C A;  4BW3 A;  3D7C A;  5D7X A;  5FDZ A;  1EQF A;  5EIS A;  5IGK A;  3AAD A;  5TB6 A;  3U5M A;  5EU1 A;  5FFY A;  5KHM A;  4NXJ A;  5CGP A;  5HFR A;  4QSW A;  2MJV B;  5ENF A;  3U5P A;  4NR6 A;  5HEM A;  3S91 A;  5I88 A;  3AQA A;  5ETB A;  4MR4 A;  5CUG A;  4YBT A;  2YQD A;  5DLZ A;  4IR6 A;  3RCW A;  4XY9 A;  4ALH A;  4UIU A;  4NR7 A;  5DYX A;  5ENJ A;  2DVQ A;  5DFD A;  1WUG A;  4O72 A;  5FFW A;  4O70 A;  4YBS A;  4QSV A;  4TT4 A;  4UIV A;  2OUO A;  5EWC A;  2E7O A;  5II2 A;  5L99 A;  5I86 A;  5FBX A;  4NYW A;  2YEM A;  5HQ6 A;  5LVQ A;  2R0S A;  5D0C A;  3I3J A;  5DYU A;  4NR4 A;  4YK0 A;  4QSQ A;  4N4F A;  2H60 A;  4J0R A;  5D3R A;  4IR3 A;  3Q2E A;  5EK9 A;  3MXF A;  4NYX A;  4HXP A;  4QEV A;  4BW4 A;  4QSR A;  5KTX A;  5C85 A;  5CRM A;  5E3D A;  5EQ1 A;  5DW1 A;  5CQA A;  4HBX A;  5DFB A;  3DAI A;  4TZ2 A;  2RO1 A;  5H1T A;  4UYG A;  4YBM A;  5CS8 A;  5CU8 A;  5BT4 A;  4QSX A;  5FE5 A;  3DWY A;  2RI7 A;  3IU6 A;  4A9H A;  5HRW A;  4UYH A;  5I29 A;  4TZ8 A;  5HRV A;  4C67 A;  5KTW A;  4O75 A;  4CUS A;  3MB3 A;  5H85 A;  5FE0 A;  5LVR A;  4KV4 A;  2RNY A;  2NXB A;  3HME A;  5EA1 A;  4O7E A;  5FH7 A;  2E3K A;  3SVG A;  5EWH A;  5JI8 A;  4X2I A;  5EWD A;  4UIT A;  4QR4 A;  5II1 A;  5D3S A;  3HMH A;  5F1L A;  4TYL A;  4PTB A;  4LZ2 A;  3O37 A;  4NUD A;  3P1E A;  5CP5 A;  3UW9 A;  3QZS A;  1ZS5 A;  4A9J A;  4A9I A;  3VKH A;  5FE4 A;  5FH6 A;  5A81 A;  5EP7 A;  3S92 A;  3U5N A;  3LQJ A;  4O77 A;  5HLS A;  5F5Z A;  3U5L A;  4AKH A;  4N4I A;  4Q0O A;  5G4R A;  5G4S A;  5I7X A;  2YEK A;  2G4A A;  4N4H A;  5CQT A;  3ZYU A;  2FSA A;  3VKG A;  5CUD A;  4CUQ A;  3QZT A;  5CQ5 A;  2YYN A;  4O7B A;  5DKC A;  5FG6 A;  2R10 A;  5DX4 A;  4LR6 A;  5CQ4 A;  5CQ7 A;  4UIZ A;  4QEW A;  5F60 A;  4QYD A;  4BJX A;  3P1F A;  5DY7 A;  5BT3 A;  4HBW A;  5FB1 A;  3G0L A;  4NR9 A;  3SVF A;  4TU4 A;  5LKT A;  3LQH A;  5CUB A;  3MUK A;  4Q0N A;  5DLX A;  5IGL A;  5D3L A;  5HQ5 A;  4AKG A;  5F62 A;  5CPE A;  5EVA A;  5CTL A;  5E74 A;  4F3I A;  5C8G A;  4ZW1 A;  4Z1Q A;  5KU3 A;  4PKL A;  4N3W A;  4QR5 A;  5CQ3 A;  4QST A;  4TU6 A;  4QSU A;  4UIW A;  5FFV A;  2D82 A;  4KCX A;  4QZS A;  4YAD A;  5D3H A;  5C4Q A;  5F61 A;  4O7C A;  4HXO A;  5E7D A;  5AME A;  5HCL A;  4MR3 A;  5DW2 A;  2DVV A;  5A85 A;  5LJ1 A;  2F6J A;  4QUU A;  4LYS A;  4KV1 A;  4RVR A;  5BT5 A;  4YC9 A;  2D9E A;  5EWW A;  3UV5 A;  5I7Y A;  5FG4 A;  4YYG A;  4A9E A;  5LUU A;  4HBV A;  4MEP A;  4XYA A;  5K29 A;  2L5E A;  4IOR A;  4HXK A;  4YYJ A;  2RFJ A;  2E7N A;  2L84 A;  2R0V A;  4NR8 A;  2RNW A;  4NUE A;  5L8T A;  5DKH A;  5HEN A;  3K2J A;  3TLP A;  5A5P A;  3HMF A;  4O71 A;  3UVD A;  5ENC A;  4YY6 A;  4NUC A;  5A5N A;  5HM0 A;  4QY4 A;  5ETD A;  4A9F A;  4MEQ A;  4J3I A;  3SVH A;  5A5O A;  5I40 A;  5HQ7 A;  2DVR A;  2RS9 B;  5CQ6 A;  4CL9 A;  5CFW A;  2OO1 A;  1F68 A;  4YAX A;  4O7A A;  3Q2F A;  4Y03 A;  5IBN A;  1E6I A;  4UYF A;  3LJW A;  2L85 A;  3MUL A;  4ZC9 A;  3UVX A;  3O33 A;  5IGM A;  5FE2 A;  4LZS A;  4QSP A;  4QBM A;  5A7C A;  3ERR A;  5E9I A;  4QB3 A;  4QSS A;  4CUR A;  3O36 A;  3O35 A;  4YYK A;  2F6N A;  4ALG A;  4N4G A;  4AI6 A;  4NRB A;  5TCM A;  1ZKR A;  4NRC A;  5E9Y A;  1X0J A;  3ONI A;  4TT2 A;  4HXR A;  5HJC A;  2LSP B;  4NRA A;  3MQM A;  4CUP A;  4CUU A;  5ACY A;  5EI4 A;  5FE8 A;  5FE6 A;  3UV4 A;  4UIY A;  5JWM A;  5J0D A;  5FE3 A;  5A83 A;  5H1U A;  4YYI A;  5FB0 A;  5ENG A;  4OGJ A;  4LYI A;  4LDF A;  1JSP B;  4TS8 A;  4YY4 A;  3MB4 A;  4Z1S A;  5EPS A;  5HEL A;  4OGI A;  4A9K A;  5IID A;  4TT6 A;  3G0J A;  4LC2 A;  5DYC A;  5EPB A;  5C7N A;  4LZR A;  4MEN A;  4IR5 A;  5D3N A;  4A9O A;  4YYD A;  2I7K A;  5IG6 A;  4O76 A;  2WP2 A;  4CLB A;  2OSS A;  5F3A A;  4PCE A;  5L98 A;  5KO4 A;  2KTB B;  2DAT A;  4LRG A;  4XUB A;  2YEL A;  5D3T A;  3QZV A;  4NYV A;  4WHU A;  4HXM A; 
#chains in the Genus database with same CATH homology
 4PS5 A;  3LXJ A;  3IU5 A;  2RNX A;  5L8U A;  4A9N A;  5C87 A;  5E9L A;  5E3G A;  4A9L A;  4QC3 A;  5D3J A;  2DKW A;  3NXB A;  5H1V A;  4LYW A;  1N72 A;  5CQ8 A;  5CUA A;  5A82 A;  4MEO A;  4E96 A;  4IOO A;  4HXN A;  5CRZ A;  3U5K A;  5LKZ A;  4BW1 A;  5CZG A;  4WHW A;  5LJ2 A;  5DYA A;  5E9V A;  4XY8 A;  5EIC A;  4PCI A;  4YH4 A;  4CFK A;  5I89 A;  4MR6 A;  5F1H A;  4HBY A;  5I1Q A;  2R0Y A;  5EWV A;  5DKD A;  4QNS A;  3GG3 A;  5F36 A;  5HFQ A;  4IR4 A;  4QEU A;  4NS5 A;  3JVK A;  3U5O A;  4UYD A;  2YW5 A;  3P1D A;  5D3P A;  4MR5 A;  4NQN A;  4YYH A;  5I83 A;  5F25 A;  4BHW A;  4J0S A;  4XUA A;  4A9M A;  5LKX A;  5FH8 A;  5E9M A;  2N9G A;  4AKN A;  5I80 A;  4TTE A;  4Z93 A;  2GRC A;  4NR5 A;  4YYN A;  5EV9 A;  3O34 A;  5AMF A;  5F2P A;  4Z6H A;  5ENE A;  5FE9 A;  4WIV A;  5ENI A;  3JVL A;  4O74 A;  4HXL A;  5KTU A;  5E9K A;  2YDW A;  4UIX A;  5EM3 A;  4CUT A;  5COI A;  1JM4 B;  4DON A;  5LJ0 A;  3P5O A;  4QC1 A;  5A5R A;  4UYF B;  5D26 A;  4QUT A;  5C89 A;  5FG5 A;  3JVJ A;  4YAB A;  5A5S A;  4Z6I A;  5D25 A;  4HXS A;  2I8N A;  4YAT A;  5ENH A;  5D24 A;  5L96 A;  5F63 A;  3U5J A;  3UV2 A;  3LQI A;  3UVY A;  5CUC A;  5E0R A;  4C66 A;  5CY9 A;  5CUE A;  5EGU A;  3FKM X;  5FE7 A;  4TQN A;  5A5Q A;  4QR3 A;  4ZQL A;  5EPR A;  3UVW A;  4FLP A;  1WUM A;  4YH3 A;  5DBM A;  4CFL A;  5HRX A;  2DVS A;  5FE1 A;  4YYM A;  5AD3 A;  5L97 A;  4O7F A;  4UYE A;  5E73 A;  5ENB A;  4BW2 A;  5LKU A;  4IOQ A;  4J1P A;  4NQM A;  2WP1 A;  5DFC A;  5IGN A;  4GPJ A;  3JVM A;  4QYL A;  4O78 A;  4OUF A;  2DWW A;  4PY6 A;  5AD2 A;  3P1C A;  4BW3 A;  3D7C A;  5D7X A;  5FDZ A;  1EQF A;  5EIS A;  5IGK A;  3AAD A;  5TB6 A;  3U5M A;  5EU1 A;  5FFY A;  5KHM A;  4NXJ A;  5CGP A;  5HFR A;  4QSW A;  2MJV B;  5ENF A;  3U5P A;  4NR6 A;  5HEM A;  3S91 A;  5I88 A;  3AQA A;  5ETB A;  4MR4 A;  5CUG A;  4YBT A;  2YQD A;  5DLZ A;  4IR6 A;  3RCW A;  4XY9 A;  4ALH A;  4UIU A;  4NR7 A;  5DYX A;  5ENJ A;  2DVQ A;  5DFD A;  1WUG A;  4O72 A;  5FFW A;  4O70 A;  4YBS A;  4QSV A;  4TT4 A;  4UIV A;  2OUO A;  5EWC A;  2E7O A;  5II2 A;  5L99 A;  5I86 A;  5FBX A;  4NYW A;  2YEM A;  5HQ6 A;  5LVQ A;  2R0S A;  5D0C A;  3I3J A;  5DYU A;  4NR4 A;  4YK0 A;  4QSQ A;  4N4F A;  2H60 A;  4J0R A;  5D3R A;  4IR3 A;  3Q2E A;  5EK9 A;  3MXF A;  4NYX A;  4HXP A;  4QEV A;  4BW4 A;  4QSR A;  5KTX A;  5C85 A;  5CRM A;  5E3D A;  5EQ1 A;  5DW1 A;  5CQA A;  4HBX A;  5DFB A;  3DAI A;  4TZ2 A;  2RO1 A;  5H1T A;  4UYG A;  4YBM A;  5CS8 A;  5CU8 A;  5BT4 A;  4QSX A;  5FE5 A;  3DWY A;  2RI7 A;  3IU6 A;  4A9H A;  5HRW A;  4UYH A;  5I29 A;  4TZ8 A;  5HRV A;  4C67 A;  5KTW A;  4O75 A;  4CUS A;  3MB3 A;  5H85 A;  5FE0 A;  5LVR A;  4KV4 A;  2RNY A;  2NXB A;  3HME A;  5EA1 A;  4O7E A;  5FH7 A;  2E3K A;  3SVG A;  5EWH A;  5JI8 A;  4X2I A;  5EWD A;  4UIT A;  4QR4 A;  5II1 A;  5D3S A;  3HMH A;  5F1L A;  4TYL A;  4PTB A;  4LZ2 A;  3O37 A;  4NUD A;  3P1E A;  5CP5 A;  3UW9 A;  3QZS A;  1ZS5 A;  4A9J A;  4A9I A;  5FE4 A;  5FH6 A;  5A81 A;  5EP7 A;  3S92 A;  3U5N A;  3LQJ A;  4O77 A;  5HLS A;  5F5Z A;  3U5L A;  4N4I A;  4Q0O A;  5G4R A;  5G4S A;  5I7X A;  2YEK A;  2G4A A;  4N4H A;  5CQT A;  3ZYU A;  2FSA A;  5CUD A;  4CUQ A;  3QZT A;  5CQ5 A;  2YYN A;  4O7B A;  5DKC A;  5FG6 A;  2R10 A;  5DX4 A;  4LR6 A;  5CQ4 A;  5CQ7 A;  4UIZ A;  4QEW A;  5F60 A;  4QYD A;  4BJX A;  3P1F A;  5DY7 A;  5BT3 A;  4HBW A;  5FB1 A;  3G0L A;  4NR9 A;  3SVF A;  4TU4 A;  5LKT A;  3LQH A;  5CUB A;  3MUK A;  4Q0N A;  5DLX A;  5IGL A;  5D3L A;  5HQ5 A;  5F62 A;  5CPE A;  5EVA A;  5CTL A;  5E74 A;  4F3I A;  5C8G A;  4ZW1 A;  4Z1Q A;  5KU3 A;  4PKL A;  4N3W A;  4QR5 A;  5CQ3 A;  4QST A;  4TU6 A;  4QSU A;  4UIW A;  5FFV A;  2D82 A;  4KCX A;  4QZS A;  4YAD A;  5D3H A;  5C4Q A;  5F61 A;  4O7C A;  4HXO A;  5E7D A;  5AME A;  5HCL A;  4MR3 A;  5DW2 A;  2DVV A;  5A85 A;  5LJ1 A;  2F6J A;  4QUU A;  4LYS A;  4KV1 A;  4RVR A;  5BT5 A;  4YC9 A;  2D9E A;  5EWW A;  3UV5 A;  5I7Y A;  5FG4 A;  4YYG A;  4A9E A;  5LUU A;  4HBV A;  4MEP A;  4XYA A;  5K29 A;  2L5E A;  4IOR A;  4HXK A;  4YYJ A;  2RFJ A;  2E7N A;  2L84 A;  2R0V A;  4NR8 A;  2RNW A;  4NUE A;  5L8T A;  5DKH A;  5HEN A;  3K2J A;  3TLP A;  5A5P A;  3HMF A;  4O71 A;  3UVD A;  5ENC A;  4YY6 A;  4NUC A;  5A5N A;  5HM0 A;  4QY4 A;  5ETD A;  4A9F A;  4MEQ A;  4J3I A;  3SVH A;  5A5O A;  5I40 A;  5HQ7 A;  2DVR A;  2RS9 B;  5CQ6 A;  4CL9 A;  5CFW A;  2OO1 A;  1F68 A;  4YAX A;  4O7A A;  3Q2F A;  4Y03 A;  5IBN A;  1E6I A;  4UYF A;  3LJW A;  2L85 A;  3MUL A;  4ZC9 A;  3UVX A;  3O33 A;  5IGM A;  5FE2 A;  4LZS A;  4QSP A;  4QBM A;  5A7C A;  5E9I A;  4QB3 A;  4QSS A;  4CUR A;  3O36 A;  3O35 A;  4YYK A;  2F6N A;  4ALG A;  4N4G A;  4NRB A;  5TCM A;  4NRC A;  5E9Y A;  1X0J A;  3ONI A;  4TT2 A;  4HXR A;  5HJC A;  2LSP B;  4NRA A;  3MQM A;  4CUP A;  4CUU A;  5ACY A;  5EI4 A;  5FE8 A;  5FE6 A;  3UV4 A;  4UIY A;  5JWM A;  5J0D A;  5FE3 A;  5A83 A;  5H1U A;  4YYI A;  5FB0 A;  5ENG A;  4OGJ A;  4LYI A;  4LDF A;  1JSP B;  4TS8 A;  4YY4 A;  3MB4 A;  4Z1S A;  5EPS A;  5HEL A;  4OGI A;  4A9K A;  5IID A;  4TT6 A;  3G0J A;  4LC2 A;  5DYC A;  5EPB A;  5C7N A;  4LZR A;  4MEN A;  4IR5 A;  5D3N A;  4A9O A;  4YYD A;  2I7K A;  5IG6 A;  4O76 A;  2WP2 A;  4CLB A;  2OSS A;  5F3A A;  4PCE A;  5L98 A;  5KO4 A;  2KTB B;  2DAT A;  4LRG A;  4XUB A;  2YEL A;  5D3T A;  3QZV A;  4NYV A;  4WHU A;  4HXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...