3P1CA

Crystal structure of the bromodomain of human crebbp in complex with acetylated lysine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3p1cA00
4Q0OA 5FH7A 4IR4A 5FG6A 5HENA 4C67A 5LKTA 3IU5A 4MR3A 5FE5A 4UYHA 5AD3A 4QSWA 4QY4A 4OUFA 3SVGA 5IGNA 4UIXA 4HXLA 4O7AA 4ZQLA 5KU3A 5IIDA 4J0SA 5E3GA 4CUTA 5ENGA 5HLSA 3SVHA 5ENEA 5C7NA 2OO1A 4NRCA 5HEMA 5IGMA 4TT6A 4TT2A 4UITA 5H1UA 4XUAA 5CQ4A 5F61A 5A81A 3ZYUA 5A5NA 4LC2A 5FE2A 5H1VA 4A9EA 4IR3A 3LXJA 4A9LA 5E73A 4NQMA 5FG4A 3UV2A 4MR5A 4PTBA 2OSSA 5FH6A 4NUEA 5D7XA 4A9IA 5CZGA 4XUBA 4NR5A 5I7YA 4IORA 3UW9A 5BT4A 3P1EA 5A5OA 5F2PA 5A7CA 4TTEA 3U5NA 5HCLA 4A9HA 5ETBA 4NR4A 5DYUA 4CL9A 3O35A 4LZSA 5E74A 1JM4B 2D82A 4QUTA 5FE1A 3AADA 4IOQA 4NUDA 3O36A 3UVWA 5DYAA 3U5MA 2R0YA 4ZW1A 4FLPA 2RNWA 3HMEA 4PCEA 5CRZA 4WHUA 4QSTA 5EA1A 5DY7A 2YW5A 5CQTA 5D3NA 5I7XA 4YYHA 2KTBB 5CQ8A 5F5ZA 5LKZA 2RNXA 5DKHA 5FFWA 5EICA 3LQHA 5FB0A 2F6NA 4TZ2A 4UIWA 5F3AA 5F63A 4YH3A 5C4QA 4TU4A 5IG6A 4YYIA 5CFWA 4BW3A 3MB3A 4HXSA 5E3DA 4YAXA 5EV9A 5CY9A 5FE7A 5DFCA 5DLZA 4TT4A 3U5JA 4WIVA 4F3IA 3U5PA 5FFVA 5DFDA 4N3WA 4NYVA 4O78A 4LYWA 5G4SA 4A9MA 4O75A 4O72A 2YEMA 5KTUA 3UV4A 3P1FA 4UIYA 4QBMA 3MXFA 4TU6A 4ZC9A 4X2IA 4A9FA 5LUUA 5L97A 5EM3A 2NXBA 4PS5A 3QZTA 4CLBA 4YYMA 5II1A 5TCMA 4MR6A 4UIZA 4LZ2A 3MULA 4UYFB 1JSPB 2DVRA 4LRGA 4YATA 2DATA 4C66A 5I86A 3O33A 1N72A 5F36A 3LJWA 5F1LA 5D26A 5HRXA 5D3SA 2I8NA 5HQ6A 4J1PA 3MB4A 5DW2A 5FG5A 2E3KA 4QSPA 4QC3A 4YYJA 5HJCA 5LKUA 4DONA 4XY9A 5E9YA 4PKLA 4N4FA 5A83A 4YK0A 5AMEA 5EWVA 2RO1A 5D24A 2RNYA 2WP1A 4N4IA 4O77A 4NR7A 5I83A 4NR8A 2RS9B 3O34A 4CURA 4O76A 4LYSA 5E9VA 5IGKA 4QSSA 5CQ6A 4PY6A 5C8GA 2F6JA 4YH4A 5LJ2A 5J0DA 5FB1A 5E7DA 5D3TA 2DVVA 4O7CA 2YQDA 5DFBA 4QUUA 5CQ3A 4UYFA 5CQ7A 4HBWA 5FDZA 5HRVA 4MEOA 3Q2FA 3U5LA 5D3LA 1F68A 5FE6A 1X0JA 4CUQA 5E9LA 5KHMA 4Z93A 5AMFA 2FSAA 5CRMA 3HMFA 4NQNA 2RFJA 5I88A 3LQJA 5C87A 4QC1A 5EQ1A 3ONIA 5EU1A 4TS8A 4NXJA 3MUKA 3RCWA 4YBMA 5CUEA 4MEPA 2L5EA 4AKNA 5KTXA 5CP5A 5ACYA 5ENCA 4NS5A 2DKWA 5EWCA 2D9EA 4O71A 4Q0NA 3JVMA 4XY8A 5IBNA 4CFKA 5E9MA 4UYGA 5KO4A 5EK9A 2E7OA 3P5OA 5LKXA 4QEWA 3K2JA 4QYLA 5F62A 4CUSA 4TZ8A 5TB6A 4NR6A 5CGPA 4LZRA 1WUGA 5CQ5A 3U5KA 3S91A 5FE9A 4YADA 5I29A 5CU8A 5I80A 3JVLA 5G4RA 4O74A 5ENJA 4YY6A 3GG3A 4Z1QA 5FBXA 4QR5A 5IGLA 5FE8A 5ENIA 5A5RA 5DBMA 5CUAA 5HQ7A 5D3RA 2H60A 4NR9A 5BT5A 4QSUA 4HXOA 2OUOA 4HXRA 4N4HA 3P1CA 5D0CA 5E0RA 4IOOA 4O7FA 4A9JA 5EPBA 3QZSA 2E7NA 3UVDA 2GRCA 4HXPA 2WP2A 4J3IA 4YYDA 4LYIA 2G4AA 5L8TA 3AQAA 4E96A 4NYXA 4UYEA 5AD2A 4YYNA 4HBYA 3G0JA 5L98A 3U5OA 3FKMX 5EPSA 3DAIA 4HXNA 5FE3A 5EI4A 5A85A 2YEKA 5EVAA 5F25A 3UV5A 4BHWA 3SVFA 2R10A 5HFQA 4OGJA 5D3HA 4CFLA 4QEVA 4NRAA 5CUBA 4IR6A 4QR4A 3LQIA 5K29A 4TYLA 4TQNA 4QSXA 4LR6A 5CUGA 5FE4A 5C89A 2MJVB 4KV4A 4MR4A 5H85A 3Q2EA 5I89A 2I7KA 5JWMA 2RI7A 5CQAA 4ALGA 3IU6A 5CUCA 3MQMA 5DX4A 5ENHA 3UVYA 5HQ5A 5HELA 4CUPA 2YDWA 4MEQA 2L84A 4BW1A 3O37A 4J0RA 5HFRA 2YELA 4YYGA 3DWYA 4N4GA 5LVQA 1E6IA 3I3JA 5F60A 4QR3A 4QB3A 4A9NA 5BT3A 4UYDA 5FH8A 5I1QA 2DVSA 5EISA 4Y03A 5H1TA 2R0VA 5A5QA 4IR5A 5DYXA 5DKDA 4YABA 5D3PA 5D25A 4BW4A 2DVQA 2YYNA 5ETDA 4O7BA 4QZSA 4A9KA 3S92A 5EP7A 4O7EA 5FE0A 5EWDA 5L8UA 5D3JA 3UVXA 5II2A 4LDFA 4BJXA 4BW2A 5L96A 4PCIA 4YYKA 5EWHA 5EGUA 5ENFA 4NRBA 4UIVA 4ALHA 4UIUA 5L99A 4XYAA 5E9KA 3JVKA 4NYWA 4HBVA 5DLXA 5F1HA 5KTWA 4QSVA 5CTLA 5A82A 5I40A 5HRWA 5JI8A 5LJ1A 4A9OA 1EQFA 4QEUA 5LJ0A 4YY4A 4KV1A 4YC9A 5A5PA 4MENA 5LVRA 2R0SA 3TLPA 5A5SA 4YBSA 5CS8A 4CUUA 3QZVA 5HM0A 3JVJA 5DKCA 4QSRA 3HMHA 4Z6HA 5DYCA 4QNSA 4O70A 1ZS5A 1WUMA 4HXMA 4QYDA 4KCXA 2DWWA 5CUDA 3G0LA 5EPRA 4YBTA 4HXKA 4Z1SA 2L85A 5COIA 4RVRA 5DW1A 5CPEA 4WHWA 5EWWA 5FFYA 4GPJA 3D7CA 4HBXA 3NXBA 4QSQA 5ENBA 5E9IA 2N9GA 4Z6IA 3P1DA 5C85A 2LSPB 4OGIA 4NUCA
chains in the Genus database with same CATH superfamily
4Q0OA 5FH7A 4IR4A 5FG6A 5HENA 4C67A 5LKTA 3IU5A 4MR3A 5FE5A 4UYHA 5AD3A 4QSWA 4QY4A 4OUFA 3SVGA 5IGNA 4UIXA 4HXLA 4O7AA 4ZQLA 5KU3A 5IIDA 4J0SA 5E3GA 4CUTA 5ENGA 5HLSA 3SVHA 5ENEA 5C7NA 2OO1A 4NRCA 5HEMA 5IGMA 4TT6A 4TT2A 4UITA 5H1UA 4XUAA 5CQ4A 5F61A 5A81A 3ZYUA 5A5NA 4LC2A 5FE2A 5H1VA 4A9EA 4IR3A 3LXJA 4A9LA 5E73A 4NQMA 5FG4A 3UV2A 4MR5A 4PTBA 2OSSA 5FH6A 4NUEA 5D7XA 4A9IA 5CZGA 4XUBA 4NR5A 5I7YA 4IORA 3UW9A 5BT4A 3P1EA 5A5OA 5F2PA 5A7CA 4TTEA 3U5NA 5HCLA 4A9HA 5ETBA 4NR4A 5DYUA 4CL9A 3O35A 4LZSA 5E74A 1JM4B 2D82A 4QUTA 5FE1A 3AADA 4IOQA 4NUDA 3O36A 3UVWA 5DYAA 3U5MA 2R0YA 4ZW1A 4FLPA 2RNWA 3HMEA 4PCEA 5CRZA 4WHUA 4QSTA 5EA1A 5DY7A 2YW5A 5CQTA 5D3NA 5I7XA 4YYHA 2KTBB 5CQ8A 5F5ZA 5LKZA 2RNXA 5DKHA 5FFWA 5EICA 3LQHA 5FB0A 2F6NA 3VKHA 4TZ2A 4UIWA 5F3AA 5F63A 4YH3A 5C4QA 4TU4A 5IG6A 4YYIA 5CFWA 4BW3A 3D1BA 3MB3A 4HXSA 5E3DA 4YAXA 5EV9A 5CY9A 5FE7A 5DFCA 5DLZA 4TT4A 3U5JA 4WIVA 4F3IA 3U5PA 5FFVA 5DFDA 1ZKRA 4N3WA 4NYVA 4O78A 4LYWA 5G4SA 4A9MA 4O75A 4O72A 2YEMA 5KTUA 3UV4A 3P1FA 4UIYA 4QBMA 3MXFA 4TU6A 4ZC9A 4X2IA 4A9FA 5LUUA 5L97A 5EM3A 2NXBA 4PS5A 3QZTA 4CLBA 4YYMA 5II1A 5TCMA 4MR6A 4UIZA 4LZ2A 3MULA 3D1DA 4UYFB 1JSPB 2DVRA 4LRGA 4YATA 2DATA 4C66A 5I86A 4AI6A 3O33A 1N72A 5F36A 3LJWA 5F1LA 5D26A 5HRXA 5D3SA 2I8NA 5HQ6A 4J1PA 3MB4A 5DW2A 5FG5A 2E3KA 4QSPA 4QC3A 4YYJA 5HJCA 5LKUA 4DONA 4XY9A 5E9YA 4PKLA 4N4FA 5A83A 4YK0A 5AMEA 5EWVA 2RO1A 5D24A 2RNYA 2WP1A 4N4IA 4O77A 4NR7A 5I83A 4NR8A 2RS9B 3O34A 4CURA 4O76A 4LYSA 5E9VA 5IGKA 4QSSA 5CQ6A 4PY6A 5C8GA 2F6JA 4YH4A 5LJ2A 5J0DA 5FB1A 5E7DA 5D3TA 2DVVA 4O7CA 2YQDA 5DFBA 4QUUA 5CQ3A 4UYFA 5CQ7A 4HBWA 5FDZA 5HRVA 4MEOA 3Q2FA 3U5LA 5D3LA 1F68A 5FE6A 1X0JA 4CUQA 5E9LA 5KHMA 4Z93A 5AMFA 2FSAA 5CRMA 3HMFA 4NQNA 2RFJA 5I88A 3LQJA 5C87A 4QC1A 1PUOA 5EQ1A 3ONIA 5EU1A 4TS8A 4NXJA 3MUKA 3RCWA 4YBMA 5CUEA 4MEPA 2L5EA 4AKNA 5KTXA 5CP5A 4AKGA 5ACYA 5ENCA 4NS5A 2DKWA 5EWCA 2D9EA 4O71A 4Q0NA 3JVMA 4XY8A 5IBNA 4CFKA 5E9MA 4UYGA 5KO4A 5EK9A 2E7OA 3P5OA 5LKXA 4QEWA 3K2JA 4QYLA 5F62A 4CUSA 4TZ8A 5TB6A 4NR6A 5CGPA 4LZRA 1WUGA 5CQ5A 3U5KA 3S91A 5FE9A 4YADA 5I29A 5CU8A 5I80A 3JVLA 5G4RA 4O74A 5ENJA 4YY6A 3GG3A 4Z1QA 5FBXA 4QR5A 5IGLA 5FE8A 5ENIA 5A5RA 5DBMA 5CUAA 5HQ7A 5D3RA 2H60A 4NR9A 5BT5A 4QSUA 4HXOA 2OUOA 4HXRA 4N4HA 3P1CA 5D0CA 5E0RA 4IOOA 4O7FA 4A9JA 5EPBA 3QZSA 2E7NA 3UVDA 2GRCA 4HXPA 2WP2A 4J3IA 4YYDA 4LYIA 2G4AA 5L8TA 2EJNA 3AQAA 4E96A 4NYXA 4UYEA 3VKGA 5AD2A 4YYNA 4HBYA 3G0JA 5L98A 3U5OA 3FKMX 5EPSA 3DAIA 4HXNA 5FE3A 5EI4A 5A85A 2YEKA 5EVAA 5F25A 3UV5A 4BHWA 3SVFA 2R10A 5HFQA 4OGJA 5D3HA 4CFLA 4QEVA 4NRAA 5CUBA 4IR6A 4QR4A 3LQIA 5K29A 4TYLA 4QSXA 4TQNA 4LR6A 5CUGA 5FE4A 5C89A 2MJVB 4KV4A 4MR4A 5H85A 3Q2EA 5I89A 2I7KA 5JWMA 2RI7A 5CQAA 4ALGA 3IU6A 5CUCA 3MQMA 5DX4A 5ENHA 3UVYA 5HQ5A 5HELA 4CUPA 2YDWA 4MEQA 2L84A 4BW1A 3O37A 4J0RA 5HFRA 2YELA 4AKIA 4YYGA 3DWYA 4N4GA 5LVQA 1E6IA 3I3JA 5F60A 4QR3A 4QB3A 4A9NA 5BT3A 4UYDA 5FH8A 5I1QA 2DVSA 5EISA 4Y03A 5H1TA 2R0VA 5A5QA 4IR5A 5DYXA 5DKDA 4YABA 5D3PA 5D25A 4BW4A 2DVQA 2YYNA 5ETDA 4O7BA 4QZSA 4A9KA 3S92A 5EP7A 4O7EA 5FE0A 5EWDA 5L8UA 5D3JA 3UVXA 5II2A 4LDFA 4BJXA 4BW2A 5L96A 4PCIA 4YYKA 5EWHA 5EGUA 5ENFA 4NRBA 4UIVA 4ALHA 4UIUA 5L99A 4XYAA 5E9KA 3JVKA 4NYWA 4HBVA 5DLXA 5F1HA 5KTWA 4QSVA 5CTLA 5A82A 5I40A 5HRWA 5JI8A 5LJ1A 4A9OA 1EQFA 4QEUA 5LJ0A 4YY4A 4KV1A 4YC9A 3ERRA 5A5PA 4MENA 5LVRA 2R0SA 3TLPA 5A5SA 4YBSA 5CS8A 4CUUA 3QZVA 5HM0A 3JVJA 5DKCA 4QSRA 3HMHA 4Z6HA 5DYCA 4QNSA 4O70A 1ZS5A 1WUMA 4HXMA 4QYDA 4KCXA 2DWWA 5CUDA 3G0LA 5EPRA 4YBTA 4HXKA 4Z1SA 2L85A 5COIA 4RVRA 5DW1A 5CPEA 4WHWA 5EWWA 5FFYA 4GPJA 3D7CA 4HBXA 3NXBA 4QSQA 5ENBA 5E9IA 2N9GA 4Z6IA 3P1DA 5C85A 2LSPB 4OGIA 4NUCA 4AKHA
chains in the Genus database with same CATH topology
4Q0OA 5FH7A 4IR4A 5FG6A 5HENA 4C67A 5LKTA 3IU5A 4MR3A 5FE5A 4UYHA 5AD3A 4QSWA 4QY4A 4OUFA 3SVGA 5IGNA 4UIXA 4HXLA 4O7AA 4ZQLA 5KU3A 5IIDA 4J0SA 5E3GA 4CUTA 5ENGA 5HLSA 3SVHA 5ENEA 5C7NA 2OO1A 4NRCA 5HEMA 5IGMA 4TT6A 4TT2A 4UITA 5H1UA 4XUAA 5CQ4A 5F61A 5A81A 3ZYUA 5A5NA 4LC2A 5FE2A 5H1VA 4A9EA 4IR3A 3LXJA 4A9LA 5E73A 4NQMA 5FG4A 3UV2A 4MR5A 4PTBA 2OSSA 5FH6A 4NUEA 5D7XA 4A9IA 5CZGA 4XUBA 4NR5A 5I7YA 4IORA 3UW9A 5BT4A 3P1EA 5A5OA 5F2PA 5A7CA 4TTEA 3U5NA 5HCLA 4A9HA 5ETBA 4NR4A 5DYUA 4CL9A 3O35A 4LZSA 5E74A 1JM4B 2D82A 4QUTA 5FE1A 3AADA 4IOQA 4NUDA 3O36A 3UVWA 5DYAA 3U5MA 2R0YA 4ZW1A 4FLPA 2RNWA 3HMEA 4PCEA 5CRZA 4WHUA 4QSTA 5EA1A 5DY7A 2YW5A 5CQTA 5D3NA 5I7XA 4YYHA 2KTBB 5CQ8A 5F5ZA 5LKZA 2RNXA 5DKHA 5FFWA 5EICA 3LQHA 5FB0A 2F6NA 4TZ2A 4UIWA 5F3AA 5F63A 4YH3A 5C4QA 4TU4A 5IG6A 4YYIA 5CFWA 4BW3A 3MB3A 4HXSA 5E3DA 4YAXA 5EV9A 5CY9A 5FE7A 5DFCA 5DLZA 4TT4A 3U5JA 4WIVA 4F3IA 3U5PA 5FFVA 5DFDA 4N3WA 4NYVA 4O78A 4LYWA 5G4SA 4A9MA 4O75A 4O72A 2YEMA 5KTUA 3UV4A 3P1FA 4UIYA 4QBMA 3MXFA 4TU6A 4ZC9A 4X2IA 4A9FA 5LUUA 5L97A 5EM3A 2NXBA 4PS5A 3QZTA 4CLBA 4YYMA 5II1A 5TCMA 4MR6A 4UIZA 4LZ2A 3MULA 4UYFB 1JSPB 2DVRA 4LRGA 4YATA 2DATA 4C66A 5I86A 3O33A 1N72A 5F36A 3LJWA 5F1LA 5D26A 5HRXA 5D3SA 2I8NA 5HQ6A 4J1PA 3MB4A 5DW2A 5FG5A 2E3KA 4QSPA 4QC3A 4YYJA 5HJCA 5LKUA 4DONA 4XY9A 5E9YA 4PKLA 4N4FA 5A83A 4YK0A 5AMEA 5EWVA 2RO1A 5D24A 2RNYA 2WP1A 4N4IA 4O77A 4NR7A 5I83A 4NR8A 2RS9B 3O34A 4CURA 4O76A 4LYSA 5E9VA 5IGKA 4QSSA 5CQ6A 4PY6A 5C8GA 2F6JA 4YH4A 5LJ2A 5J0DA 5FB1A 5E7DA 5D3TA 2DVVA 4O7CA 2YQDA 5DFBA 4QUUA 5CQ3A 4UYFA 5CQ7A 4HBWA 5FDZA 5HRVA 4MEOA 3Q2FA 3U5LA 5D3LA 1F68A 5FE6A 1X0JA 4CUQA 5E9LA 5KHMA 4Z93A 5AMFA 2FSAA 5CRMA 3HMFA 4NQNA 2RFJA 5I88A 3LQJA 5C87A 4QC1A 5EQ1A 3ONIA 5EU1A 4TS8A 4NXJA 3MUKA 3RCWA 4YBMA 5CUEA 4MEPA 2L5EA 4AKNA 5KTXA 5CP5A 5ACYA 5ENCA 4NS5A 2DKWA 5EWCA 2D9EA 4O71A 4Q0NA 3JVMA 4XY8A 5IBNA 4CFKA 5E9MA 4UYGA 5KO4A 5EK9A 2E7OA 3P5OA 5LKXA 4QEWA 3K2JA 4QYLA 5F62A 4CUSA 4TZ8A 5TB6A 4NR6A 5CGPA 4LZRA 1WUGA 5CQ5A 3U5KA 3S91A 5FE9A 4YADA 5I29A 5CU8A 5I80A 3JVLA 5G4RA 4O74A 5ENJA 4YY6A 3GG3A 4Z1QA 5FBXA 4QR5A 5IGLA 5FE8A 5ENIA 5A5RA 5DBMA 5CUAA 5HQ7A 5D3RA 2H60A 4NR9A 5BT5A 4QSUA 4HXOA 2OUOA 4HXRA 4N4HA 3P1CA 5D0CA 5E0RA 4IOOA 4O7FA 4A9JA 5EPBA 3QZSA 2E7NA 3UVDA 2GRCA 4HXPA 2WP2A 4J3IA 4YYDA 4LYIA 2G4AA 5L8TA 3AQAA 4E96A 4NYXA 4UYEA 5AD2A 4YYNA 4HBYA 3G0JA 5L98A 3U5OA 3FKMX 5EPSA 3DAIA 4HXNA 5FE3A 5EI4A 5A85A 2YEKA 5EVAA 5F25A 3UV5A 4BHWA 3SVFA 2R10A 5HFQA 4OGJA 5D3HA 4CFLA 4QEVA 4NRAA 5CUBA 4IR6A 4QR4A 3LQIA 5K29A 4TYLA 4TQNA 4QSXA 4LR6A 5CUGA 5FE4A 5C89A 2MJVB 4KV4A 4MR4A 5H85A 3Q2EA 5I89A 2I7KA 5JWMA 2RI7A 5CQAA 4ALGA 3IU6A 5CUCA 3MQMA 5DX4A 5ENHA 3UVYA 5HQ5A 5HELA 4CUPA 2YDWA 4MEQA 2L84A 4BW1A 3O37A 4J0RA 5HFRA 2YELA 4YYGA 3DWYA 4N4GA 5LVQA 1E6IA 3I3JA 5F60A 4QR3A 4QB3A 4A9NA 5BT3A 4UYDA 5FH8A 5I1QA 2DVSA 5EISA 4Y03A 5H1TA 2R0VA 5A5QA 4IR5A 5DYXA 5DKDA 4YABA 5D3PA 5D25A 4BW4A 2DVQA 2YYNA 5ETDA 4O7BA 4QZSA 4A9KA 3S92A 5EP7A 4O7EA 5FE0A 5EWDA 5L8UA 5D3JA 3UVXA 5II2A 4LDFA 4BJXA 4BW2A 5L96A 4PCIA 4YYKA 5EWHA 5EGUA 5ENFA 4NRBA 4UIVA 4ALHA 4UIUA 5L99A 4XYAA 5E9KA 3JVKA 4NYWA 4HBVA 5DLXA 5F1HA 5KTWA 4QSVA 5CTLA 5A82A 5I40A 5HRWA 5JI8A 5LJ1A 4A9OA 1EQFA 4QEUA 5LJ0A 4YY4A 4KV1A 4YC9A 5A5PA 4MENA 5LVRA 2R0SA 3TLPA 5A5SA 4YBSA 5CS8A 4CUUA 3QZVA 5HM0A 3JVJA 5DKCA 4QSRA 3HMHA 4Z6HA 5DYCA 4QNSA 4O70A 1ZS5A 1WUMA 4HXMA 4QYDA 4KCXA 2DWWA 5CUDA 3G0LA 5EPRA 4YBTA 4HXKA 4Z1SA 2L85A 5COIA 4RVRA 5DW1A 5CPEA 4WHWA 5EWWA 5FFYA 4GPJA 3D7CA 4HBXA 3NXBA 4QSQA 5ENBA 5E9IA 2N9GA 4Z6IA 3P1DA 5C85A 2LSPB 4OGIA 4NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0O A;  5FH7 A;  4IR4 A;  5FG6 A;  5HEN A;  4C67 A;  5LKT A;  3IU5 A;  4MR3 A;  5FE5 A;  4UYH A;  5AD3 A;  4QSW A;  4QY4 A;  4OUF A;  3SVG A;  5IGN A;  4UIX A;  4HXL A;  4O7A A;  4ZQL A;  5KU3 A;  5IID A;  4J0S A;  5E3G A;  4CUT A;  5ENG A;  5HLS A;  3SVH A;  5ENE A;  5C7N A;  2OO1 A;  4NRC A;  5HEM A;  5IGM A;  4TT6 A;  4TT2 A;  4UIT A;  5H1U A;  4XUA A;  5CQ4 A;  5F61 A;  5A81 A;  3ZYU A;  5A5N A;  4LC2 A;  5FE2 A;  5H1V A;  4A9E A;  4IR3 A;  3LXJ A;  4A9L A;  5E73 A;  4NQM A;  5FG4 A;  3UV2 A;  4MR5 A;  4PTB A;  2OSS A;  5FH6 A;  4NUE A;  5D7X A;  4A9I A;  5CZG A;  4XUB A;  4NR5 A;  5I7Y A;  4IOR A;  3UW9 A;  5BT4 A;  3P1E A;  5A5O A;  5F2P A;  5A7C A;  4TTE A;  3U5N A;  5HCL A;  4A9H A;  5ETB A;  4NR4 A;  5DYU A;  4CL9 A;  3O35 A;  4LZS A;  5E74 A;  1JM4 B;  2D82 A;  4QUT A;  5FE1 A;  3AAD A;  4IOQ A;  4NUD A;  3O36 A;  3UVW A;  5DYA A;  3U5M A;  2R0Y A;  4ZW1 A;  4FLP A;  2RNW A;  3HME A;  4PCE A;  5CRZ A;  4WHU A;  4QST A;  5EA1 A;  5DY7 A;  2YW5 A;  5CQT A;  5D3N A;  5I7X A;  4YYH A;  2KTB B;  5CQ8 A;  5F5Z A;  5LKZ A;  2RNX A;  5DKH A;  5FFW A;  5EIC A;  3LQH A;  5FB0 A;  2F6N A;  4TZ2 A;  4UIW A;  5F3A A;  5F63 A;  4YH3 A;  5C4Q A;  4TU4 A;  5IG6 A;  4YYI A;  5CFW A;  4BW3 A;  3MB3 A;  4HXS A;  5E3D A;  4YAX A;  5EV9 A;  5CY9 A;  5FE7 A;  5DFC A;  5DLZ A;  4TT4 A;  3U5J A;  4WIV A;  4F3I A;  3U5P A;  5FFV A;  5DFD A;  4N3W A;  4NYV A;  4O78 A;  4LYW A;  5G4S A;  4A9M A;  4O75 A;  4O72 A;  2YEM A;  5KTU A;  3UV4 A;  3P1F A;  4UIY A;  4QBM A;  3MXF A;  4TU6 A;  4ZC9 A;  4X2I A;  4A9F A;  5LUU A;  5L97 A;  5EM3 A;  2NXB A;  4PS5 A;  3QZT A;  4CLB A;  4YYM A;  5II1 A;  5TCM A;  4MR6 A;  4UIZ A;  4LZ2 A;  3MUL A;  4UYF B;  1JSP B;  2DVR A;  4LRG A;  4YAT A;  2DAT A;  4C66 A;  5I86 A;  3O33 A;  1N72 A;  5F36 A;  3LJW A;  5F1L A;  5D26 A;  5HRX A;  5D3S A;  2I8N A;  5HQ6 A;  4J1P A;  3MB4 A;  5DW2 A;  5FG5 A;  2E3K A;  4QSP A;  4QC3 A;  4YYJ A;  5HJC A;  5LKU A;  4DON A;  4XY9 A;  5E9Y A;  4PKL A;  4N4F A;  5A83 A;  4YK0 A;  5AME A;  5EWV A;  2RO1 A;  5D24 A;  2RNY A;  2WP1 A;  4N4I A;  4O77 A;  4NR7 A;  5I83 A;  4NR8 A;  2RS9 B;  3O34 A;  4CUR A;  4O76 A;  4LYS A;  5E9V A;  5IGK A;  4QSS A;  5CQ6 A;  4PY6 A;  5C8G A;  2F6J A;  4YH4 A;  5LJ2 A;  5J0D A;  5FB1 A;  5E7D A;  5D3T A;  2DVV A;  4O7C A;  2YQD A;  5DFB A;  4QUU A;  5CQ3 A;  4UYF A;  5CQ7 A;  4HBW A;  5FDZ A;  5HRV A;  4MEO A;  3Q2F A;  3U5L A;  5D3L A;  1F68 A;  5FE6 A;  1X0J A;  4CUQ A;  5E9L A;  5KHM A;  4Z93 A;  5AMF A;  2FSA A;  5CRM A;  3HMF A;  4NQN A;  2RFJ A;  5I88 A;  3LQJ A;  5C87 A;  4QC1 A;  5EQ1 A;  3ONI A;  5EU1 A;  4TS8 A;  4NXJ A;  3MUK A;  3RCW A;  4YBM A;  5CUE A;  4MEP A;  2L5E A;  4AKN A;  5KTX A;  5CP5 A;  5ACY A;  5ENC A;  4NS5 A;  2DKW A;  5EWC A;  2D9E A;  4O71 A;  4Q0N A;  3JVM A;  4XY8 A;  5IBN A;  4CFK A;  5E9M A;  4UYG A;  5KO4 A;  5EK9 A;  2E7O A;  3P5O A;  5LKX A;  4QEW A;  3K2J A;  4QYL A;  5F62 A;  4CUS A;  4TZ8 A;  5TB6 A;  4NR6 A;  5CGP A;  4LZR A;  1WUG A;  5CQ5 A;  3U5K A;  3S91 A;  5FE9 A;  4YAD A;  5I29 A;  5CU8 A;  5I80 A;  3JVL A;  5G4R A;  4O74 A;  5ENJ A;  4YY6 A;  3GG3 A;  4Z1Q A;  5FBX A;  4QR5 A;  5IGL A;  5FE8 A;  5ENI A;  5A5R A;  5DBM A;  5CUA A;  5HQ7 A;  5D3R A;  2H60 A;  4NR9 A;  5BT5 A;  4QSU A;  4HXO A;  2OUO A;  4HXR A;  4N4H A;  3P1C A;  5D0C A;  5E0R A;  4IOO A;  4O7F A;  4A9J A;  5EPB A;  3QZS A;  2E7N A;  3UVD A;  2GRC A;  4HXP A;  2WP2 A;  4J3I A;  4YYD A;  4LYI A;  2G4A A;  5L8T A;  3AQA A;  4E96 A;  4NYX A;  4UYE A;  5AD2 A;  4YYN A;  4HBY A;  3G0J A;  5L98 A;  3U5O A;  3FKM X;  5EPS A;  3DAI A;  4HXN A;  5FE3 A;  5EI4 A;  5A85 A;  2YEK A;  5EVA A;  5F25 A;  3UV5 A;  4BHW A;  3SVF A;  2R10 A;  5HFQ A;  4OGJ A;  5D3H A;  4CFL A;  4QEV A;  4NRA A;  5CUB A;  4IR6 A;  4QR4 A;  3LQI A;  5K29 A;  4TYL A;  4TQN A;  4QSX A;  4LR6 A;  5CUG A;  5FE4 A;  5C89 A;  2MJV B;  4KV4 A;  4MR4 A;  5H85 A;  3Q2E A;  5I89 A;  2I7K A;  5JWM A;  2RI7 A;  5CQA A;  4ALG A;  3IU6 A;  5CUC A;  3MQM A;  5DX4 A;  5ENH A;  3UVY A;  5HQ5 A;  5HEL A;  4CUP A;  2YDW A;  4MEQ A;  2L84 A;  4BW1 A;  3O37 A;  4J0R A;  5HFR A;  2YEL A;  4YYG A;  3DWY A;  4N4G A;  5LVQ A;  1E6I A;  3I3J A;  5F60 A;  4QR3 A;  4QB3 A;  4A9N A;  5BT3 A;  4UYD A;  5FH8 A;  5I1Q A;  2DVS A;  5EIS A;  4Y03 A;  5H1T A;  2R0V A;  5A5Q A;  4IR5 A;  5DYX A;  5DKD A;  4YAB A;  5D3P A;  5D25 A;  4BW4 A;  2DVQ A;  2YYN A;  5ETD A;  4O7B A;  4QZS A;  4A9K A;  3S92 A;  5EP7 A;  4O7E A;  5FE0 A;  5EWD A;  5L8U A;  5D3J A;  3UVX A;  5II2 A;  4LDF A;  4BJX A;  4BW2 A;  5L96 A;  4PCI A;  4YYK A;  5EWH A;  5EGU A;  5ENF A;  4NRB A;  4UIV A;  4ALH A;  4UIU A;  5L99 A;  4XYA A;  5E9K A;  3JVK A;  4NYW A;  4HBV A;  5DLX A;  5F1H A;  5KTW A;  4QSV A;  5CTL A;  5A82 A;  5I40 A;  5HRW A;  5JI8 A;  5LJ1 A;  4A9O A;  1EQF A;  4QEU A;  5LJ0 A;  4YY4 A;  4KV1 A;  4YC9 A;  5A5P A;  4MEN A;  5LVR A;  2R0S A;  3TLP A;  5A5S A;  4YBS A;  5CS8 A;  4CUU A;  3QZV A;  5HM0 A;  3JVJ A;  5DKC A;  4QSR A;  3HMH A;  4Z6H A;  5DYC A;  4QNS A;  4O70 A;  1ZS5 A;  1WUM A;  4HXM A;  4QYD A;  4KCX A;  2DWW A;  5CUD A;  3G0L A;  5EPR A;  4YBT A;  4HXK A;  4Z1S A;  2L85 A;  5COI A;  4RVR A;  5DW1 A;  5CPE A;  4WHW A;  5EWW A;  5FFY A;  4GPJ A;  3D7C A;  4HBX A;  3NXB A;  4QSQ A;  5ENB A;  5E9I A;  2N9G A;  4Z6I A;  3P1D A;  5C85 A;  2LSP B;  4OGI A;  4NUC A; 
#chains in the Genus database with same CATH topology
 4Q0O A;  5FH7 A;  4IR4 A;  5FG6 A;  5HEN A;  4C67 A;  5LKT A;  3IU5 A;  4MR3 A;  5FE5 A;  4UYH A;  5AD3 A;  4QSW A;  4QY4 A;  4OUF A;  3SVG A;  5IGN A;  4UIX A;  4HXL A;  4O7A A;  4ZQL A;  5KU3 A;  5IID A;  4J0S A;  5E3G A;  4CUT A;  5ENG A;  5HLS A;  3SVH A;  5ENE A;  5C7N A;  2OO1 A;  4NRC A;  5HEM A;  5IGM A;  4TT6 A;  4TT2 A;  4UIT A;  5H1U A;  4XUA A;  5CQ4 A;  5F61 A;  5A81 A;  3ZYU A;  5A5N A;  4LC2 A;  5FE2 A;  5H1V A;  4A9E A;  4IR3 A;  3LXJ A;  4A9L A;  5E73 A;  4NQM A;  5FG4 A;  3UV2 A;  4MR5 A;  4PTB A;  2OSS A;  5FH6 A;  4NUE A;  5D7X A;  4A9I A;  5CZG A;  4XUB A;  4NR5 A;  5I7Y A;  4IOR A;  3UW9 A;  5BT4 A;  3P1E A;  5A5O A;  5F2P A;  5A7C A;  4TTE A;  3U5N A;  5HCL A;  4A9H A;  5ETB A;  4NR4 A;  5DYU A;  4CL9 A;  3O35 A;  4LZS A;  5E74 A;  1JM4 B;  2D82 A;  4QUT A;  5FE1 A;  3AAD A;  4IOQ A;  4NUD A;  3O36 A;  3UVW A;  5DYA A;  3U5M A;  2R0Y A;  4ZW1 A;  4FLP A;  2RNW A;  3HME A;  4PCE A;  5CRZ A;  4WHU A;  4QST A;  5EA1 A;  5DY7 A;  2YW5 A;  5CQT A;  5D3N A;  5I7X A;  4YYH A;  2KTB B;  5CQ8 A;  5F5Z A;  5LKZ A;  2RNX A;  5DKH A;  5FFW A;  5EIC A;  3LQH A;  5FB0 A;  2F6N A;  3VKH A;  4TZ2 A;  4UIW A;  5F3A A;  5F63 A;  4YH3 A;  5C4Q A;  4TU4 A;  5IG6 A;  4YYI A;  5CFW A;  4BW3 A;  3D1B A;  3MB3 A;  4HXS A;  5E3D A;  4YAX A;  5EV9 A;  5CY9 A;  5FE7 A;  5DFC A;  5DLZ A;  4TT4 A;  3U5J A;  4WIV A;  4F3I A;  3U5P A;  5FFV A;  5DFD A;  1ZKR A;  4N3W A;  4NYV A;  4O78 A;  4LYW A;  5G4S A;  4A9M A;  4O75 A;  4O72 A;  2YEM A;  5KTU A;  3UV4 A;  3P1F A;  4UIY A;  4QBM A;  3MXF A;  4TU6 A;  4ZC9 A;  4X2I A;  4A9F A;  5LUU A;  5L97 A;  5EM3 A;  2NXB A;  4PS5 A;  3QZT A;  4CLB A;  4YYM A;  5II1 A;  5TCM A;  4MR6 A;  4UIZ A;  4LZ2 A;  3MUL A;  3D1D A;  4UYF B;  1JSP B;  2DVR A;  4LRG A;  4YAT A;  2DAT A;  4C66 A;  5I86 A;  4AI6 A;  3O33 A;  1N72 A;  5F36 A;  3LJW A;  5F1L A;  5D26 A;  5HRX A;  5D3S A;  2I8N A;  5HQ6 A;  4J1P A;  3MB4 A;  5DW2 A;  5FG5 A;  2E3K A;  4QSP A;  4QC3 A;  4YYJ A;  5HJC A;  5LKU A;  4DON A;  4XY9 A;  5E9Y A;  4PKL A;  4N4F A;  5A83 A;  4YK0 A;  5AME A;  5EWV A;  2RO1 A;  5D24 A;  2RNY A;  2WP1 A;  4N4I A;  4O77 A;  4NR7 A;  5I83 A;  4NR8 A;  2RS9 B;  3O34 A;  4CUR A;  4O76 A;  4LYS A;  5E9V A;  5IGK A;  4QSS A;  5CQ6 A;  4PY6 A;  5C8G A;  2F6J A;  4YH4 A;  5LJ2 A;  5J0D A;  5FB1 A;  5E7D A;  5D3T A;  2DVV A;  4O7C A;  2YQD A;  5DFB A;  4QUU A;  5CQ3 A;  4UYF A;  5CQ7 A;  4HBW A;  5FDZ A;  5HRV A;  4MEO A;  3Q2F A;  3U5L A;  5D3L A;  1F68 A;  5FE6 A;  1X0J A;  4CUQ A;  5E9L A;  5KHM A;  4Z93 A;  5AMF A;  2FSA A;  5CRM A;  3HMF A;  4NQN A;  2RFJ A;  5I88 A;  3LQJ A;  5C87 A;  4QC1 A;  1PUO A;  5EQ1 A;  3ONI A;  5EU1 A;  4TS8 A;  4NXJ A;  3MUK A;  3RCW A;  4YBM A;  5CUE A;  4MEP A;  2L5E A;  4AKN A;  5KTX A;  5CP5 A;  4AKG A;  5ACY A;  5ENC A;  4NS5 A;  2DKW A;  5EWC A;  2D9E A;  4O71 A;  4Q0N A;  3JVM A;  4XY8 A;  5IBN A;  4CFK A;  5E9M A;  4UYG A;  5KO4 A;  5EK9 A;  2E7O A;  3P5O A;  5LKX A;  4QEW A;  3K2J A;  4QYL A;  5F62 A;  4CUS A;  4TZ8 A;  5TB6 A;  4NR6 A;  5CGP A;  4LZR A;  1WUG A;  5CQ5 A;  3U5K A;  3S91 A;  5FE9 A;  4YAD A;  5I29 A;  5CU8 A;  5I80 A;  3JVL A;  5G4R A;  4O74 A;  5ENJ A;  4YY6 A;  3GG3 A;  4Z1Q A;  5FBX A;  4QR5 A;  5IGL A;  5FE8 A;  5ENI A;  5A5R A;  5DBM A;  5CUA A;  5HQ7 A;  5D3R A;  2H60 A;  4NR9 A;  5BT5 A;  4QSU A;  4HXO A;  2OUO A;  4HXR A;  4N4H A;  3P1C A;  5D0C A;  5E0R A;  4IOO A;  4O7F A;  4A9J A;  5EPB A;  3QZS A;  2E7N A;  3UVD A;  2GRC A;  4HXP A;  2WP2 A;  4J3I A;  4YYD A;  4LYI A;  2G4A A;  5L8T A;  2EJN A;  3AQA A;  4E96 A;  4NYX A;  4UYE A;  3VKG A;  5AD2 A;  4YYN A;  4HBY A;  3G0J A;  5L98 A;  3U5O A;  3FKM X;  5EPS A;  3DAI A;  4HXN A;  5FE3 A;  5EI4 A;  5A85 A;  2YEK A;  5EVA A;  5F25 A;  3UV5 A;  4BHW A;  3SVF A;  2R10 A;  5HFQ A;  4OGJ A;  5D3H A;  4CFL A;  4QEV A;  4NRA A;  5CUB A;  4IR6 A;  4QR4 A;  3LQI A;  5K29 A;  4TYL A;  4QSX A;  4TQN A;  4LR6 A;  5CUG A;  5FE4 A;  5C89 A;  2MJV B;  4KV4 A;  4MR4 A;  5H85 A;  3Q2E A;  5I89 A;  2I7K A;  5JWM A;  2RI7 A;  5CQA A;  4ALG A;  3IU6 A;  5CUC A;  3MQM A;  5DX4 A;  5ENH A;  3UVY A;  5HQ5 A;  5HEL A;  4CUP A;  2YDW A;  4MEQ A;  2L84 A;  4BW1 A;  3O37 A;  4J0R A;  5HFR A;  2YEL A;  4AKI A;  4YYG A;  3DWY A;  4N4G A;  5LVQ A;  1E6I A;  3I3J A;  5F60 A;  4QR3 A;  4QB3 A;  4A9N A;  5BT3 A;  4UYD A;  5FH8 A;  5I1Q A;  2DVS A;  5EIS A;  4Y03 A;  5H1T A;  2R0V A;  5A5Q A;  4IR5 A;  5DYX A;  5DKD A;  4YAB A;  5D3P A;  5D25 A;  4BW4 A;  2DVQ A;  2YYN A;  5ETD A;  4O7B A;  4QZS A;  4A9K A;  3S92 A;  5EP7 A;  4O7E A;  5FE0 A;  5EWD A;  5L8U A;  5D3J A;  3UVX A;  5II2 A;  4LDF A;  4BJX A;  4BW2 A;  5L96 A;  4PCI A;  4YYK A;  5EWH A;  5EGU A;  5ENF A;  4NRB A;  4UIV A;  4ALH A;  4UIU A;  5L99 A;  4XYA A;  5E9K A;  3JVK A;  4NYW A;  4HBV A;  5DLX A;  5F1H A;  5KTW A;  4QSV A;  5CTL A;  5A82 A;  5I40 A;  5HRW A;  5JI8 A;  5LJ1 A;  4A9O A;  1EQF A;  4QEU A;  5LJ0 A;  4YY4 A;  4KV1 A;  4YC9 A;  3ERR A;  5A5P A;  4MEN A;  5LVR A;  2R0S A;  3TLP A;  5A5S A;  4YBS A;  5CS8 A;  4CUU A;  3QZV A;  5HM0 A;  3JVJ A;  5DKC A;  4QSR A;  3HMH A;  4Z6H A;  5DYC A;  4QNS A;  4O70 A;  1ZS5 A;  1WUM A;  4HXM A;  4QYD A;  4KCX A;  2DWW A;  5CUD A;  3G0L A;  5EPR A;  4YBT A;  4HXK A;  4Z1S A;  2L85 A;  5COI A;  4RVR A;  5DW1 A;  5CPE A;  4WHW A;  5EWW A;  5FFY A;  4GPJ A;  3D7C A;  4HBX A;  3NXB A;  4QSQ A;  5ENB A;  5E9I A;  2N9G A;  4Z6I A;  3P1D A;  5C85 A;  2LSP B;  4OGI A;  4NUC A;  4AKH A; 
#chains in the Genus database with same CATH homology
 4Q0O A;  5FH7 A;  4IR4 A;  5FG6 A;  5HEN A;  4C67 A;  5LKT A;  3IU5 A;  4MR3 A;  5FE5 A;  4UYH A;  5AD3 A;  4QSW A;  4QY4 A;  4OUF A;  3SVG A;  5IGN A;  4UIX A;  4HXL A;  4O7A A;  4ZQL A;  5KU3 A;  5IID A;  4J0S A;  5E3G A;  4CUT A;  5ENG A;  5HLS A;  3SVH A;  5ENE A;  5C7N A;  2OO1 A;  4NRC A;  5HEM A;  5IGM A;  4TT6 A;  4TT2 A;  4UIT A;  5H1U A;  4XUA A;  5CQ4 A;  5F61 A;  5A81 A;  3ZYU A;  5A5N A;  4LC2 A;  5FE2 A;  5H1V A;  4A9E A;  4IR3 A;  3LXJ A;  4A9L A;  5E73 A;  4NQM A;  5FG4 A;  3UV2 A;  4MR5 A;  4PTB A;  2OSS A;  5FH6 A;  4NUE A;  5D7X A;  4A9I A;  5CZG A;  4XUB A;  4NR5 A;  5I7Y A;  4IOR A;  3UW9 A;  5BT4 A;  3P1E A;  5A5O A;  5F2P A;  5A7C A;  4TTE A;  3U5N A;  5HCL A;  4A9H A;  5ETB A;  4NR4 A;  5DYU A;  4CL9 A;  3O35 A;  4LZS A;  5E74 A;  1JM4 B;  2D82 A;  4QUT A;  5FE1 A;  3AAD A;  4IOQ A;  4NUD A;  3O36 A;  3UVW A;  5DYA A;  3U5M A;  2R0Y A;  4ZW1 A;  4FLP A;  2RNW A;  3HME A;  4PCE A;  5CRZ A;  4WHU A;  4QST A;  5EA1 A;  5DY7 A;  2YW5 A;  5CQT A;  5D3N A;  5I7X A;  4YYH A;  2KTB B;  5CQ8 A;  5F5Z A;  5LKZ A;  2RNX A;  5DKH A;  5FFW A;  5EIC A;  3LQH A;  5FB0 A;  2F6N A;  4TZ2 A;  4UIW A;  5F3A A;  5F63 A;  4YH3 A;  5C4Q A;  4TU4 A;  5IG6 A;  4YYI A;  5CFW A;  4BW3 A;  3MB3 A;  4HXS A;  5E3D A;  4YAX A;  5EV9 A;  5CY9 A;  5FE7 A;  5DFC A;  5DLZ A;  4TT4 A;  3U5J A;  4WIV A;  4F3I A;  3U5P A;  5FFV A;  5DFD A;  4N3W A;  4NYV A;  4O78 A;  4LYW A;  5G4S A;  4A9M A;  4O75 A;  4O72 A;  2YEM A;  5KTU A;  3UV4 A;  3P1F A;  4UIY A;  4QBM A;  3MXF A;  4TU6 A;  4ZC9 A;  4X2I A;  4A9F A;  5LUU A;  5L97 A;  5EM3 A;  2NXB A;  4PS5 A;  3QZT A;  4CLB A;  4YYM A;  5II1 A;  5TCM A;  4MR6 A;  4UIZ A;  4LZ2 A;  3MUL A;  4UYF B;  1JSP B;  2DVR A;  4LRG A;  4YAT A;  2DAT A;  4C66 A;  5I86 A;  3O33 A;  1N72 A;  5F36 A;  3LJW A;  5F1L A;  5D26 A;  5HRX A;  5D3S A;  2I8N A;  5HQ6 A;  4J1P A;  3MB4 A;  5DW2 A;  5FG5 A;  2E3K A;  4QSP A;  4QC3 A;  4YYJ A;  5HJC A;  5LKU A;  4DON A;  4XY9 A;  5E9Y A;  4PKL A;  4N4F A;  5A83 A;  4YK0 A;  5AME A;  5EWV A;  2RO1 A;  5D24 A;  2RNY A;  2WP1 A;  4N4I A;  4O77 A;  4NR7 A;  5I83 A;  4NR8 A;  2RS9 B;  3O34 A;  4CUR A;  4O76 A;  4LYS A;  5E9V A;  5IGK A;  4QSS A;  5CQ6 A;  4PY6 A;  5C8G A;  2F6J A;  4YH4 A;  5LJ2 A;  5J0D A;  5FB1 A;  5E7D A;  5D3T A;  2DVV A;  4O7C A;  2YQD A;  5DFB A;  4QUU A;  5CQ3 A;  4UYF A;  5CQ7 A;  4HBW A;  5FDZ A;  5HRV A;  4MEO A;  3Q2F A;  3U5L A;  5D3L A;  1F68 A;  5FE6 A;  1X0J A;  4CUQ A;  5E9L A;  5KHM A;  4Z93 A;  5AMF A;  2FSA A;  5CRM A;  3HMF A;  4NQN A;  2RFJ A;  5I88 A;  3LQJ A;  5C87 A;  4QC1 A;  5EQ1 A;  3ONI A;  5EU1 A;  4TS8 A;  4NXJ A;  3MUK A;  3RCW A;  4YBM A;  5CUE A;  4MEP A;  2L5E A;  4AKN A;  5KTX A;  5CP5 A;  5ACY A;  5ENC A;  4NS5 A;  2DKW A;  5EWC A;  2D9E A;  4O71 A;  4Q0N A;  3JVM A;  4XY8 A;  5IBN A;  4CFK A;  5E9M A;  4UYG A;  5KO4 A;  5EK9 A;  2E7O A;  3P5O A;  5LKX A;  4QEW A;  3K2J A;  4QYL A;  5F62 A;  4CUS A;  4TZ8 A;  5TB6 A;  4NR6 A;  5CGP A;  4LZR A;  1WUG A;  5CQ5 A;  3U5K A;  3S91 A;  5FE9 A;  4YAD A;  5I29 A;  5CU8 A;  5I80 A;  3JVL A;  5G4R A;  4O74 A;  5ENJ A;  4YY6 A;  3GG3 A;  4Z1Q A;  5FBX A;  4QR5 A;  5IGL A;  5FE8 A;  5ENI A;  5A5R A;  5DBM A;  5CUA A;  5HQ7 A;  5D3R A;  2H60 A;  4NR9 A;  5BT5 A;  4QSU A;  4HXO A;  2OUO A;  4HXR A;  4N4H A;  3P1C A;  5D0C A;  5E0R A;  4IOO A;  4O7F A;  4A9J A;  5EPB A;  3QZS A;  2E7N A;  3UVD A;  2GRC A;  4HXP A;  2WP2 A;  4J3I A;  4YYD A;  4LYI A;  2G4A A;  5L8T A;  3AQA A;  4E96 A;  4NYX A;  4UYE A;  5AD2 A;  4YYN A;  4HBY A;  3G0J A;  5L98 A;  3U5O A;  3FKM X;  5EPS A;  3DAI A;  4HXN A;  5FE3 A;  5EI4 A;  5A85 A;  2YEK A;  5EVA A;  5F25 A;  3UV5 A;  4BHW A;  3SVF A;  2R10 A;  5HFQ A;  4OGJ A;  5D3H A;  4CFL A;  4QEV A;  4NRA A;  5CUB A;  4IR6 A;  4QR4 A;  3LQI A;  5K29 A;  4TYL A;  4TQN A;  4QSX A;  4LR6 A;  5CUG A;  5FE4 A;  5C89 A;  2MJV B;  4KV4 A;  4MR4 A;  5H85 A;  3Q2E A;  5I89 A;  2I7K A;  5JWM A;  2RI7 A;  5CQA A;  4ALG A;  3IU6 A;  5CUC A;  3MQM A;  5DX4 A;  5ENH A;  3UVY A;  5HQ5 A;  5HEL A;  4CUP A;  2YDW A;  4MEQ A;  2L84 A;  4BW1 A;  3O37 A;  4J0R A;  5HFR A;  2YEL A;  4YYG A;  3DWY A;  4N4G A;  5LVQ A;  1E6I A;  3I3J A;  5F60 A;  4QR3 A;  4QB3 A;  4A9N A;  5BT3 A;  4UYD A;  5FH8 A;  5I1Q A;  2DVS A;  5EIS A;  4Y03 A;  5H1T A;  2R0V A;  5A5Q A;  4IR5 A;  5DYX A;  5DKD A;  4YAB A;  5D3P A;  5D25 A;  4BW4 A;  2DVQ A;  2YYN A;  5ETD A;  4O7B A;  4QZS A;  4A9K A;  3S92 A;  5EP7 A;  4O7E A;  5FE0 A;  5EWD A;  5L8U A;  5D3J A;  3UVX A;  5II2 A;  4LDF A;  4BJX A;  4BW2 A;  5L96 A;  4PCI A;  4YYK A;  5EWH A;  5EGU A;  5ENF A;  4NRB A;  4UIV A;  4ALH A;  4UIU A;  5L99 A;  4XYA A;  5E9K A;  3JVK A;  4NYW A;  4HBV A;  5DLX A;  5F1H A;  5KTW A;  4QSV A;  5CTL A;  5A82 A;  5I40 A;  5HRW A;  5JI8 A;  5LJ1 A;  4A9O A;  1EQF A;  4QEU A;  5LJ0 A;  4YY4 A;  4KV1 A;  4YC9 A;  5A5P A;  4MEN A;  5LVR A;  2R0S A;  3TLP A;  5A5S A;  4YBS A;  5CS8 A;  4CUU A;  3QZV A;  5HM0 A;  3JVJ A;  5DKC A;  4QSR A;  3HMH A;  4Z6H A;  5DYC A;  4QNS A;  4O70 A;  1ZS5 A;  1WUM A;  4HXM A;  4QYD A;  4KCX A;  2DWW A;  5CUD A;  3G0L A;  5EPR A;  4YBT A;  4HXK A;  4Z1S A;  2L85 A;  5COI A;  4RVR A;  5DW1 A;  5CPE A;  4WHW A;  5EWW A;  5FFY A;  4GPJ A;  3D7C A;  4HBX A;  3NXB A;  4QSQ A;  5ENB A;  5E9I A;  2N9G A;  4Z6I A;  3P1D A;  5C85 A;  2LSP B;  4OGI A;  4NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...