4A9HA

N-terminal bromodomain of human brd2 with 1-(2-methyl-1,2,3,4-tetrahydroquinolin-1-yl)ethan-1-one
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
112
structure length
112
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9hA00
4UYEA 5DLZA 3JVMA 4DONA 4O70A 5FE6A 2YDWA 4YADA 5FH8A 4LZRA 5E9LA 5JI8A 4ALGA 2DKWA 5CTLA 5IGNA 4PS5A 5C85A 5FE8A 5CS8A 4BW1A 4E96A 3D7CA 3P1CA 3O34A 4QR5A 5I80A 5DKHA 4NR9A 5EICA 5FH7A 4HXNA 5FE1A 4QSXA 4YC9A 5CUGA 5FH6A 5FE4A 5EISA 4QSPA 4O76A 3QZVA 5E9YA 2FSAA 5A5PA 3O37A 5TCMA 4NR6A 5E0RA 5HEMA 5E3GA 4N4IA 3RCWA 2D82A 4A9KA 5COIA 5LKXA 4HBYA 5F3AA 1WUMA 5D3LA 3U5NA 4HXSA 4HXPA 3G0LA 4TT6A 4MENA 4YYGA 5A82A 2R0VA 3LXJA 5II2A 5HLSA 5FE5A 5F5ZA 5C4QA 4A9EA 4MR5A 3DAIA 5DFDA 5IIDA 4YY6A 3TLPA 5D3PA 4XYAA 4YBMA 4YYKA 3P1EA 3Q2EA 4IORA 5EK9A 5HRXA 5IGLA 5L98A 4NUEA 5F62A 4QY4A 2OSSA 4UIXA 3UV2A 4A9LA 5EV9A 5FFWA 4LR6A 5D25A 5E74A 5KTUA 4CUSA 4F3IA 5HCLA 4N3WA 5FG6A 4IR5A 5E3DA 4UIWA 4ZW1A 4KV4A 4O74A 4UYFA 5L8UA 4QZSA 2WP2A 4J3IA 5ETDA 3ZYUA 5KTXA 4MEQA 4IOOA 3U5PA 4TYLA 5EWWA 2RNWA 2YW5A 5HFQA 4LC2A 4A9MA 5CUBA 5D3RA 5CFWA 2YEMA 5CQ6A 4UITA 5EI4A 5A5QA 2D9EA 5FE7A 4NR8A 4LYIA 5A83A 4N4GA 3O36A 4LYSA 4O7BA 5IGMA 4N4FA 4CUUA 4QSWA 3IU6A 3ONIA 4CLBA 4QNSA 4J0SA 4YYIA 5KU3A 3MUKA 5D3SA 4PCEA 4Z1SA 4QUTA 5JWMA 4O7EA 2OO1A 4TU6A 5FE0A 5I29A 5ENIA 1JSPB 5I1QA 2RI7A 4WHUA 5G4SA 2NXBA 4OGJA 5KTWA 5D7XA 4NR7A 5F60A 3LQJA 4QSRA 4UIZA 3LQHA 4HXMA 3HMEA 1N72A 3U5MA 3S91A 5L97A 5H1UA 5KO4A 5C8GA 2WP1A 4ZQLA 3U5KA 3UVXA 5CQ8A 4YABA 5HRWA 5DLXA 5H85A 5AMFA 4QYDA 5H1VA 2H60A 4O72A 4MR4A 4NR4A 1JM4B 4UIVA 5L8TA 4CFLA 3K2JA 4O7FA 5FB1A 4TQNA 5LVQA 3DWYA 5J0DA 5I7XA 2E3KA 2DATA 1EQFA 5C87A 4PCIA 5E9IA 3S92A 2G4AA 4MR3A 4NRBA 5A5NA 4NRAA 2E7OA 2RS9B 4LZSA 5F61A 2I8NA 4O7AA 3Q2FA 5EU1A 5A85A 5CUEA 2YYNA 5CZGA 4Z1QA 4NRCA 4HXOA 2R0SA 4QR3A 4NUDA 3AADA 4YY4A 4C66A 2RFJA 4Y03A 5EGUA 4QUUA 5DYCA 5EPBA 4CUQA 5ENGA 2MJVB 5A5RA 4Z6IA 4QSSA 2I7KA 5CP5A 5FG4A 4MEOA 4KCXA 5EQ1A 5DW1A 3HMFA 5HJCA 4NXJA 4LZ2A 3JVJA 5FBXA 3UV4A 4BHWA 5A5OA 2LSPB 4IR3A 5CUAA 5BT3A 4MR6A 5L99A 3UW9A 5E9MA 4YBTA 3U5OA 5FDZA 4CUPA 3O33A 5DYUA 4YYNA 3MXFA 5IG6A 5DKCA 3UVDA 5F1LA 2RNXA 3HMHA 4A9FA 5F2PA 5IBNA 4TTEA 2YQDA 4A9OA 3MQMA 2KTBB 4O77A 1X0JA 5EWHA 4QEWA 4ALHA 4YH3A 4A9IA 3P1FA 5F36A 4YYDA 3SVFA 5L96A 2R10A 5A5SA 5DFBA 5ENJA 2DVRA 4NQMA 4YYMA 4Q0NA 4LDFA 2OUOA 4IR4A 5D3JA 5H1TA 4QSVA 5F25A 5G4RA 5HRVA 5I86A 4PKLA 4YATA 5CQ4A 2DVQA 2DWWA 2YELA 4XUAA 5CQ7A 4J1PA 4QYLA 4NS5A 5EPSA 1F68A 4TT2A 5AD3A 2R0YA 5E9VA 4CUTA 5F63A 5D3NA 3IU5A 5DX4A 3NXBA 4RVRA 4BW3A 2RNYA 5II1A 5D3HA 3P5OA 5DY7A 5HENA 4C67A 4NYWA 4PY6A 4QBMA 1ZS5A 5EVAA 4HBXA 5HFRA 2L84A 5FFYA 4CFKA 2F6JA 4UYFB 3FKMX 5A81A 5A7CA 5I40A 5C89A 3GG3A 4O78A 5DYXA 5C7NA 5I89A 1WUGA 5E73A 4QC3A 5HQ5A 3SVHA 5K29A 4XY8A 3MULA 4OUFA 5E7DA 4CL9A 5BT4A 5CUCA 4IOQA 3UVWA 5AD2A 5CQ3A 4NYVA 1E6IA 5CU8A 5EM3A 4WIVA 5CQTA 4YAXA 4UIYA 4NUCA 5KHMA 4J0RA 5E9KA 5TB6A 5I7YA 4OGIA 3SVGA 5LKZA 5HELA 5LVRA 5EWDA 5ENHA 4LRGA 5DYAA 4YK0A 3MB3A 4ZC9A 5EA1A 5CRZA 4NR5A 5ENBA 2GRCA 3P1DA 4O75A 5I88A 4NQNA 4MEPA 2E7NA 4FLPA 5LKUA 4IR6A 4QSTA 2RO1A 5LKTA 5ENCA 4X2IA 5LUUA 4N4HA 5D26A 4A9HA 3LJWA 4O7CA 4A9NA 3AQAA 4KV1A 5EWCA 5DW2A 4A9JA 5FG5A 5LJ1A 5HQ6A 5CRMA 5FE2A 4NYXA 5CUDA 5HQ7A 4TS8A 5FB0A 4YH4A 4YYJA 4TZ2A 4YBSA 5FE9A 3O35A 3JVLA 4HXLA 5CY9A 4QSUA 3MB4A 5EWVA 4QB3A 4QEVA 2N9GA 4QR4A 5EPRA 5DKDA 4UYHA 5ENEA 4XUBA 4PTBA 4Z6HA 5HM0A 5BT5A 4HBWA 5FFVA 5D24A 5ENFA 3UV5A 2YEKA 5CQ5A 3UVYA 4BW2A 4Z93A 5IGKA 4Q0OA 4UIUA 4BJXA 3G0JA 5I83A 5LJ0A 5CQAA 3U5JA 4HXRA 4WHWA 5LJ2A 4YYHA 5ACYA 4HBVA 5EP7A 4O71A 4QC1A 2F6NA 2DVSA 2L5EA 4GPJA 2DVVA 4BW4A 4CURA 3LQIA 4UYGA 5D3TA 3JVKA 5FE3A 5ETBA 4QEUA 4AKNA 4XY9A 3QZTA 5DFCA 3QZSA 3I3JA 5CPEA 3U5LA 4TU4A 4LYWA 4TT4A 4TZ8A 5D0CA 4HXKA 5F1HA 5CGPA 5DBMA 5AMEA 4QSQA 2L85A 4UYDA
chains in the Genus database with same CATH superfamily
4UYEA 5DLZA 3JVMA 4DONA 4O70A 5FE6A 2YDWA 4YADA 5FH8A 4LZRA 5E9LA 5JI8A 4ALGA 2DKWA 5CTLA 5IGNA 4PS5A 5C85A 5FE8A 5CS8A 4BW1A 4E96A 3D7CA 3P1CA 3O34A 4QR5A 5I80A 5DKHA 4NR9A 5EICA 5FH7A 4HXNA 5FE1A 4QSXA 4YC9A 5CUGA 5FH6A 5FE4A 5EISA 4QSPA 4O76A 3QZVA 5E9YA 2FSAA 5A5PA 3O37A 5TCMA 4NR6A 5E0RA 5HEMA 5E3GA 4N4IA 3RCWA 2D82A 4A9KA 5COIA 5LKXA 2EJNA 4HBYA 5F3AA 1WUMA 5D3LA 3U5NA 4HXSA 4HXPA 3G0LA 4TT6A 4MENA 4YYGA 5A82A 2R0VA 3LXJA 5II2A 5HLSA 5FE5A 5F5ZA 5C4QA 4A9EA 4MR5A 3DAIA 5DFDA 5IIDA 4YY6A 3TLPA 5D3PA 4XYAA 4YBMA 4YYKA 3P1EA 3Q2EA 4IORA 5EK9A 5HRXA 5IGLA 5L98A 4NUEA 5F62A 4QY4A 2OSSA 4UIXA 3UV2A 4A9LA 5EV9A 5FFWA 4LR6A 5D25A 5E74A 5KTUA 4CUSA 4F3IA 5HCLA 4N3WA 5FG6A 4IR5A 5E3DA 4UIWA 4ZW1A 4KV4A 4O74A 4UYFA 5L8UA 4QZSA 2WP2A 4J3IA 5ETDA 3ZYUA 5KTXA 4MEQA 4IOOA 3U5PA 4TYLA 5EWWA 2RNWA 2YW5A 5HFQA 4LC2A 4A9MA 5CUBA 5D3RA 5CFWA 2YEMA 5CQ6A 4UITA 5EI4A 5A5QA 2D9EA 5FE7A 4NR8A 4LYIA 5A83A 4N4GA 3O36A 4LYSA 4O7BA 5IGMA 4N4FA 4CUUA 4QSWA 3IU6A 3ONIA 4CLBA 4QNSA 4J0SA 4YYIA 5KU3A 3MUKA 5D3SA 4PCEA 4Z1SA 4QUTA 5JWMA 4O7EA 2OO1A 4TU6A 5FE0A 5I29A 5ENIA 1JSPB 5I1QA 2RI7A 4WHUA 5G4SA 2NXBA 4OGJA 5KTWA 5D7XA 4NR7A 5F60A 3LQJA 4QSRA 4UIZA 3LQHA 4HXMA 3HMEA 1N72A 3U5MA 3S91A 5L97A 5H1UA 5KO4A 5C8GA 2WP1A 4ZQLA 3U5KA 3UVXA 5CQ8A 4YABA 5HRWA 5DLXA 5H85A 5AMFA 4QYDA 5H1VA 2H60A 4O72A 4MR4A 4NR4A 1JM4B 4UIVA 5L8TA 4CFLA 3K2JA 4O7FA 5FB1A 4TQNA 5LVQA 3DWYA 5J0DA 5I7XA 2E3KA 2DATA 1EQFA 5C87A 4PCIA 5E9IA 3S92A 2G4AA 4MR3A 4NRBA 5A5NA 4NRAA 2E7OA 2RS9B 4LZSA 5F61A 2I8NA 4O7AA 3Q2FA 5EU1A 5A85A 5CUEA 2YYNA 3ERRA 5CZGA 4Z1QA 4NRCA 4HXOA 2R0SA 4QR3A 4NUDA 3AADA 4YY4A 4C66A 2RFJA 4Y03A 5EGUA 4QUUA 5DYCA 5EPBA 4CUQA 5ENGA 3VKGA 2MJVB 5A5RA 4Z6IA 4QSSA 2I7KA 5CP5A 5FG4A 4MEOA 4KCXA 5EQ1A 5DW1A 3HMFA 5HJCA 4NXJA 4AKIA 4LZ2A 3JVJA 5FBXA 3UV4A 4BHWA 5A5OA 2LSPB 4IR3A 5CUAA 5BT3A 4MR6A 5L99A 3UW9A 5E9MA 4YBTA 3U5OA 5FDZA 4CUPA 3D1BA 3O33A 5DYUA 4YYNA 3MXFA 5IG6A 5DKCA 3UVDA 5F1LA 2RNXA 3HMHA 4A9FA 5F2PA 5IBNA 4TTEA 2YQDA 4A9OA 3MQMA 2KTBB 4O77A 1X0JA 5EWHA 4QEWA 4ALHA 4YH3A 4A9IA 3P1FA 5F36A 4YYDA 3SVFA 5L96A 2R10A 5A5SA 5DFBA 5ENJA 2DVRA 4NQMA 4YYMA 4Q0NA 4LDFA 2OUOA 4IR4A 5D3JA 5H1TA 4QSVA 5F25A 5G4RA 5HRVA 5I86A 4AKHA 4PKLA 4YATA 5CQ4A 2DVQA 2DWWA 5CQ7A 2YELA 1ZKRA 4XUAA 4J1PA 4QYLA 4NS5A 5EPSA 1F68A 4TT2A 5AD3A 2R0YA 5E9VA 4CUTA 5F63A 5D3NA 3IU5A 5DX4A 3NXBA 4RVRA 4BW3A 2RNYA 5II1A 5D3HA 3P5OA 5DY7A 5HENA 4C67A 4NYWA 4PY6A 4QBMA 1ZS5A 5EVAA 4HBXA 5HFRA 2L84A 5FFYA 4CFKA 2F6JA 4UYFB 3FKMX 5A81A 5A7CA 5I40A 5C89A 3GG3A 4O78A 5DYXA 5C7NA 5I89A 1WUGA 5E73A 4QC3A 5HQ5A 3SVHA 5K29A 4XY8A 3MULA 4OUFA 5E7DA 4CL9A 5BT4A 5CUCA 4IOQA 3UVWA 5AD2A 5CQ3A 4NYVA 1E6IA 5CU8A 5EM3A 4WIVA 4AI6A 5CQTA 4YAXA 4UIYA 4NUCA 5KHMA 4J0RA 5E9KA 5TB6A 5I7YA 4OGIA 3SVGA 5LKZA 5HELA 5LVRA 5EWDA 3VKHA 5ENHA 4LRGA 5DYAA 4YK0A 3MB3A 4ZC9A 5EA1A 5CRZA 4NR5A 5ENBA 2GRCA 3P1DA 4O75A 5I88A 4NQNA 4MEPA 2E7NA 4FLPA 5LKUA 4IR6A 4QSTA 2RO1A 5LKTA 5ENCA 4X2IA 5LUUA 4N4HA 5D26A 4A9HA 3LJWA 4O7CA 4A9NA 3AQAA 4KV1A 4AKGA 5EWCA 5DW2A 4A9JA 5FG5A 5LJ1A 5HQ6A 5CRMA 5FE2A 4NYXA 5CUDA 5HQ7A 4TS8A 5FB0A 4YH4A 4YYJA 4TZ2A 4YBSA 5FE9A 3O35A 3JVLA 4HXLA 5CY9A 4QSUA 3MB4A 5EWVA 4QB3A 4QEVA 1PUOA 2N9GA 4QR4A 5EPRA 5DKDA 4UYHA 5ENEA 4XUBA 4PTBA 4Z6HA 5HM0A 5BT5A 4HBWA 5FFVA 5D24A 5ENFA 3UV5A 2YEKA 5CQ5A 3UVYA 4BW2A 4Z93A 5IGKA 4Q0OA 4UIUA 4BJXA 3G0JA 5I83A 5LJ0A 5CQAA 3U5JA 4HXRA 4WHWA 5LJ2A 4YYHA 5ACYA 4HBVA 5EP7A 4O71A 4QC1A 2F6NA 2DVSA 2L5EA 4GPJA 2DVVA 4BW4A 4CURA 3LQIA 4UYGA 5D3TA 3JVKA 5FE3A 5ETBA 4QEUA 4AKNA 4XY9A 3QZTA 5DFCA 3QZSA 3I3JA 5CPEA 3D1DA 4TU4A 4LYWA 3U5LA 4TT4A 4TZ8A 5D0CA 4HXKA 5F1HA 5CGPA 5DBMA 5AMEA 4QSQA 2L85A 4UYDA
chains in the Genus database with same CATH topology
4UYEA 5DLZA 3JVMA 4DONA 4O70A 5FE6A 2YDWA 4YADA 5FH8A 4LZRA 5E9LA 5JI8A 4ALGA 2DKWA 5CTLA 5IGNA 4PS5A 5C85A 5FE8A 5CS8A 4BW1A 4E96A 3D7CA 3P1CA 3O34A 4QR5A 5I80A 5DKHA 4NR9A 5EICA 5FH7A 4HXNA 5FE1A 4QSXA 4YC9A 5CUGA 5FH6A 5FE4A 5EISA 4QSPA 4O76A 3QZVA 5E9YA 2FSAA 5A5PA 3O37A 5TCMA 4NR6A 5E0RA 5HEMA 5E3GA 4N4IA 3RCWA 2D82A 4A9KA 5COIA 5LKXA 4HBYA 5F3AA 1WUMA 5D3LA 3U5NA 4HXSA 4HXPA 3G0LA 4TT6A 4MENA 4YYGA 5A82A 2R0VA 3LXJA 5II2A 5HLSA 5FE5A 5F5ZA 5C4QA 4A9EA 4MR5A 3DAIA 5DFDA 5IIDA 4YY6A 3TLPA 5D3PA 4XYAA 4YBMA 4YYKA 3P1EA 3Q2EA 4IORA 5EK9A 5HRXA 5IGLA 5L98A 4NUEA 5F62A 4QY4A 2OSSA 4UIXA 3UV2A 4A9LA 5EV9A 5FFWA 4LR6A 5D25A 5E74A 5KTUA 4CUSA 4F3IA 5HCLA 4N3WA 5FG6A 4IR5A 5E3DA 4UIWA 4ZW1A 4KV4A 4O74A 4UYFA 5L8UA 4QZSA 2WP2A 4J3IA 5ETDA 3ZYUA 5KTXA 4MEQA 4IOOA 3U5PA 4TYLA 5EWWA 2RNWA 2YW5A 5HFQA 4LC2A 4A9MA 5CUBA 5D3RA 5CFWA 2YEMA 5CQ6A 4UITA 5EI4A 5A5QA 2D9EA 5FE7A 4NR8A 4LYIA 5A83A 4N4GA 3O36A 4LYSA 4O7BA 5IGMA 4N4FA 4CUUA 4QSWA 3IU6A 3ONIA 4CLBA 4QNSA 4J0SA 4YYIA 5KU3A 3MUKA 5D3SA 4PCEA 4Z1SA 4QUTA 5JWMA 4O7EA 2OO1A 4TU6A 5FE0A 5I29A 5ENIA 1JSPB 5I1QA 2RI7A 4WHUA 5G4SA 2NXBA 4OGJA 5KTWA 5D7XA 4NR7A 5F60A 3LQJA 4QSRA 4UIZA 3LQHA 4HXMA 3HMEA 1N72A 3U5MA 3S91A 5L97A 5H1UA 5KO4A 5C8GA 2WP1A 4ZQLA 3U5KA 3UVXA 5CQ8A 4YABA 5HRWA 5DLXA 5H85A 5AMFA 4QYDA 5H1VA 2H60A 4O72A 4MR4A 4NR4A 1JM4B 4UIVA 5L8TA 4CFLA 3K2JA 4O7FA 5FB1A 4TQNA 5LVQA 3DWYA 5J0DA 5I7XA 2E3KA 2DATA 1EQFA 5C87A 4PCIA 5E9IA 3S92A 2G4AA 4MR3A 4NRBA 5A5NA 4NRAA 2E7OA 2RS9B 4LZSA 5F61A 2I8NA 4O7AA 3Q2FA 5EU1A 5A85A 5CUEA 2YYNA 5CZGA 4Z1QA 4NRCA 4HXOA 2R0SA 4QR3A 4NUDA 3AADA 4YY4A 4C66A 2RFJA 4Y03A 5EGUA 4QUUA 5DYCA 5EPBA 4CUQA 5ENGA 2MJVB 5A5RA 4Z6IA 4QSSA 2I7KA 5CP5A 5FG4A 4MEOA 4KCXA 5EQ1A 5DW1A 3HMFA 5HJCA 4NXJA 4LZ2A 3JVJA 5FBXA 3UV4A 4BHWA 5A5OA 2LSPB 4IR3A 5CUAA 5BT3A 4MR6A 5L99A 3UW9A 5E9MA 4YBTA 3U5OA 5FDZA 4CUPA 3O33A 5DYUA 4YYNA 3MXFA 5IG6A 5DKCA 3UVDA 5F1LA 2RNXA 3HMHA 4A9FA 5F2PA 5IBNA 4TTEA 2YQDA 4A9OA 3MQMA 2KTBB 4O77A 1X0JA 5EWHA 4QEWA 4ALHA 4YH3A 4A9IA 3P1FA 5F36A 4YYDA 3SVFA 5L96A 2R10A 5A5SA 5DFBA 5ENJA 2DVRA 4NQMA 4YYMA 4Q0NA 4LDFA 2OUOA 4IR4A 5D3JA 5H1TA 4QSVA 5F25A 5G4RA 5HRVA 5I86A 4PKLA 4YATA 5CQ4A 2DVQA 2DWWA 2YELA 4XUAA 5CQ7A 4J1PA 4QYLA 4NS5A 5EPSA 1F68A 4TT2A 5AD3A 2R0YA 5E9VA 4CUTA 5F63A 5D3NA 3IU5A 5DX4A 3NXBA 4RVRA 4BW3A 2RNYA 5II1A 5D3HA 3P5OA 5DY7A 5HENA 4C67A 4NYWA 4PY6A 4QBMA 1ZS5A 5EVAA 4HBXA 5HFRA 2L84A 5FFYA 4CFKA 2F6JA 4UYFB 3FKMX 5A81A 5A7CA 5I40A 5C89A 3GG3A 4O78A 5DYXA 5C7NA 5I89A 1WUGA 5E73A 4QC3A 5HQ5A 3SVHA 5K29A 4XY8A 3MULA 4OUFA 5E7DA 4CL9A 5BT4A 5CUCA 4IOQA 3UVWA 5AD2A 5CQ3A 4NYVA 1E6IA 5CU8A 5EM3A 4WIVA 5CQTA 4YAXA 4UIYA 4NUCA 5KHMA 4J0RA 5E9KA 5TB6A 5I7YA 4OGIA 3SVGA 5LKZA 5HELA 5LVRA 5EWDA 5ENHA 4LRGA 5DYAA 4YK0A 3MB3A 4ZC9A 5EA1A 5CRZA 4NR5A 5ENBA 2GRCA 3P1DA 4O75A 5I88A 4NQNA 4MEPA 2E7NA 4FLPA 5LKUA 4IR6A 4QSTA 2RO1A 5LKTA 5ENCA 4X2IA 5LUUA 4N4HA 5D26A 4A9HA 3LJWA 4O7CA 4A9NA 3AQAA 4KV1A 5EWCA 5DW2A 4A9JA 5FG5A 5LJ1A 5HQ6A 5CRMA 5FE2A 4NYXA 5CUDA 5HQ7A 4TS8A 5FB0A 4YH4A 4YYJA 4TZ2A 4YBSA 5FE9A 3O35A 3JVLA 4HXLA 5CY9A 4QSUA 3MB4A 5EWVA 4QB3A 4QEVA 2N9GA 4QR4A 5EPRA 5DKDA 4UYHA 5ENEA 4XUBA 4PTBA 4Z6HA 5HM0A 5BT5A 4HBWA 5FFVA 5D24A 5ENFA 3UV5A 2YEKA 5CQ5A 3UVYA 4BW2A 4Z93A 5IGKA 4Q0OA 4UIUA 4BJXA 3G0JA 5I83A 5LJ0A 5CQAA 3U5JA 4HXRA 4WHWA 5LJ2A 4YYHA 5ACYA 4HBVA 5EP7A 4O71A 4QC1A 2F6NA 2DVSA 2L5EA 4GPJA 2DVVA 4BW4A 4CURA 3LQIA 4UYGA 5D3TA 3JVKA 5FE3A 5ETBA 4QEUA 4AKNA 4XY9A 3QZTA 5DFCA 3QZSA 3I3JA 5CPEA 3U5LA 4TU4A 4LYWA 4TT4A 4TZ8A 5D0CA 4HXKA 5F1HA 5CGPA 5DBMA 5AMEA 4QSQA 2L85A 4UYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UYE A;  5DLZ A;  3JVM A;  4DON A;  4O70 A;  5FE6 A;  2YDW A;  4YAD A;  5FH8 A;  4LZR A;  5E9L A;  5JI8 A;  4ALG A;  2DKW A;  5CTL A;  5IGN A;  4PS5 A;  5C85 A;  5FE8 A;  5CS8 A;  4BW1 A;  4E96 A;  3D7C A;  3P1C A;  3O34 A;  4QR5 A;  5I80 A;  5DKH A;  4NR9 A;  5EIC A;  5FH7 A;  4HXN A;  5FE1 A;  4QSX A;  4YC9 A;  5CUG A;  5FH6 A;  5FE4 A;  5EIS A;  4QSP A;  4O76 A;  3QZV A;  5E9Y A;  2FSA A;  5A5P A;  3O37 A;  5TCM A;  4NR6 A;  5E0R A;  5HEM A;  5E3G A;  4N4I A;  3RCW A;  2D82 A;  4A9K A;  5COI A;  5LKX A;  4HBY A;  5F3A A;  1WUM A;  5D3L A;  3U5N A;  4HXS A;  4HXP A;  3G0L A;  4TT6 A;  4MEN A;  4YYG A;  5A82 A;  2R0V A;  3LXJ A;  5II2 A;  5HLS A;  5FE5 A;  5F5Z A;  5C4Q A;  4A9E A;  4MR5 A;  3DAI A;  5DFD A;  5IID A;  4YY6 A;  3TLP A;  5D3P A;  4XYA A;  4YBM A;  4YYK A;  3P1E A;  3Q2E A;  4IOR A;  5EK9 A;  5HRX A;  5IGL A;  5L98 A;  4NUE A;  5F62 A;  4QY4 A;  2OSS A;  4UIX A;  3UV2 A;  4A9L A;  5EV9 A;  5FFW A;  4LR6 A;  5D25 A;  5E74 A;  5KTU A;  4CUS A;  4F3I A;  5HCL A;  4N3W A;  5FG6 A;  4IR5 A;  5E3D A;  4UIW A;  4ZW1 A;  4KV4 A;  4O74 A;  4UYF A;  5L8U A;  4QZS A;  2WP2 A;  4J3I A;  5ETD A;  3ZYU A;  5KTX A;  4MEQ A;  4IOO A;  3U5P A;  4TYL A;  5EWW A;  2RNW A;  2YW5 A;  5HFQ A;  4LC2 A;  4A9M A;  5CUB A;  5D3R A;  5CFW A;  2YEM A;  5CQ6 A;  4UIT A;  5EI4 A;  5A5Q A;  2D9E A;  5FE7 A;  4NR8 A;  4LYI A;  5A83 A;  4N4G A;  3O36 A;  4LYS A;  4O7B A;  5IGM A;  4N4F A;  4CUU A;  4QSW A;  3IU6 A;  3ONI A;  4CLB A;  4QNS A;  4J0S A;  4YYI A;  5KU3 A;  3MUK A;  5D3S A;  4PCE A;  4Z1S A;  4QUT A;  5JWM A;  4O7E A;  2OO1 A;  4TU6 A;  5FE0 A;  5I29 A;  5ENI A;  1JSP B;  5I1Q A;  2RI7 A;  4WHU A;  5G4S A;  2NXB A;  4OGJ A;  5KTW A;  5D7X A;  4NR7 A;  5F60 A;  3LQJ A;  4QSR A;  4UIZ A;  3LQH A;  4HXM A;  3HME A;  1N72 A;  3U5M A;  3S91 A;  5L97 A;  5H1U A;  5KO4 A;  5C8G A;  2WP1 A;  4ZQL A;  3U5K A;  3UVX A;  5CQ8 A;  4YAB A;  5HRW A;  5DLX A;  5H85 A;  5AMF A;  4QYD A;  5H1V A;  2H60 A;  4O72 A;  4MR4 A;  4NR4 A;  1JM4 B;  4UIV A;  5L8T A;  4CFL A;  3K2J A;  4O7F A;  5FB1 A;  4TQN A;  5LVQ A;  3DWY A;  5J0D A;  5I7X A;  2E3K A;  2DAT A;  1EQF A;  5C87 A;  4PCI A;  5E9I A;  3S92 A;  2G4A A;  4MR3 A;  4NRB A;  5A5N A;  4NRA A;  2E7O A;  2RS9 B;  4LZS A;  5F61 A;  2I8N A;  4O7A A;  3Q2F A;  5EU1 A;  5A85 A;  5CUE A;  2YYN A;  5CZG A;  4Z1Q A;  4NRC A;  4HXO A;  2R0S A;  4QR3 A;  4NUD A;  3AAD A;  4YY4 A;  4C66 A;  2RFJ A;  4Y03 A;  5EGU A;  4QUU A;  5DYC A;  5EPB A;  4CUQ A;  5ENG A;  2MJV B;  5A5R A;  4Z6I A;  4QSS A;  2I7K A;  5CP5 A;  5FG4 A;  4MEO A;  4KCX A;  5EQ1 A;  5DW1 A;  3HMF A;  5HJC A;  4NXJ A;  4LZ2 A;  3JVJ A;  5FBX A;  3UV4 A;  4BHW A;  5A5O A;  2LSP B;  4IR3 A;  5CUA A;  5BT3 A;  4MR6 A;  5L99 A;  3UW9 A;  5E9M A;  4YBT A;  3U5O A;  5FDZ A;  4CUP A;  3O33 A;  5DYU A;  4YYN A;  3MXF A;  5IG6 A;  5DKC A;  3UVD A;  5F1L A;  2RNX A;  3HMH A;  4A9F A;  5F2P A;  5IBN A;  4TTE A;  2YQD A;  4A9O A;  3MQM A;  2KTB B;  4O77 A;  1X0J A;  5EWH A;  4QEW A;  4ALH A;  4YH3 A;  4A9I A;  3P1F A;  5F36 A;  4YYD A;  3SVF A;  5L96 A;  2R10 A;  5A5S A;  5DFB A;  5ENJ A;  2DVR A;  4NQM A;  4YYM A;  4Q0N A;  4LDF A;  2OUO A;  4IR4 A;  5D3J A;  5H1T A;  4QSV A;  5F25 A;  5G4R A;  5HRV A;  5I86 A;  4PKL A;  4YAT A;  5CQ4 A;  2DVQ A;  2DWW A;  2YEL A;  4XUA A;  5CQ7 A;  4J1P A;  4QYL A;  4NS5 A;  5EPS A;  1F68 A;  4TT2 A;  5AD3 A;  2R0Y A;  5E9V A;  4CUT A;  5F63 A;  5D3N A;  3IU5 A;  5DX4 A;  3NXB A;  4RVR A;  4BW3 A;  2RNY A;  5II1 A;  5D3H A;  3P5O A;  5DY7 A;  5HEN A;  4C67 A;  4NYW A;  4PY6 A;  4QBM A;  1ZS5 A;  5EVA A;  4HBX A;  5HFR A;  2L84 A;  5FFY A;  4CFK A;  2F6J A;  4UYF B;  3FKM X;  5A81 A;  5A7C A;  5I40 A;  5C89 A;  3GG3 A;  4O78 A;  5DYX A;  5C7N A;  5I89 A;  1WUG A;  5E73 A;  4QC3 A;  5HQ5 A;  3SVH A;  5K29 A;  4XY8 A;  3MUL A;  4OUF A;  5E7D A;  4CL9 A;  5BT4 A;  5CUC A;  4IOQ A;  3UVW A;  5AD2 A;  5CQ3 A;  4NYV A;  1E6I A;  5CU8 A;  5EM3 A;  4WIV A;  5CQT A;  4YAX A;  4UIY A;  4NUC A;  5KHM A;  4J0R A;  5E9K A;  5TB6 A;  5I7Y A;  4OGI A;  3SVG A;  5LKZ A;  5HEL A;  5LVR A;  5EWD A;  5ENH A;  4LRG A;  5DYA A;  4YK0 A;  3MB3 A;  4ZC9 A;  5EA1 A;  5CRZ A;  4NR5 A;  5ENB A;  2GRC A;  3P1D A;  4O75 A;  5I88 A;  4NQN A;  4MEP A;  2E7N A;  4FLP A;  5LKU A;  4IR6 A;  4QST A;  2RO1 A;  5LKT A;  5ENC A;  4X2I A;  5LUU A;  4N4H A;  5D26 A;  4A9H A;  3LJW A;  4O7C A;  4A9N A;  3AQA A;  4KV1 A;  5EWC A;  5DW2 A;  4A9J A;  5FG5 A;  5LJ1 A;  5HQ6 A;  5CRM A;  5FE2 A;  4NYX A;  5CUD A;  5HQ7 A;  4TS8 A;  5FB0 A;  4YH4 A;  4YYJ A;  4TZ2 A;  4YBS A;  5FE9 A;  3O35 A;  3JVL A;  4HXL A;  5CY9 A;  4QSU A;  3MB4 A;  5EWV A;  4QB3 A;  4QEV A;  2N9G A;  4QR4 A;  5EPR A;  5DKD A;  4UYH A;  5ENE A;  4XUB A;  4PTB A;  4Z6H A;  5HM0 A;  5BT5 A;  4HBW A;  5FFV A;  5D24 A;  5ENF A;  3UV5 A;  2YEK A;  5CQ5 A;  3UVY A;  4BW2 A;  4Z93 A;  5IGK A;  4Q0O A;  4UIU A;  4BJX A;  3G0J A;  5I83 A;  5LJ0 A;  5CQA A;  3U5J A;  4HXR A;  4WHW A;  5LJ2 A;  4YYH A;  5ACY A;  4HBV A;  5EP7 A;  4O71 A;  4QC1 A;  2F6N A;  2DVS A;  2L5E A;  4GPJ A;  2DVV A;  4BW4 A;  4CUR A;  3LQI A;  4UYG A;  5D3T A;  3JVK A;  5FE3 A;  5ETB A;  4QEU A;  4AKN A;  4XY9 A;  3QZT A;  5DFC A;  3QZS A;  3I3J A;  5CPE A;  3U5L A;  4TU4 A;  4LYW A;  4TT4 A;  4TZ8 A;  5D0C A;  4HXK A;  5F1H A;  5CGP A;  5DBM A;  5AME A;  4QSQ A;  2L85 A;  4UYD A; 
#chains in the Genus database with same CATH topology
 4UYE A;  5DLZ A;  3JVM A;  4DON A;  4O70 A;  5FE6 A;  2YDW A;  4YAD A;  5FH8 A;  4LZR A;  5E9L A;  5JI8 A;  4ALG A;  2DKW A;  5CTL A;  5IGN A;  4PS5 A;  5C85 A;  5FE8 A;  5CS8 A;  4BW1 A;  4E96 A;  3D7C A;  3P1C A;  3O34 A;  4QR5 A;  5I80 A;  5DKH A;  4NR9 A;  5EIC A;  5FH7 A;  4HXN A;  5FE1 A;  4QSX A;  4YC9 A;  5CUG A;  5FH6 A;  5FE4 A;  5EIS A;  4QSP A;  4O76 A;  3QZV A;  5E9Y A;  2FSA A;  5A5P A;  3O37 A;  5TCM A;  4NR6 A;  5E0R A;  5HEM A;  5E3G A;  4N4I A;  3RCW A;  2D82 A;  4A9K A;  5COI A;  5LKX A;  2EJN A;  4HBY A;  5F3A A;  1WUM A;  5D3L A;  3U5N A;  4HXS A;  4HXP A;  3G0L A;  4TT6 A;  4MEN A;  4YYG A;  5A82 A;  2R0V A;  3LXJ A;  5II2 A;  5HLS A;  5FE5 A;  5F5Z A;  5C4Q A;  4A9E A;  4MR5 A;  3DAI A;  5DFD A;  5IID A;  4YY6 A;  3TLP A;  5D3P A;  4XYA A;  4YBM A;  4YYK A;  3P1E A;  3Q2E A;  4IOR A;  5EK9 A;  5HRX A;  5IGL A;  5L98 A;  4NUE A;  5F62 A;  4QY4 A;  2OSS A;  4UIX A;  3UV2 A;  4A9L A;  5EV9 A;  5FFW A;  4LR6 A;  5D25 A;  5E74 A;  5KTU A;  4CUS A;  4F3I A;  5HCL A;  4N3W A;  5FG6 A;  4IR5 A;  5E3D A;  4UIW A;  4ZW1 A;  4KV4 A;  4O74 A;  4UYF A;  5L8U A;  4QZS A;  2WP2 A;  4J3I A;  5ETD A;  3ZYU A;  5KTX A;  4MEQ A;  4IOO A;  3U5P A;  4TYL A;  5EWW A;  2RNW A;  2YW5 A;  5HFQ A;  4LC2 A;  4A9M A;  5CUB A;  5D3R A;  5CFW A;  2YEM A;  5CQ6 A;  4UIT A;  5EI4 A;  5A5Q A;  2D9E A;  5FE7 A;  4NR8 A;  4LYI A;  5A83 A;  4N4G A;  3O36 A;  4LYS A;  4O7B A;  5IGM A;  4N4F A;  4CUU A;  4QSW A;  3IU6 A;  3ONI A;  4CLB A;  4QNS A;  4J0S A;  4YYI A;  5KU3 A;  3MUK A;  5D3S A;  4PCE A;  4Z1S A;  4QUT A;  5JWM A;  4O7E A;  2OO1 A;  4TU6 A;  5FE0 A;  5I29 A;  5ENI A;  1JSP B;  5I1Q A;  2RI7 A;  4WHU A;  5G4S A;  2NXB A;  4OGJ A;  5KTW A;  5D7X A;  4NR7 A;  5F60 A;  3LQJ A;  4QSR A;  4UIZ A;  3LQH A;  4HXM A;  3HME A;  1N72 A;  3U5M A;  3S91 A;  5L97 A;  5H1U A;  5KO4 A;  5C8G A;  2WP1 A;  4ZQL A;  3U5K A;  3UVX A;  5CQ8 A;  4YAB A;  5HRW A;  5DLX A;  5H85 A;  5AMF A;  4QYD A;  5H1V A;  2H60 A;  4O72 A;  4MR4 A;  4NR4 A;  1JM4 B;  4UIV A;  5L8T A;  4CFL A;  3K2J A;  4O7F A;  5FB1 A;  4TQN A;  5LVQ A;  3DWY A;  5J0D A;  5I7X A;  2E3K A;  2DAT A;  1EQF A;  5C87 A;  4PCI A;  5E9I A;  3S92 A;  2G4A A;  4MR3 A;  4NRB A;  5A5N A;  4NRA A;  2E7O A;  2RS9 B;  4LZS A;  5F61 A;  2I8N A;  4O7A A;  3Q2F A;  5EU1 A;  5A85 A;  5CUE A;  2YYN A;  3ERR A;  5CZG A;  4Z1Q A;  4NRC A;  4HXO A;  2R0S A;  4QR3 A;  4NUD A;  3AAD A;  4YY4 A;  4C66 A;  2RFJ A;  4Y03 A;  5EGU A;  4QUU A;  5DYC A;  5EPB A;  4CUQ A;  5ENG A;  3VKG A;  2MJV B;  5A5R A;  4Z6I A;  4QSS A;  2I7K A;  5CP5 A;  5FG4 A;  4MEO A;  4KCX A;  5EQ1 A;  5DW1 A;  3HMF A;  5HJC A;  4NXJ A;  4AKI A;  4LZ2 A;  3JVJ A;  5FBX A;  3UV4 A;  4BHW A;  5A5O A;  2LSP B;  4IR3 A;  5CUA A;  5BT3 A;  4MR6 A;  5L99 A;  3UW9 A;  5E9M A;  4YBT A;  3U5O A;  5FDZ A;  4CUP A;  3D1B A;  3O33 A;  5DYU A;  4YYN A;  3MXF A;  5IG6 A;  5DKC A;  3UVD A;  5F1L A;  2RNX A;  3HMH A;  4A9F A;  5F2P A;  5IBN A;  4TTE A;  2YQD A;  4A9O A;  3MQM A;  2KTB B;  4O77 A;  1X0J A;  5EWH A;  4QEW A;  4ALH A;  4YH3 A;  4A9I A;  3P1F A;  5F36 A;  4YYD A;  3SVF A;  5L96 A;  2R10 A;  5A5S A;  5DFB A;  5ENJ A;  2DVR A;  4NQM A;  4YYM A;  4Q0N A;  4LDF A;  2OUO A;  4IR4 A;  5D3J A;  5H1T A;  4QSV A;  5F25 A;  5G4R A;  5HRV A;  5I86 A;  4AKH A;  4PKL A;  4YAT A;  5CQ4 A;  2DVQ A;  2DWW A;  5CQ7 A;  2YEL A;  1ZKR A;  4XUA A;  4J1P A;  4QYL A;  4NS5 A;  5EPS A;  1F68 A;  4TT2 A;  5AD3 A;  2R0Y A;  5E9V A;  4CUT A;  5F63 A;  5D3N A;  3IU5 A;  5DX4 A;  3NXB A;  4RVR A;  4BW3 A;  2RNY A;  5II1 A;  5D3H A;  3P5O A;  5DY7 A;  5HEN A;  4C67 A;  4NYW A;  4PY6 A;  4QBM A;  1ZS5 A;  5EVA A;  4HBX A;  5HFR A;  2L84 A;  5FFY A;  4CFK A;  2F6J A;  4UYF B;  3FKM X;  5A81 A;  5A7C A;  5I40 A;  5C89 A;  3GG3 A;  4O78 A;  5DYX A;  5C7N A;  5I89 A;  1WUG A;  5E73 A;  4QC3 A;  5HQ5 A;  3SVH A;  5K29 A;  4XY8 A;  3MUL A;  4OUF A;  5E7D A;  4CL9 A;  5BT4 A;  5CUC A;  4IOQ A;  3UVW A;  5AD2 A;  5CQ3 A;  4NYV A;  1E6I A;  5CU8 A;  5EM3 A;  4WIV A;  4AI6 A;  5CQT A;  4YAX A;  4UIY A;  4NUC A;  5KHM A;  4J0R A;  5E9K A;  5TB6 A;  5I7Y A;  4OGI A;  3SVG A;  5LKZ A;  5HEL A;  5LVR A;  5EWD A;  3VKH A;  5ENH A;  4LRG A;  5DYA A;  4YK0 A;  3MB3 A;  4ZC9 A;  5EA1 A;  5CRZ A;  4NR5 A;  5ENB A;  2GRC A;  3P1D A;  4O75 A;  5I88 A;  4NQN A;  4MEP A;  2E7N A;  4FLP A;  5LKU A;  4IR6 A;  4QST A;  2RO1 A;  5LKT A;  5ENC A;  4X2I A;  5LUU A;  4N4H A;  5D26 A;  4A9H A;  3LJW A;  4O7C A;  4A9N A;  3AQA A;  4KV1 A;  4AKG A;  5EWC A;  5DW2 A;  4A9J A;  5FG5 A;  5LJ1 A;  5HQ6 A;  5CRM A;  5FE2 A;  4NYX A;  5CUD A;  5HQ7 A;  4TS8 A;  5FB0 A;  4YH4 A;  4YYJ A;  4TZ2 A;  4YBS A;  5FE9 A;  3O35 A;  3JVL A;  4HXL A;  5CY9 A;  4QSU A;  3MB4 A;  5EWV A;  4QB3 A;  4QEV A;  1PUO A;  2N9G A;  4QR4 A;  5EPR A;  5DKD A;  4UYH A;  5ENE A;  4XUB A;  4PTB A;  4Z6H A;  5HM0 A;  5BT5 A;  4HBW A;  5FFV A;  5D24 A;  5ENF A;  3UV5 A;  2YEK A;  5CQ5 A;  3UVY A;  4BW2 A;  4Z93 A;  5IGK A;  4Q0O A;  4UIU A;  4BJX A;  3G0J A;  5I83 A;  5LJ0 A;  5CQA A;  3U5J A;  4HXR A;  4WHW A;  5LJ2 A;  4YYH A;  5ACY A;  4HBV A;  5EP7 A;  4O71 A;  4QC1 A;  2F6N A;  2DVS A;  2L5E A;  4GPJ A;  2DVV A;  4BW4 A;  4CUR A;  3LQI A;  4UYG A;  5D3T A;  3JVK A;  5FE3 A;  5ETB A;  4QEU A;  4AKN A;  4XY9 A;  3QZT A;  5DFC A;  3QZS A;  3I3J A;  5CPE A;  3D1D A;  4TU4 A;  4LYW A;  3U5L A;  4TT4 A;  4TZ8 A;  5D0C A;  4HXK A;  5F1H A;  5CGP A;  5DBM A;  5AME A;  4QSQ A;  2L85 A;  4UYD A; 
#chains in the Genus database with same CATH homology
 4UYE A;  5DLZ A;  3JVM A;  4DON A;  4O70 A;  5FE6 A;  2YDW A;  4YAD A;  5FH8 A;  4LZR A;  5E9L A;  5JI8 A;  4ALG A;  2DKW A;  5CTL A;  5IGN A;  4PS5 A;  5C85 A;  5FE8 A;  5CS8 A;  4BW1 A;  4E96 A;  3D7C A;  3P1C A;  3O34 A;  4QR5 A;  5I80 A;  5DKH A;  4NR9 A;  5EIC A;  5FH7 A;  4HXN A;  5FE1 A;  4QSX A;  4YC9 A;  5CUG A;  5FH6 A;  5FE4 A;  5EIS A;  4QSP A;  4O76 A;  3QZV A;  5E9Y A;  2FSA A;  5A5P A;  3O37 A;  5TCM A;  4NR6 A;  5E0R A;  5HEM A;  5E3G A;  4N4I A;  3RCW A;  2D82 A;  4A9K A;  5COI A;  5LKX A;  4HBY A;  5F3A A;  1WUM A;  5D3L A;  3U5N A;  4HXS A;  4HXP A;  3G0L A;  4TT6 A;  4MEN A;  4YYG A;  5A82 A;  2R0V A;  3LXJ A;  5II2 A;  5HLS A;  5FE5 A;  5F5Z A;  5C4Q A;  4A9E A;  4MR5 A;  3DAI A;  5DFD A;  5IID A;  4YY6 A;  3TLP A;  5D3P A;  4XYA A;  4YBM A;  4YYK A;  3P1E A;  3Q2E A;  4IOR A;  5EK9 A;  5HRX A;  5IGL A;  5L98 A;  4NUE A;  5F62 A;  4QY4 A;  2OSS A;  4UIX A;  3UV2 A;  4A9L A;  5EV9 A;  5FFW A;  4LR6 A;  5D25 A;  5E74 A;  5KTU A;  4CUS A;  4F3I A;  5HCL A;  4N3W A;  5FG6 A;  4IR5 A;  5E3D A;  4UIW A;  4ZW1 A;  4KV4 A;  4O74 A;  4UYF A;  5L8U A;  4QZS A;  2WP2 A;  4J3I A;  5ETD A;  3ZYU A;  5KTX A;  4MEQ A;  4IOO A;  3U5P A;  4TYL A;  5EWW A;  2RNW A;  2YW5 A;  5HFQ A;  4LC2 A;  4A9M A;  5CUB A;  5D3R A;  5CFW A;  2YEM A;  5CQ6 A;  4UIT A;  5EI4 A;  5A5Q A;  2D9E A;  5FE7 A;  4NR8 A;  4LYI A;  5A83 A;  4N4G A;  3O36 A;  4LYS A;  4O7B A;  5IGM A;  4N4F A;  4CUU A;  4QSW A;  3IU6 A;  3ONI A;  4CLB A;  4QNS A;  4J0S A;  4YYI A;  5KU3 A;  3MUK A;  5D3S A;  4PCE A;  4Z1S A;  4QUT A;  5JWM A;  4O7E A;  2OO1 A;  4TU6 A;  5FE0 A;  5I29 A;  5ENI A;  1JSP B;  5I1Q A;  2RI7 A;  4WHU A;  5G4S A;  2NXB A;  4OGJ A;  5KTW A;  5D7X A;  4NR7 A;  5F60 A;  3LQJ A;  4QSR A;  4UIZ A;  3LQH A;  4HXM A;  3HME A;  1N72 A;  3U5M A;  3S91 A;  5L97 A;  5H1U A;  5KO4 A;  5C8G A;  2WP1 A;  4ZQL A;  3U5K A;  3UVX A;  5CQ8 A;  4YAB A;  5HRW A;  5DLX A;  5H85 A;  5AMF A;  4QYD A;  5H1V A;  2H60 A;  4O72 A;  4MR4 A;  4NR4 A;  1JM4 B;  4UIV A;  5L8T A;  4CFL A;  3K2J A;  4O7F A;  5FB1 A;  4TQN A;  5LVQ A;  3DWY A;  5J0D A;  5I7X A;  2E3K A;  2DAT A;  1EQF A;  5C87 A;  4PCI A;  5E9I A;  3S92 A;  2G4A A;  4MR3 A;  4NRB A;  5A5N A;  4NRA A;  2E7O A;  2RS9 B;  4LZS A;  5F61 A;  2I8N A;  4O7A A;  3Q2F A;  5EU1 A;  5A85 A;  5CUE A;  2YYN A;  5CZG A;  4Z1Q A;  4NRC A;  4HXO A;  2R0S A;  4QR3 A;  4NUD A;  3AAD A;  4YY4 A;  4C66 A;  2RFJ A;  4Y03 A;  5EGU A;  4QUU A;  5DYC A;  5EPB A;  4CUQ A;  5ENG A;  2MJV B;  5A5R A;  4Z6I A;  4QSS A;  2I7K A;  5CP5 A;  5FG4 A;  4MEO A;  4KCX A;  5EQ1 A;  5DW1 A;  3HMF A;  5HJC A;  4NXJ A;  4LZ2 A;  3JVJ A;  5FBX A;  3UV4 A;  4BHW A;  5A5O A;  2LSP B;  4IR3 A;  5CUA A;  5BT3 A;  4MR6 A;  5L99 A;  3UW9 A;  5E9M A;  4YBT A;  3U5O A;  5FDZ A;  4CUP A;  3O33 A;  5DYU A;  4YYN A;  3MXF A;  5IG6 A;  5DKC A;  3UVD A;  5F1L A;  2RNX A;  3HMH A;  4A9F A;  5F2P A;  5IBN A;  4TTE A;  2YQD A;  4A9O A;  3MQM A;  2KTB B;  4O77 A;  1X0J A;  5EWH A;  4QEW A;  4ALH A;  4YH3 A;  4A9I A;  3P1F A;  5F36 A;  4YYD A;  3SVF A;  5L96 A;  2R10 A;  5A5S A;  5DFB A;  5ENJ A;  2DVR A;  4NQM A;  4YYM A;  4Q0N A;  4LDF A;  2OUO A;  4IR4 A;  5D3J A;  5H1T A;  4QSV A;  5F25 A;  5G4R A;  5HRV A;  5I86 A;  4PKL A;  4YAT A;  5CQ4 A;  2DVQ A;  2DWW A;  2YEL A;  4XUA A;  5CQ7 A;  4J1P A;  4QYL A;  4NS5 A;  5EPS A;  1F68 A;  4TT2 A;  5AD3 A;  2R0Y A;  5E9V A;  4CUT A;  5F63 A;  5D3N A;  3IU5 A;  5DX4 A;  3NXB A;  4RVR A;  4BW3 A;  2RNY A;  5II1 A;  5D3H A;  3P5O A;  5DY7 A;  5HEN A;  4C67 A;  4NYW A;  4PY6 A;  4QBM A;  1ZS5 A;  5EVA A;  4HBX A;  5HFR A;  2L84 A;  5FFY A;  4CFK A;  2F6J A;  4UYF B;  3FKM X;  5A81 A;  5A7C A;  5I40 A;  5C89 A;  3GG3 A;  4O78 A;  5DYX A;  5C7N A;  5I89 A;  1WUG A;  5E73 A;  4QC3 A;  5HQ5 A;  3SVH A;  5K29 A;  4XY8 A;  3MUL A;  4OUF A;  5E7D A;  4CL9 A;  5BT4 A;  5CUC A;  4IOQ A;  3UVW A;  5AD2 A;  5CQ3 A;  4NYV A;  1E6I A;  5CU8 A;  5EM3 A;  4WIV A;  5CQT A;  4YAX A;  4UIY A;  4NUC A;  5KHM A;  4J0R A;  5E9K A;  5TB6 A;  5I7Y A;  4OGI A;  3SVG A;  5LKZ A;  5HEL A;  5LVR A;  5EWD A;  5ENH A;  4LRG A;  5DYA A;  4YK0 A;  3MB3 A;  4ZC9 A;  5EA1 A;  5CRZ A;  4NR5 A;  5ENB A;  2GRC A;  3P1D A;  4O75 A;  5I88 A;  4NQN A;  4MEP A;  2E7N A;  4FLP A;  5LKU A;  4IR6 A;  4QST A;  2RO1 A;  5LKT A;  5ENC A;  4X2I A;  5LUU A;  4N4H A;  5D26 A;  4A9H A;  3LJW A;  4O7C A;  4A9N A;  3AQA A;  4KV1 A;  5EWC A;  5DW2 A;  4A9J A;  5FG5 A;  5LJ1 A;  5HQ6 A;  5CRM A;  5FE2 A;  4NYX A;  5CUD A;  5HQ7 A;  4TS8 A;  5FB0 A;  4YH4 A;  4YYJ A;  4TZ2 A;  4YBS A;  5FE9 A;  3O35 A;  3JVL A;  4HXL A;  5CY9 A;  4QSU A;  3MB4 A;  5EWV A;  4QB3 A;  4QEV A;  2N9G A;  4QR4 A;  5EPR A;  5DKD A;  4UYH A;  5ENE A;  4XUB A;  4PTB A;  4Z6H A;  5HM0 A;  5BT5 A;  4HBW A;  5FFV A;  5D24 A;  5ENF A;  3UV5 A;  2YEK A;  5CQ5 A;  3UVY A;  4BW2 A;  4Z93 A;  5IGK A;  4Q0O A;  4UIU A;  4BJX A;  3G0J A;  5I83 A;  5LJ0 A;  5CQA A;  3U5J A;  4HXR A;  4WHW A;  5LJ2 A;  4YYH A;  5ACY A;  4HBV A;  5EP7 A;  4O71 A;  4QC1 A;  2F6N A;  2DVS A;  2L5E A;  4GPJ A;  2DVV A;  4BW4 A;  4CUR A;  3LQI A;  4UYG A;  5D3T A;  3JVK A;  5FE3 A;  5ETB A;  4QEU A;  4AKN A;  4XY9 A;  3QZT A;  5DFC A;  3QZS A;  3I3J A;  5CPE A;  3U5L A;  4TU4 A;  4LYW A;  4TT4 A;  4TZ8 A;  5D0C A;  4HXK A;  5F1H A;  5CGP A;  5DBM A;  5AME A;  4QSQ A;  2L85 A;  4UYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...