4N4HA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.1k36me3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
188
Chain Sequence
QEMGTYLRFIVSRMKERAIDLVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Zinc finger MYND domain-containing protein 11
total genus 66
structure length 188
sequence length 209
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4hA02
4A9OA 3OYJA 5D3LA 5CPEA 4EDUA 2O4XA 5ENEA 4BW1A 3OYDA 5AD3A 5HFRA 5D26A 3JVLA 4YK0A 4YC9A 2CKKA 5I86A 3UVXA 4QNSA 5LJ2A 5CU8A 4ZC9A 5I89A 4YBTA 2RHZA 5F1LA 2DWWA 5CQAA 5I29A 2DVRA 2D82A 4O7CA 4NXJA 2DKWA 5CTLA 3MB4A 4Z93A 5I1QA 3LJWA 3P1DA 5EWHA 5EWCA 4O70A 2GFAA 3MEVA 4XY9A 4MR5A 4YYNA 3LLRA 3P8HA 4X34A 5II1A 1N72A 4C66A 4PCEA 4QUUA 3O35A 2RHUA 4MR4A 5FG5A 5DYCA 4NYXA 5M9OA 2LRQA 5CUAA 3M9QA 3OS1A 3DAIA 4O72A 3P1CA 5DYAA 3CEYA 5DY7A 5E9VA 5KTUA 5FE0A 4DONA 4J0RA 2LTOA 3S6WA 3MO8A 4J0SA 2DATA 4TT6A 4WIVA 3MULA 4HCZA 4NYWA 5CS8A 3U5NA 5ENJA 4TZ8A 4YYIA 5HQ6A 5KTWA 2H60A 4HXLA 3MEWA 4GY5A 3G0JA 4BDYA 3UVWA 3LGLA 4ZW1A 5EA1A 4Q5WA 3BDLA 3FDRA 5CQ3A 4QSQA 4LRGA 2JZ2A 2RHXA 2OSSA 4QYLA 3OY9A 3NTHA 3E9FA 5D3SA 4N3WA 4A9LA 5A5SA 5C0MA 3OMCA 3MP1A 5I83A 1WUGA 4IKFA 4MEOA 4HXRA 4B9XA 4XUBA 5DKHA 3EAEA 4QSTA 3MEUA 1F68A 3FKMX 3UV4A 2R58A 4BACA 5LJ1A 2KTBB 5CUBA 5ENCA 5FE1A 4E7LA 4N4FA 5CUEA 4HXPA 4UYGA 5KCOA 4C5IA 4YYGA 2RJCA 5I88A 3QKJA 2MWPA 4KCXA 2EQKA 5L96A 2M16A 2RJDA 1G5VA 3OYLA 5EWVA 4LDFA 4L59A 5FFYA 4QW2A 4YH4A 5KHMA 5CUCA 3O37A 5KE3A 5I80A 2EKOA 5LVQA 5DW1A 5D6WA 5D3RA 3O36A 4UYFA 2O4XB 5D6XA 3ME9A 1EQFA 4UIXA 2RJEA 2E3KA 5L8UA 5LVRA 1OI1A 4QR3A 3Q2EA 4UITA 4LYIA 4UYEA 5FG4A 5FG6A 5F36A 5H1TA 4MEQA 5DKDA 5AMEA 4O71A 5DYXA 4Q0NA 5ENIA 5ACYA 5FBXA 2DVVA 5J39A 5C89A 4NQNA 4BHWA 3UT1A 4IUVA 4N4IA 1N27A 2RO1A 3IU6A 4NRAA 2DAQA 4Y03A 2K3XA 4B9WA 4TU4A 4FL6A 3D7CA 2RI2A 5D0CA 2L5EA 4UIYA 4HXMA 4XY8A 4N4GA 5ENBA 4A9KA 5EQ1A 3OB9A 3LYIA 5BT4A 5C4QA 5IBNA 5C87A 5FE6A 3H8ZA 3P1EA 5FFVA 3DB4A 4A9MA 2R0YA 4A4HA 3UW9A 4OVAA 3OYEA 4LZRA 3OYIA 4IUQA 4II1A 4BD3A 5A82A 5AMFA 2GF7A 3U5OA 4YBSA 4MR3A 5E74A 5DFBA 3SD4A 3MQMA 3JVJA 4HXNA 5EK9A 2R5AA 5G4RA 3U5KA 3H6ZA 5EPSA 2D9TA 4RG2A 2F6NA 4O7FA 5FRMA 4Q0OA 4NR7A 4QQ6A 5D3JA 3SVFA 5FE8A 4LZSA 4IR3A 4YH3A 4BW2A 5IGLA 5F63A 2E7OA 2YW5A 3O33A 4IUPA 3HMFA 2LCCA 4RVRA 2RI3A 4A4GA 2K3YA 4NRCA 5FRNA 2FHDA 5HM0A 4YYMA 3HMEA 1OZ2A 2X4WA 2GRCA 5BT3A 4PL6A 3L2RA 3OYMA 5DFCA 4MR6A 5H85A 1WJRA 2PQWA 5D3PA 5F60A 3L2QA 5HLSA 3JVMA 4QUTA 4X2IA 5F5ZA 5KU3A 2LSPB 3FLGA 3MP6A 4PLIA 1OYXA 2RI5A 3P8DA 3UWNA 4E96A 2DVQA 4OGIA 4QR4A 5D3TA 5A5NA 4CLBA 4LR6A 5LKTA 2RFJA 4PLLA 2I7KA 4BE2A 3OMGA 5HQ5A 1WJQA 3MUKA 3L2VA 5FROA 5FE2A 3LGFA 5CFWA 5FH6A 4Z02A 5FE9A 4F3IA 2MJVB 4UIWA 5CZGA 3G0LA 4MENA 3GOXA 4XYAA 3C4SA 5A85A 3PMTA 4CUSA 4FLPA 3O8VA 3UVYA 5FE3A 5IGNA 3QBYA 5CQ5A 2XK0A 4CUTA 5KCHA 3U5JA 4PY6A 2MWOA 5DKCA 5F61A 4QBMA 4IORA 4UC4A 3OYHA 4YY4A 2F5KA 5FE7A 2YEMA 3MXFA 2D9EA 4WHWA 2M0OA 5LKXA 5CGPA 4HBWA 4CUQA 4OGJA 5KO4A 2HQEA 2LVMA 5E3DA 4IR5A 1E6IA 5E9MA 4NYVA 5E9KA 5JI8A 3S3MA 5F3AA 4UYFB 5DLZA 3L42A 4LYWA 2RNXA 5E73A 4CFKA 4NR9A 2DIGA 3P1FA 5HRWA 4QSWA 2YRVA 2YYNA 5LUUA 5CUDA 4MEPA 2LDMA 5J26A 3O34A 3LXJA 5D25A 5EICA 5HELA 2RNWA 4NUEA 3I3JA 4O7EA 4A9HA 4IUUA 5EPRA 4CFLA 5FH8A 2QQRA 3META 4CRIA 5DX4A 4YADA 5L8TA 4QSVA 5E9LA 4XUAA 5D3NA 2E7NA 4LYSA 3SVHA 5A5OA 2X35A 5HEMA 4BW4A 3PNWC 4OUFA 4QZSA 4BDZA 2L8DA 2RO0A 4C5EA 4C5GA 3SVGA 3OYFA 4J3IA 4IOOA 5ENHA 4KV4A 5E3GA 4CUPA 2M1HA 2RHYA 4IUTA 4A4FA 2L85A 5A5PA 1OZ3A 3OQ5A 5F25A 4A9NA 3QJ6A 3S3OA 4QSSA 2B8AA 4QEUA 5EM3A 5F1HA 5HCLA 4ALGA 5HJCA 5E9YA 2RNYA 1MHNA 5D6YA 4YYDA 5ENGA 2F6JA 2R10A 5CP5A 4E7KA 2QQSA 5COIA 4YAXA 5H1UA 4NUDA 3E9GA 4TT2A 2VYTA 3OYNA 4E7HA 3DB3A 3K2JA 4PS5A 4N4HA 5CY9A 3HMHA 4BE1A 1WGSA 4HXKA 5EP7A 4UIZA 5E0RA 3LX7A 5A5QA 4YBMA 3ONIA 5KH6A 2FSAA 4TQNA 5EWWA 5G4SA 2P0KA 3NXBA 4A9FA 3MEAA 4O78A 5ENFA 4UYHA 2NXBA 4CUUA 5IIDA 4O7AA 5A81A 5F2PA 4Z6IA 3U5LA 2R0VA 3RCWA 2L84A 3QIIA 1ZS5A 5IN1A 3MP8A 5LKUA 5FH7A 4LZ2A 3OS2A 4LC2A 4HXOA 5CQ4A 4C5HA 4O7BA 5EWDA 4C67A 5DW2A 3OA6A 5J0DA 5CQ8A 2N9GA 5EVAA 4QEVA 5L97A 2R57A 2WACA 3DLMA 4GPJA 3L2WA 3JVKA 3UV5A 5CQ6A 5E7DA 4TTEA 4YY6A 2E6NA 2YEKA 4QQGA 5C8GA 5CQ7A 4HXSA 3P5OA 3OYKA 3Q1JA 4TU6A 4IOQA 5EISA 5TCMA 3FEOA 4NR6A 4QB3A 4E7JA 3TLPA 4J1PA 3OS0A 5IGKA 5I7YA 4NS5A 2IG0A 5KTXA 4PKLA 5EPBA 4A9IA 4NR8A 4YYHA 5I7XA 3S3NA 5TB6A 5I40A 4NR5A 1SSFA 3ZEHA 3S91A 4QR5A 5CQTA 5C7NA 2YQDA 3MB3A 4QC1A 3S92A 2WP2A 4NR4A 5FE4A 5AD2A 4BE0A 5K29A 2G4AA 5BT5A 3NTIA 5C6SA 4HBVA 4ALHA 4O75A 4KV1A 4FU6A 2L3RA 2DVSA 4QYDA 4QSXA 5II2A 1JSPB 5L98A 3LQHA 4IURA 3GG3A 3LQIA 4E7IA 3LQJA 5A5RA 5FDZA 5ETDA 3QZTA 3UV2A 5LKZA 2EQMA 2HQXA 3FC3A 4UIUA 3ZYUA 4Z1QA 5CRMA 4BJXA 2RS9B 4TZ2A 4CURA 2JTFA 3NTKA 5DBMA 3OYBA 5D24A 2L89A 4TS8A 4UIVA 4LD6A 2YDWA 4NUCA 5FB1A 4O77A 5FB0A 5ETBA 5FE5A 2GFUA 4O76A 2NLUA 3KUFA 3AQAA 5HRXA 4QVZA 3F70A 4A9JA 1WJSA 2YELA 4UYDA 2R0SA 4Z6HA 4A9EA 4QY4A 1KHCA 5IAYA 5DLXA 5EGUA 4NQMA 2X4YA 5FFWA 1RI0A 3ASKA 5HENA 3Q2FA 4YABA 5IGMA 2RHIA 4HBYA 5A7CA 4IR4A 3PMIA 5KE2A 2XDPA 4QSPA 5EV9A 4YATA 2EFIA 3QZSA 4O74A 5C85A 3U5PA 5L99A 3OYGA 2I8NA 4CL9A 2BUDA 3DWYA 4TYLA 4NRBA 4IR6A 5HQ7A 5F62A 3U5MA 3OYCA 4QSRA 5H1VA 4QQDA 4YYKA 2EQUA 4ZTFA 5DFDA 5IG6A 1WUMA 4PCIA 5HRVA 3PFSA 2RJFA 2BKDN 4Z1SA 4HBXA 5DYUA 5EI4A 1H3ZA 4QSUA 1X0JA 5JWMA 1XNIA 1JM4B 4ZTJA 5LJ0A 5D3HA 3AADA 5HFQA 5CUGA 2E5QA 4PTBA 4WHUA 5D7XA 2WP1A 3QZVA 2X4XA 3L2UA 4YYJA 3LH0A 2RI7A 5CRZA 4QC3A 2OUOA 4ZQLA 3UVDA 2EQJA 3OYAA 5A83A 4TT4A 3IU5A 4BW3A 5CIUA 2R5MA 2DIQA 4A4EA 4QEWA 2G3RA 2OO1A 5EU1A 4AKNA 5E9IA 2BIVA
chains in the Genus database with same CATH superfamily
2ZPBB 5CPEA 1M9SA 1GBRA 4C8QA 2O4XA 4BW1A 4JZ3A 3OW2P 5D26A 1QVGS 1D09B 3GIBA 4YC9A 1YCYA 2V8JA 5I86A 1SHGA 1VQMT 4OGCA 1AOJA 5CU8A 4ZC9A 4DA4A 2F2XA 4YBTA 2RPNA 3JB9F 1BIAA 5CQAA 1NPPA 1M8MA 4OMLA 3CCEA 1QVPA 5EWHA 3M0TA 4QT7A 2K79A 4YYNA 4MR5A 3LLRA 1JB0E 4X34A 1ARKA 4QUUA 1UEBA 2MAMA 5CUAA 1AEYA 3JCMW 2FB7A 1VQPT 4MMLA 3D1BA 5CR2A 4EIKA 2LTOA 3S6WA 3MO8A 4J0SA 2OI3A 1VIEA 4TT6A 5ENJA 3A8GB 1WHJA 4YYIA 5HQ6A 5KTWA 3CPWA 3RERA 2G6FX 4Q5WA 3BDLA 3FDRA 2JMAA 4QSQA 5CKEA 2ECZA 2DJQA 1WLPB 2RHXA 2OSSA 1Q7YR 1K8AU 3OY9A 1QP3A 1X6GA 5KYWA 4XQ3A 1AWXA 4NL2A 3MP1A 1WUGA 3MKDA 2P0PA 4XUBA 5DKHA 3EAEA 3MEUA 2LQKA 2X9HA 5CUBA 2BE9B 4E7LA 4N4FA 2I0NA 4HXPA 4HKEA 3CMEA 4IIMA 4C5IA 2RJCA 3EGXB 2O31A 2KAFA 5L96A 2M16A 2AZSA 1BI3A 3PVQA 2KR3A 1G5VA 5EWVA 4L59A 3I56Q 2QG9B 5KHMA 1UUEA 3O37A 3JCMg 1M90U 3INZA 4LDVA 3ME9A 2JNGA 1Q7YU 5LVRA 1ZBJA 2DYIA 5FG4A 3G71A 2DLPA 3EGDB 4LDYA 1MMDA 3VYGA 1Y0MA 1QP2A 2DMOA 5DYXA 3DKMA 3NGPA 4C92C 4LD9K 5J39A 2CUDA 4BHWA 4LUEA 4NRAA 2AZVA 2DAQA 2EYYA 3EG9B 2K3XA 3D7CA 2DPPB 3BY7A 2KK4A 4ANJA 3CCRT 2FZGB 2NUTA 4UIYA 4N4GA 1X75C 2X4JA 4A9KA 5GAOq 4KT0E 4B6MA 2K5FA 5BT4A 5C4QA 4ZGEB 5FE6A 1ZUUA 3OYEA 2QTVA 3OYIA 4II1A 3UA7A 2GF7A 1GCPA 1SRMA 4MR3A 3GF5A 4JJBA 5DFBA 3MQMA 2KDSA 5EK9A 2AKLA 3X26B 1EFNA 3M4YA 1VQ9A 3U5KA 2RQRA 4C8QF 5EPSA 2YSQA 4RG2A 3CC2A 4BUGA 4QQ6A 5CVIA 2MCNA 1YI2Q 1FMVA 2EBPA 2CUBA 5IGLA 3E2UA 1ZX6A 3CCRA 5CKDA 4FW2A 3VRYA 1JU5C 1E6HA 4J9CA 3VS4A 1OZ2A 3M57A 3OYMA 2QDYB 1ZQ1A 5D3PA 5HLSA 4X2IA 3CCVQ 3QSUA 2LX9A 5F5ZA 1RLPC 5KU3A 3EG3A 1ZSGA 3MP6A 1IGQA 1OYXA 4M75D 2ZCFB 3WVDB 4LR6A 2RFJA 3OMGA 4M78G 2E64A 2KY9A 4OP0A 1YCSB 3CXCP 2JMCA 4M75G 1D0ZA 1LVKA 4DEXA 3CCJT 3GOXA 2LJ3A 2JM8A 3PMTA 3CC7T 3O8VA 4C8QB 1GRIA 5FE3A 2CSQA 4ZGJB 1D3BB 3UATA 1B3QA 2KGTA 2PUOB 5DKCA 5F61A 4UC4A 5CQXA 1OU9A 5GAMd 5FE7A 1XJWB 3JAME 2MIOA 4HBWA 2YUQA 1YHQT 2HQEA 2LVMA 3HRTA 1M5Q1 4IR5A 2K6DA 1WQ7A 1PRMC 2XDBA 3ZBDA 2HKNA 3CQTA 3JCMX 1QMCA 3S3MA 2HEQA 4A53A 4LYWA 2CP7A 1UTIA 1UG1A 3L2ZA 2QEXT 2XKOC 1RAAB 3CBPA 3EGDA 3TREA 2DIGA 2YYNA 2D8JA 1K1ZA 5LUUA 2A36A 5J26A 3O34A 3LXJA 3VS0A 5GAMg 4M77G 3CCUA 4OF1A 4O7EA 3I56T 1RAFB 2XDDA 4CFLA 3EFOA 1NZ9A 2C0TA 4QSVA 3RNJA 4HT9A 1PHTA 2QK0A 3LWHA 2OTLA 2E7NA 4LYSA 3UDCA 4VUBA 3VKGA 2NUZA 2LCLA 4RG8A 4QZSA 3M54A 2L8DA 4XTXA 3A98A 4C5EA 3X20B 3G7ZA 4IOOA 5ENHA 2DJZA 5E3GA 2M1HA 1TH7A 4A4FA 5A5PA 3OQ5A 4A9NA 3HTRA 4QSSA 2B8AA 5HCLA 1M1KR 5D6YA 4ELZC 2A28A 3VS3A 3G6EQ 1VQLT 2DZCA 2R10A 1H3HA 1T0JA 4YAXA 2VWFA 4XTZA 1C1AA 3TCJA 3I56A 3A8OB 1TXQA 4CC4B 3K2JA 4HXJA 2JXBA 4K11A 2CP0A 4BE1A 1AVZC 1W70A 4OMNA 5KYNA 3LX7A 4QVDA 1KK7A 5A5QA 4A9FA 2DF6A 3HKSA 4O78A 1VQ8T 1T3LA 3CCJA 3T9NA 1ZSZB 5IIDA 2L0AA 5F2PA 2KEAA 2GQIA 3EG0A 1IO6A 2WSEE 1M27C 2KRMA 2FZCB 1KC8U 1VQ8Q 5FH7A 4LZ2A 4IIOA 4LC2A 5CQ4A 4C5HA 1N8RU 1Y57A 1W2BS 1I1JA 5GAOr 1PD0A 1NJIR 2BZ8A 3N5BB 3DLMA 3LW5E 1K9AA 2VGNA 2E6NA 2CREA 4QQGA 3I55T 5CQ7A 4J83A 3Q1JA 4TU6A 5EISA 3QWYA 3CCLA 4M7AD 5I7YA 1T3SA 3JCMd 1KC8C 4PJOF 5EPBA 4A9IA 4M77F 2FZKB 1R8OB 1U06A 1YJWT 5I40A 3S91A 4KGVB 2K2MA 5HCKA 2DL4A 1WYXA 5FE4A 5AD2A 1W6XA 5K29A 2G4AA 5C6SA 5FU7C 2L3RA 4AKGA 4JZ4A 3REAB 1IGUA 1UGPB 3LQIA 2HQHA 3LQJA 2YRCA 5FDZA 3CCLT 2LNVA 2NYSA 2ATCB 3NMZC 1UGRB 2QA4Q 1K0XA 3CCQT 2RS9B 1M1GA 3NTKA 2LCSA 4TS8A 3JCMc 2VVKA 5LJ5d 4O77A 3JCMh 4AFSC 1UGVA 2K4YA 2QA4T 5LJ5h 1Q81R 2IIMA 1WHLA 5KYUA 4C8QC 4A9JA 4UYDA 3VJPA 1KHCA 4EMKB 5EGUA 1MMNA 5FFWA 3ASKA 1VQLQ 2RHIA 2CH4W 2KMTA 3VS6A 1QLYA 2XDPA 4QSPA 5LJ3g 3QZSA 2J6FA 5C85A 2MK5A 1ZA2B 2RQUA 4C8QE 4CL9A 2BUDA 2DL7A 3U5MA 1UECA 5F62A 2ABLA 3CCMA 3X28B 5H1VA 1WUMA 3J81E 1UHFA 2E65A 3KFVA 4HBXA 2PU9B 2RK1A 5IXBA 1NPRA 1X0JA 2CT3A 1G83A 4KBMB 1YJ9A 4PJOD 5D3HA 4OB2B 2LZ6B 5HFQA 1XOVA 5D7XA 2X4XA 5IHNA 4YYJA 3LH0A 1RACB 2OUOA 3UVDA 2YUOA 4PJOG 2DETA 1VQKQ 1D1BA 1BIBA 4BW3A 2V1QA 3CPWP 1NEBA 4A4EA 5CAIA 1PSEA 2G3RA 2DRKA 5EU1A 5E9IA 5GAOl 4A9OA 4EDUA 4D8DA 5ENEA 3QXEB 1SRLA 1QQJA 5AD3A 5HFRA 2DXTA 2OX7A 2GBQA 2CKKA 3UVXA 4QNSA 2EGCA 3C95A 4LE9A 2FEIA 1EX4A 2RHZA 5F1LA 2DWWA 1MUZA 1YWOA 2M9UA 5I29A 2D82A 4NXJA 2CZ1B 1HYOA 3MB4A 1M3BA 2EGAA 4Z93A 5GAOm 2WSCE 4JLGA 2OTLQ 1O75A 2GNCA 2W0ZA 5II1A 4C66A 2AHJB 1UGQB 5FG5A 2DBMA 1RUWA 1Q82U 3BE3A 1GCQA 5M9OA 5HK0A 3M58A 4O72A 4N0AC 2OTJT 3P1CA 1G2BA 1UHCA 2ZPGB 5FWCA 3CCEQ 5DY7A 5KTUA 4RTXA 4C92D 3CCMQ 1SHFA 5FE0A 4OB1B 4J0RA 2QQBA 2MOXA 4ZNXA 2CSIA 1B07A 4NYWA 4XU3A 3U5NA 4TZ8A 2QDLA 1B34A 2PUKB 2JW4A 3MEWA 1M2VA 1OULA 4ZW1A 5EA1A 2YXYA 5CQ3A 1Q86U 3JB9J 4QYLA 2XHCA 3M53A 1M8VA 2OAWA 1YITQ 2KE9A 4C8QD 4F16A 2SEMA 3CC4Q 1Z9ZA 2E1HA 3OMCA 5I83A 4EPCA 4F7UB 2A7YA 4QSTA 2XU8A 1F68A 1Y07A 2COYA 2R58A 3UV4A 5LJ1A 5FE1A 4UYGA 5GAMe 1MV3A 1PG5B 3QKJA 1NLOC 1A0NB 1IHVA 4M77D 5GANj 2RJDA 2YT6A 4LDFA 3EG9A 2RK2A 4M78F 3TQ7P 5KE3A 5I80A 2CP2A 2EKOA 5LVQA 5DW1A 2D0QB 5D6WA 5D3RA 3O36A 2O4XB 1EQFA 4UIXA 4M75F 1W2BA 2XD0A 1OI1A 4UYEA 1WFWA 5ACYA 4O71A 5CCAA 2W10A 3M0UA 4NQNA 3UT1A 4IUVA 4PJOC 1I8FA 3SWNA 4PK4A 4M7AC 5IXFA 4C0ZA 4PJNA 4FL6A 2RI2A 1ZBXA 4XY8A 2DBKA 5EQ1A 4XTYA 5FLXE 1BCMA 3CMEQ 4JS4A 5C87A 3H8ZA 3DB4A 4A9MA 4A4HA 2NUPB 1VQ6A 1ZUKA 1JJ2S 1Y96B 5GMKe 5A82A 2X3XD 4HCBA 3J80E 1N9RA 5E74A 3A5ZB 4BY6C 2EJFA 5G4RA 3JB9G 1D0XA 3C94A 4DBQA 3TU4K 2D9TA 4O7FA 2JOYA 1D1AA 3V7SA 5D3JA 3PTAA 1UE9A 3CCQA 1Y7XA 4YH3A 1TOVA 3JB9I 1KQSA 2E7OA 2YW5A 3O33A 4EMGA 4HCCA 1AZGB 2QGFB 4DOWA 2RI3A 2E12A 3LWIA 5FRNA 2FHDA 3UA6A 5BT3A 4PL6A 5DFCA 2L3SA 2PQWA 2EYQA 5F60A 2DKGA 3L2QA 2JTEA 3JVMA 4N0AA 3EHRA 1M3CA 3CPWS 4M7AE 2LSPB 2V26A 1SG5A 3FJPA 1UDLA 3P8DA 1WHKA 4E96A 3H9NA 4ZGDB 5D3TA 3SFMA 4BE2A 3E1SA 1GFCA 3MUKA 3L2VA 2VV5A 5FE2A 2EAYA 2GCXA 3LGFA 5FH6A 3R6OA 5FE9A 2RNAA 1WQWA 4V2SA 1SKUB 2LNHB 4FYYB 1YJ9Q 4QVCA 3G0LA 4MENA 4PJOE 2JJ9A 2KQWA 1X69A 4XTVA 5I21A 4CUSA 1V76A 3I9QA 3QBYA 1VQPA 3URGA 2XK0A 5GAN8 1Q82R 3QUIA 2LT1A 5FU6C 1WHMA 4PY6A 1VQ7T 3OYHA 2F5KA 4BI3A 2D9EA 3H0IA 5LKXA 3CXCS 1FYNA 2PVOB 1DJ7B 2H3EB 4J9FA 4DOVA 5E3DA 3ZFJA 1E6IA 5LJ3h 4NYVA 3H0HA 5F3AA 4PFZA 2Y4YA 3L42A 5E73A 1VQMA 1VQ5T 3QWXX 4PJLA 1HD3A 1VQ4A 4NR9A 3JCMb 2D0NA 2DD4A 2GGRA 2YRVA 1M1KC 4Z88A 5CUDA 2LDMA 1VQMQ 1VQ9T 5HELA 3HSBA 2DVEA 1WPYA 2AIRB 3I3JA 1R0CB 4R0KA 3META 2QQRA 4CRIA 2YWWA 3P8BB 5KYYB 5L8TA 1WXBA 3M55A 3RKYA 4M7DA 1X43A 1D1CA 5E9LA 4XUAA 4NL3A 5A5OA 1PSFA 3CBOA 1RAEB 3PNWC 1PUOA 4F7UF 2KRNA 4KV4A 1RI9A 3VV0A 2DK3A 3PT9A 5EM3A 5F1HA 2LJ0A 4YYDA 1KD1R 5ENGA 2F6JA 1IHWA 5CP5A 5GANe 1VQPQ 5COIA 1K73U 3GBQA 3OYNA 4E7HA 1M1KU 2VC8A 4LDWA 4PS5A 1VQ7A 4N4HA 3X25B 3H41A 1SPKA 1YFNA 4UIZA 5E0RA 4C92B 4M78D 2CH4A 2KVQG 5G4SA 2P0KA 3NXBA 4E6RA 4Y28E 5A2QE 4XTUA 1BBZA 4Z6IA 2A0FB 1VOMA 3CCVT 2E6ZA 1QVFA 2R0VA 1AZEA 2L84A 1ZS5A 3G1JA 5I2SA 1IB8A 2L3PA 4JDSA 4F7UE 1YJNA 4O7BA 2EQIA 1LNXA 1KC8R 4PNOA 3OA6A 4RKUE 2N9GA 5GJVB 2IPOB 2VASA 4OB0B 2OJ2A 3A8LB 4GPJA 3OW2S 4AFZC 4LDXA 3L2WA 4FYVB 3JVKA 5CQ6A 4TTEA 4YY6A 2HMAA 2ZPFB 1KJWA 3J7AF 2KT1A 3CCVA 4IOQA 2H8HA 1M3AA 3VKHA 4J9GA 1U3OA 4M77A 5IGKA 2E3HA 1Q86R 3SB2A 1VYVA 1K8AC 4XK8E 4NR8A 3WXMB 4YYHA 5I7XA 2LMJA 3NFCA 4HA8A 2LT4A 4NR5A 4M7DE 3HL8A 5CQTA 4XU2A 2YQDA 1KQSS 3MB3A 2OTJA 3SHWA 5BT5A 3NTIA 2LX7A 4HBVA 4O75A 2RQTA 2DVSA 4KGZB 3MHXA 4QSXA 1JSPB 1AT1B 3RESA 2VKNA 3LQHA 2DRMA 1YWPA 4FYWB 4LN2A 1X6BA 2C0OA 5A5RA 4Y92A 5LKZA 2EQMA 3EHQA 3O5ZA 1CSKA 2FRWA 1FX7A 4BJXA 1QKXA 5DBMA 3KBGA 5D24A 2L89A 2XI9A 2ZPIB 4NUCA 5GAOp 5FB1A 2GFUA 3DLLA 2BZXA 3JCMV 2BTTA 3AQAA 5HRXA 4QVZA 4ESRA 2YELA 2K7AA 5DY9A 2X4YA 2YUPA 1RI0A 4YABA 5IGMA 2ZGWA 3VUZA 1TTHB 2EJ9A 1VUBA 1M1FA 3PMIA 4X1VA 1VQKT 4OMMA 5EV9A 1TWBA 2EFIA 3TSWA 1AWJA 1VQ9Q 3U5PA 3DWYA 3QO3A 4IR6A 2DVJA 3HP9A 4QQDA 4ZTFA 3QDRB 3PFSA 1I0CA 2QAZA 2BKDN 1YITT 5DYUA 1X27A 3CCUT 3FRNA 5DLOA 2XG8D 4PFPA 3JV3A 1JM4B 5HKCA 3HPWA 2V8IA 3OYYA 4JJCA 2RA2A 2RQVA 1PD1A 2A08A 5CUGA 2E5QA 3CCUQ 3ER0A 2EGEA 2WP1A 3NPFA 4C92G 3CCMT 4M77C 1Q82C 2LP5A 4QC3A 2LQWA 4O6JA 4X9DA 1MNEA 3OYAA 1MNDA 1WXUA 3QPHA 1N8RR 1LJOA 3ZL7C 2HSPA 4E2FB 4C0DB 4F04B 3CC2T 2DIQA 2LC4A 2MYSA 2BIVA 2KYMA 3OYJA 5D3LA 5A0LA 4XTWA 3BW1A 3OYDA 3JVLA 4YK0A 1ACMB 5LJ2A 4FIBA 1R0BG 4E7ZA 3D7SB 1VA7A 5I89A 2X3WD 4PJMA 1Y71A 2D8HA 2J6KA 2EIFA 1Q81C 2DVRA 1GXIE 3M0SA 2DILA 5DM7R 5I1QA 1PCXA 3OSVA 3LJWA 2DL3A 1K8AR 3MEVA 5EWCA 2GFAA 4XY9A 3P8HA 1N6AA 5FU7B 3U23A 4PCEA 1PM3A 2RHUA 3FIFA 5DYCA 1QWEA 4PJOA 4NYXA 2LRQA 3OS1A 2ED1A 3G71Q 3M0PA 2E70A 5CKHA 3BFMA 5E9VA 2DYBA 1EZZB 2E41A 2KSSA 4FW1A 4M7DD 4WIVA 3MULA 3EH1A 4P5NA 3HFOA 4RTWA 4GLMA 2H60A 1BI0A 3SEMA 4GY5A 4BDYA 3G0JA 3V8JA 3LGLA 1OQKA 4LRGA 2JZ2A 3NTHA 3CMET 1ZUYA 4J9DA 5D3SA 4N3WA 5C0MA 4MEOA 4D6WA 4HXRA 4B9XA 2ZPHB 4KRTA 1O9SA 3JCMQ 1VQNA 4RUGA 4KUIA 4YYGA 2DO3A 4FT4A 5I88A 2MWPA 1SSHA 2OTJQ 3EGXA 1SF9A 2EQKA 1WA7A 4OMOA 2FPDA 3OYLA 1WIEA 3EFRA 2FO0A 1EIFA 4O5VA 4YH4A 1Q95G 2DXBA 4DQ2A 4MZPA 1HXDA 2RJEA 2E3KA 5L8UA 4QR3A 2PZ1A 1QWFA 4MEQA 5DKDA 1BU1A 5AMEA 5ENIA 4C92A 3GPLA 2DVVA 1VQ5Q 4N4IA 2FL7A 1V29B 2JTMA 1W2BP 1X2QA 2CT4A 1RADB 4B9WA 4PJOB 4HXMA 3RMSA 5ENBA 2DTHA 3OB9A 2EYWA 3LYIA 1H92A 1NYGA 2DTIA 4Z8AA 5LJ3j 5IBNA 2LQ8A 4LUDA 1ABQA 1Q7YC 3CC4A 3RR6A 3P1EA 2R0YA 1H641 4MDWA 5AYFA 4IUQA 1I81A 1GFDA 5AMFA 2GQVA 2DX1A 3SD4A 4HXNA 3ERRA 4PFOA 3CMAT 2KI7A 4KUDK 2F6NA 5FRMA 4NR7A 2A3LA 1VQ4T 1U8RA 5FE8A 4C0FA 4F14A 1ZLMA 4LZSA 1LCKA 3JB9H 1K0SA 5F63A 4KULA 2YLCA 2LCCA 4OMFB 2DERA 4RVRA 2HZYA 4A4GA 2CS7A 4AG1C 4NRCA 1QVGP 4F17A 1MMGA 5GAMh 2HBPA 2X4WA 5FU6B 3L2RA 5LJ5g 4M7AA 4MR6A 5H85A 4M77E 4DBRA 3TEEA 4QUTA 2K5LA 4J7IA 1LOJA 3FLGA 3VS2A 4A63B 5A0GA 5CKBA 5IAYA 5A5NA 3CCJQ 2EYZA 2BE7D 2I7KA 2DTOA 2ED0A 5CFWA 3REBB 2K3BA 2MJVB 4UIWA 5CZGA 5GMKj 1TS9A 1VYUA 2O01E 4XYAA 3JCMJ 5L23A 1IZ6A 3C4SA 1J3TA 1WX6A 3V8KA 4FLPA 3UVYA 2KXCA 3I55Q 1W4SA 4HVUA 4MDXA 2F2VA 2MWOA 2E4HA 4YY4A 2CP5A 2VB6A 1M2VB 2ESWA 2M0OA 3UPUA 4CUQA 3HRSA 4J9HA 1S1NA 3TSZA 4OGJA 5KO4A 1G3TA 3I35A 2KROA 2FPFA 5E9MA 3M56A 2EPDA 2YRDA 1WDXA 2DEQA 2E3IA 3GNGA 4HVWA 4CC2A 3GP8A 1VQOA 1YHQA 3PE0A 2O9VA 4RCCA 1YJ9T 5CO7A 4A54A 1BI1A 4QSWA 3CMAA 4AG2C 4MEPA 4FYXB 2DZ9A 1Y96A 1AWOA 2EWNA 4A9HA 4L6V5 1JO8A 5GANd 5DX4A 4YADA 1N9SA 3FB9A 5D3NA 2X35A 3IQLA 5I22A 4ZN3A 2L5QA 4OUFA 1OPKA 3VUBA 3SVGA 3V7CA 1JXOA 3PVLA 4CUPA 2L85A 1OZ3A 5F25A 1QVFS 1PKTA 4ALGA 5HJCA 5E9YA 2RNYA 1MHNA 1M90R 3JB9D 3PIOA 3VS5A 5H1UA 2KBTA 4NUDA 4XAXB 1K9MR 1UJYA 2CZ7B 2GTOA 4AMCA 1OEBA 3HMHA 4KH1B 4HXKA 3AT1B 4C0GA 3EG2A 1F1BB 2QXFA 4M7DG 5KH6A 1M2OA 2FSAA 3MEAA 3A1PA 2QEXA 4JRIA 5ENFA 1AD5A 3BDUA 1G8XA 3ULRB 5GMKm 4O7AA 5A81A 2EVRA 1IXDA 3EFOB 4MZMA 3JRZA 1NBEB 1K73C 5GAN3 3OS2A 1SEMA 1KD1C 5EWDA 2JUFA 1X2KA 1K9MU 4J5YA 5DW2A 2DXUA 3CCLQ 5LJ3e 3VU3C 4XU0A 5J0DA 5CQ8A 2WACA 9ATCB 4DBFA 5D7UA 2K9GA 3UV5A 1VQLA 1FMKA 4HXSA 3P5OA 1WI7A 4RCBA 3OYKA 3RIRA 3FEOA 4NR6A 4QB3A 2CP6A 4E7JA 1KFZA 3TLPA 4EMKA 2QTXA 3QZ9B 2IG0A 4XU1A 2FYKA 5KYXA 4WF2A 5GAMj 4M75A 3ZEHA 1C6VX 1TU0B 4BI8B 1I5LA 1M4ZA 2DA9A 3LH5A 4QC1A 1JJ2A 2ROTA 3C12A 3M5AA 4M78A 3G4ST 4BE0A 1YI2A 2PTKA 4ALHA 5GANg 1B7TA 4KV1A 1OX8A 4QYDA 1NJIU 5II2A 5LL6S 3GG3A 4E7IA 1VQOT 1E7OA 2HQXA 1QCOA 3ZYUA 3NHNA 4DEYA 1VQNQ 1M90C 4UIVA 2I2LA 5LJ5f 2FG0A 5FB0A 1RLQC 1FXXA 2YUNA 1UGSB 3RMQA 4O76A 2NLUA 5CKFA 3F70A 1WJSA 2R0SA 4Z6HA 5A0DA 4QY4A 4D8KA 3AHUA 2Y4XA 5DLXA 2EKHA 4NQMA 5HENA 4IR4A 3OBYA 5KE2A 4RTVA 2CDTA 1IREB 4YATA 2D6FA 2FRYA 5GMKl 5L99A 1ZHIA 4FM4B 4TYLA 4NRBA 5HQ7A 1MMAA 4FSSA 5GMKi 3OYCA 4QSRA 2P0QA 4CI0C 4JPBW 2OTLT 5DFDA 5IG6A 5IHKA 5ECAA 2QGGA 2RJFA 4ELYC 5DLQE 8ATCB 4Z1SA 4JRQA 5EI4A 4JUVA 5GAN7 5JWMA 5EG2A 4ZN1A 1VIFA 4M75C 2QQ9A 5IT9E 2ZAEA 3FJ5A 3HRUA 1VQ7Q 3A8HB 2GTJA 2WSFE 3RKWA 4M75B 1JQQA 4EMKC 1E6GA 2A37A 2EQJA 5FW9A 3VKIA 5A83A 2CGHA 2MMPA 2RN8A 7AT1B 3M0QA 2ENMA 2PVDB 3OW2A 2OO1A 3I5SA 1AWWA 4MZTA 4RTUA 2COWA 3VS7A 1KQ1A 1N5ZA 2Y90A 1D0YA 3RUXA 2EJGA 3JCMe 1G3SA 1TUCA 5EC7A 1WZOA 1FMWA 2RH2A 4C8QG 4O7CA 3CD6Q 3MCAB 2DKWA 5CTLA 1JRIA 2JN0A 3P1DA 3CC7Q 3L1AA 2MPXC 1NE8A 2H3JA 2DE0X 4O70A 4RTTA 2HBWA 2K2VA 1Q86C 4JS5A 1N8RC 1N72A 1BKBA 4OMQA 3O35A 4OB3B 5GJWB 4MR4A 4AFUC 1RAHB 2HNIA 2KYBA 2YHTA 5CQYA 3M9QA 3RKXA 3M59A 3G6ET 1X6OA 3DAIA 5DYAA 3CEYA 1I4K1 1YITA 1TSFA 4DONA 5GMKh 2DATA 4HCZA 2M51A 3R6NA 5CS8A 1AHJB 1OX9A 4MMKA 5HK3A 2HL3A 4HXLA 1YIJA 3G4SQ 4DBHA 3UVWA 5J3BA 1ZKRA 2ZPEB 3C0CA 3E9FA 1KIKA 2B86A 2P4TA 4FSXA 3PGGA 1K4US 4A9LA 5A5SA 3QDFA 2JM9A 4M4ZA 2ZZDA 3QYHB 3CXCA 5LJ5j 4IKFA 2DEUA 3V7RA 3FKMX 1BI2A 4BACA 3CCSQ 1YJWA 2KTBB 5ENCA 3A8MB 2RQWA 5CUEA 5KCOA 5I11A 2NUTB 2DL8A 2LJ1A 4KCXA 4AKIA 1XQHA 2V8KA 4C92E 5FFYA 4QW2A 5KYXB 2J7IA 5CUCA 4JJNK 1K76A 4UYFA 5D6XA 3OSSC 4NOYA 1VQKA 2L3QA 2C06A 2HL5C 1NYFA 1P92A 4WCIA 1UB4A 3Q2EA 3QHSA 4M7DC 4UITA 4LYIA 1HJDA 5FG6A 2HDAA 5F36A 3SWNC 5H1TA 1VQNT 1C0MA 4KH0B 1FWZA 1NLPC 1IRXA 4Q0NA 5FBXA 5C89A 2M0YA 4F7UG 5LJ3f 2QEXQ 2QA4A 1I07A 2RO1A 1N27A 2P84A 2C0IA 3SWNB 3WVEB 3IU6A 4RMOA 2O88A 1X01A 1V1CA 3CC4T 4Y03A 3CC7A 4TU4A 1RAGB 3EG1A 5D0CA 2L5EA 1YNZA 1JJ2P 2PNIA 4J9BA 4RTZA 3VS1A 5GAOn 3QYGB 1VQ8A 1QW1A 1WXTA 5FFVA 1U5SA 3UW9A 4OVAA 3CBMA 4LZRA 4ATOA 3GNFB 1T0HA 4BD3A 4E47A 1KD1U 3U5OA 4YBSA 2X51A 2DNUA 4R55A 3JVJA 2R5AA 3I5RA 3H6ZA 2L2PA 5GAN4 4Q0OA 2K5IA 1YIJT 3SVFA 4LDUA 4IR3A 1S72A 4BW2A 2F2WA 4IUPA 4HCKA 3HMFA 3KXTA 4EMHA 2KXDA 2F5TX 2K3YA 1PNJA 5HM0A 4YYMA 3HMEA 1D3BA 2JT4A 1YIJQ 2GRCA 3HHTB 3EFSA 1WJRA 3CC2Q 2VXFA 3UF4A 1HK9A 1S72Q 4PLIA 4ORZA 2HAXA 2KNBB 2RI5A 1LPLA 1H8KA 2J05A 3UWNA 5LKTA 2DVQA 4OGIA 4QR4A 4CLBA 4L5GA 4OMPA 5GANh 3CCRQ 4PLLA 2F69A 2E10A 5HQ5A 1WJQA 1Z9QA 1JXMA 5FROA 1OV3A 1HSQA 1PC0A 3THKA 4Z02A 2O2OA 3QG1A 4F3IA 2JS0A 4J6YA 2MF2A 1I5OB 4M7DB 2KT8A 5A85A 1ZSZA 3QJYA 4ME7A 1KQSP 5IGNA 3JCMP 5CQ5A 2P4RA 3TVTA 4CUTA 1MV0B 1MGQA 5KCHA 3U5JA 4CC7A 2FVUA 4QBMA 1W1FA 2VXEA 1YHQQ 4IORA 2DM1A 3G71T 2YEMA 3MXFA 4WHWA 2K57A 5KYUB 1UJ0A 5CGPA 4TVRA 6AT1B 1QVGA 2DFUA 2QI2A 2HSEB 2J06A 3JSCA 1KG1A 2AK5A 5E9KA 2EYXA 5JI8A 4UYFB 5DLZA 1WNLA 2RNXA 1QKWA 4CFKA 4AKHA 3QZ5B 4JJDA 3P1FA 5HRWA 3X24B 5AT1B 5D25A 5EICA 3PIPA 3G6EA 4X9CA 2RNWA 4NUEA 4IUUA 5EPRA 5FH8A 1QCNA 3M0RA 1JBMA 3SVHA 3H0FA 3SDZA 5HEMA 1VQOQ 4BW4A 4RTYA 4BDZA 2RO0A 3CCSA 4C5GA 3CCET 2RF0A 3OYFA 4J3IA 2RHYA 4AFQC 4IUTA 8AT1B 4JRKA 3QJ6A 3S3OA 2IVWA 3EGUA 3OBWA 4QEUA 1CKAA 3CCQQ 2DL5A 1BYMA 4BY6B 1WHHA 4E7KA 2QQSA 3E9GA 4TT2A 2VYTA 3HFNA 3DB3A 2M02A 4J9IA 4Z89A 1K73R 4HT8A 3G4SA 1YI2T 1PKSA 5CY9A 1QCFA 4HVVA 4FCYA 1KSWA 1WGSA 5FWBA 5EP7A 2F1LA 2AT1B 1VQ6T 4CC3A 4J6WA 4J7FA 1XTDA 4YBMA 3ONIA 4TQNA 5EWWA 5GANf 1VQ5A 5LJ3d 5LJ5e 4E7SA 4J9EA 4UYHA 2NXBA 4WTOB 4CUUA 1CKBA 5GAN6 1S72T 3RDVA 2QYZA 1YJWQ 3U5LA 4C92F 1YN8A 3E19A 5KYYA 1JEGA 3RCWA 3QIIA 1RABB 1BCOA 2QASA 5IN1A 3MP8A 5LKUA 1KQ2A 4HXOA 4GLKA 2BZYA 1KHIA 4C67A 2E5KA 2FPEA 3GLXA 5KYWB 1RL2A 4M78C 3CD6A 1GCQC 1TUDA 5CK9A 1UFFA 2MI6A 5IH2A 5EVAA 4QEVA 5L97A 1ZA1B 2R57A 4PKCC 4KGXB 1BK2A 1NJIC 2LQNA 1OU8A 4M78B 1OPLA 5E7DA 2YEKA 3VYHB 5C8GA 2AKKA 4Y91A 5I2MA 2D1XA 2JS2A 4M7AB 3D1DA 1OOTA 5TCMA 4M78E 2O9SA 4R56A 1NG2A 3OS0A 4J1PA 3VRZA 2RD1A 1ABOA 1M30A 4NS5A 4J6XA 4M75E 5KTXA 4PKLA 3I55A 2Z0WA 4M7AG 2CZ6B 3S3NA 5TB6A 1BB9A 1SSFA 2YLBA 3CD6T 4QR5A 2VGMA 5C7NA 2CP3A 3S92A 2CZ0B 1GBQA 2WP2A 4NR4A 4A4KA 2EJNA 1PWTA 4FU6A 4YTLA 5GAN5 4PJJA 2HCKA 1VQ6Q 3MPUB 5L98A 3MJXA 4IURA 5ETDA 3OS5A 2ROLA 3QZTA 3UV2A 5GAN2 2NWMA 3FC3A 1G3YA 2KRSA 4UIUA 1K9MC 2PVGB 4Z1QA 5CRMA 4TZ2A 4CURA 2JTFA 2DXCA 3OYBA 5L8RE 4LXCA 4LD6A 2YDWA 1YJNQ 2JVVA 3CMAQ 5ETBA 5FE5A 2XMFA 3KUFA 3JCMf 2V1RA 4QKUA 4A9EA 4M77B 2VUBA 5HY6A 3Q2FA 1QVFP 2HD0A 5IHIA 4HBYA 5A7CA 1ZSZC 1B34B 2DD5A 4OGEA 4JRPA 5GAMf 4C0DC 1WHGA 4O74A 2QQAA 3CCST 3V8LA 3OYGA 2I8NA 2SRCA 2EW3A 2OAUA 2CYZB 4YYKA 2EQUA 4AT1B 1G3WA 4PCIA 2J6OA 5HRVA 4LNPA 1TUGB 1PRLC 1H3ZA 4QSUA 1Q81U 4M7AF 1U1TA 1R77A 2COZA 4M7DF 1XNIA 2NUPA 4ZTJA 1RAIB 5LJ0A 1VQ4Q 1YJNT 1GL5A 2YDLA 1NEGA 3M4GA 3AADA 2RMOA 1YBYA 2HKQB 4FT2A 4PTBA 1VYTA 2RB6A 4WHUA 4F7UA 3QZVA 3L2UA 2RI7A 3CPFA 5CRZA 4ZQLA 1TG0A 2RM4A 4TT4A 3IU5A 1YP5A 2XIDA 2XICA 3RBBB 3EH2A 4J8OA 4BI4A 1U1SA 4GBQA 5CIUA 2R5MA 4QEWA 1NM7A 4BB7A 4AKNA 4JLIA 4AI6A
chains in the Genus database with same CATH topology
2ZPBB 5CPEA 1M9SA 4C8QA 2O4XA 4BW1A 5D26A 1QVGS 3GIBA 4YC9A 1YCYA 2V8JA 5I86A 1VQMT 4OGCA 4DA4A 5CU8A 4ZC9A 4YBTA 3JB9F 1BIAA 5CQAA 1NPPA 3CCEA 1QVPA 5EWHA 4YYNA 4MR5A 3LLRA 1JB0E 4X34A 4QUUA 1UEBA 2MAMA 5CUAA 3JCMW 2FB7A 1VQPT 4MMLA 5CR2A 2LTOA 3S6WA 3MO8A 4J0SA 1VIEA 4TT6A 5ENJA 3A8GB 3CPWA 4YYIA 5HQ6A 5KTWA 3RERA 4Q5WA 3BDLA 3FDRA 4QSQA 5CKEA 2RHXA 2OSSA 1K8AU 3OY9A 1QP3A 4XQ3A 4NL2A 3MP1A 1WUGA 2P0PA 4XUBA 5DKHA 3EAEA 3MEUA 2LQKA 5CUBA 4E7LA 4N4FA 4HXPA 4HKEA 3CMEA 4C5IA 2RJCA 2KAFA 5L96A 2M16A 1BI3A 1G5VA 5EWVA 4L59A 5KHMA 3O37A 3JCMg 1M90U 3INZA 4LDVA 3ME9A 2JNGA 1Q7YU 5LVRA 5FG4A 3G71A 3VYGA 4LDYA 1QP2A 4LD9K 5DYXA 3DKMA 4C92C 5J39A 4BHWA 4NRAA 2DAQA 2K3XA 3D7CA 2DPPB 3BY7A 2KK4A 3CCRT 4UIYA 4N4GA 1X75C 2X4JA 4A9KA 5GAOq 4KT0E 2K5FA 5BT4A 5C4QA 4ZGEB 5FE6A 3OYEA 3OYIA 4II1A 2GF7A 4MR3A 3GF5A 5DFBA 3MQMA 2KDSA 5EK9A 3X26B 3M4YA 1VQ9A 3U5KA 4C8QF 5EPSA 4RG2A 3CC2A 4BUGA 4QQ6A 5CVIA 5IGLA 3CCRA 5CKDA 1OZ2A 3M57A 3OYMA 2QDYB 1ZQ1A 5D3PA 5HLSA 4X2IA 3QSUA 2LX9A 5F5ZA 5KU3A 3MP6A 1OYXA 4M75D 2ZCFB 3WVDB 4LR6A 2RFJA 3OMGA 4M78G 2E64A 2KY9A 4OP0A 4M75G 3CCJT 3GOXA 3PMTA 3CC7T 3O8VA 4C8QB 5FE3A 4ZGJB 1D3BB 2PUOB 5DKCA 5F61A 4UC4A 5CQXA 5GAMd 5FE7A 3JAME 4HBWA 1YHQT 2HQEA 2LVMA 3HRTA 1M5Q1 4IR5A 1WQ7A 2XDBA 3ZBDA 3JCMX 3S3MA 4A53A 4LYWA 3L2ZA 2QEXT 2XKOC 3CBPA 3TREA 2DIGA 2YYNA 5LUUA 5J26A 3O34A 3LXJA 5GAMg 4M77G 3CCUA 4OF1A 4O7EA 3I56T 2XDDA 4CFLA 1NZ9A 4QSVA 4HT9A 2OTLA 3LWHA 2E7NA 4LYSA 3UDCA 4VUBA 2LCLA 4RG8A 4QZSA 3M54A 2L8DA 4XTXA 4C5EA 3X20B 3G7ZA 4IOOA 5ENHA 4A4FA 5E3GA 2DJZA 1TH7A 2M1HA 5A5PA 3OQ5A 4A9NA 4QSSA 2B8AA 5HCLA 5D6YA 4ELZC 1VQLT 2DZCA 2R10A 4YAXA 4XTZA 3TCJA 3I56A 3A8OB 3K2JA 4BE1A 3LX7A 4QVDA 5A5QA 4A9FA 3HKSA 4O78A 1VQ8T 3CCJA 3T9NA 5IIDA 5F2PA 2WSEE 1KC8U 5FH7A 4LZ2A 1N8RU 4LC2A 5CQ4A 4C5HA 1W2BS 5GAOr 3N5BB 3DLMA 3LW5E 2VGNA 2E6NA 4QQGA 3I55T 5CQ7A 4J83A 3Q1JA 4TU6A 5EISA 3CCLA 4M7AD 5I7YA 3JCMd 1KC8C 4PJOF 5EPBA 4A9IA 4M77F 1R8OB 1YJWT 5I40A 3S91A 5FE4A 5AD2A 5K29A 2G4AA 5C6SA 5FU7C 2L3RA 1UGPB 3LQIA 3LQJA 5FDZA 3CCLT 2LNVA 1UGRB 3CCQT 2RS9B 1M1GA 3NTKA 4TS8A 3JCMc 5LJ5d 4O77A 3JCMh 2K4YA 2QA4T 5LJ5h 4C8QC 4A9JA 4UYDA 3VJPA 1KHCA 4EMKB 5EGUA 5FFWA 3ASKA 2KMTA 2RHIA 2XDPA 4QSPA 5LJ3g 3QZSA 5C85A 4C8QE 4CL9A 2BUDA 3U5MA 5F62A 3CCMA 3X28B 5H1VA 1WUMA 3J81E 2E65A 4HBXA 2PU9B 2RK1A 1NPRA 1X0JA 4KBMB 1YJ9A 4PJOD 5D3HA 4OB2B 5HFQA 1XOVA 5D7XA 2X4XA 4YYJA 3LH0A 2OUOA 3UVDA 4PJOG 1BIBA 4BW3A 4A4EA 5CAIA 1PSEA 2G3RA 5EU1A 5E9IA 5GAOl 4A9OA 4EDUA 5ENEA 3QXEB 5AD3A 5HFRA 2DXTA 2CKKA 3UVXA 4QNSA 3C95A 2RHZA 5F1LA 2DWWA 2M9UA 5I29A 2D82A 4NXJA 2CZ1B 5GAOm 3MB4A 4Z93A 2WSCE 4JLGA 1O75A 5II1A 4C66A 2AHJB 1UGQB 5FG5A 1Q82U 5M9OA 5HK0A 3M58A 4O72A 4N0AC 2OTJT 3P1CA 2ZPGB 5DY7A 5KTUA 4C92D 5FE0A 4OB1B 4J0RA 2QQBA 4NYWA 4XU3A 3U5NA 4TZ8A 1B34A 2PUKB 3MEWA 4ZW1A 5EA1A 5CQ3A 1Q86U 3JB9J 4QYLA 2XHCA 3M53A 1M8VA 4C8QD 2E1HA 3OMCA 5I83A 4EPCA 4F7UB 2A7YA 4QSTA 2XU8A 1F68A 1Y07A 2R58A 3UV4A 5LJ1A 5FE1A 4UYGA 5GAMe 3QKJA 5GANj 4M77D 2RJDA 4LDFA 2RK2A 4M78F 5KE3A 5I80A 2EKOA 5LVQA 5DW1A 2D0QB 5D6WA 5D3RA 3O36A 2O4XB 1EQFA 4UIXA 4M75F 1W2BA 2XD0A 1OI1A 4UYEA 5ACYA 4O71A 5CCAA 4NQNA 3UT1A 4IUVA 4PJOC 1I8FA 3SWNA 4M7AC 4C0ZA 4FL6A 2RI2A 1ZBXA 4XY8A 5EQ1A 4XTYA 5FLXE 4JS4A 5C87A 3H8ZA 3DB4A 4A9MA 4A4HA 1VQ6A 1JJ2S 1Y96B 5GMKe 5A82A 4HCBA 3J80E 1N9RA 5E74A 3A5ZB 4BY6C 2EJFA 5G4RA 3JB9G 3C94A 3TU4K 2D9TA 4O7FA 2JOYA 3V7SA 5D3JA 3PTAA 3CCQA 1Y7XA 4YH3A 3JB9I 1KQSA 2E7OA 2YW5A 3O33A 4EMGA 4HCCA 4DOWA 2RI3A 2E12A 3LWIA 5FRNA 2FHDA 5BT3A 4PL6A 5DFCA 2PQWA 2EYQA 5F60A 2DKGA 3L2QA 3JVMA 4N0AA 3CPWS 4M7AE 2LSPB 3FJPA 3P8DA 4ZGDB 4E96A 5D3TA 3SFMA 4BE2A 3E1SA 3MUKA 3L2VA 2VV5A 5FE2A 2EAYA 2GCXA 3LGFA 5FH6A 3R6OA 5FE9A 1WQWA 4V2SA 4QVCA 3G0LA 4MENA 4PJOE 2KQWA 4XTVA 5I21A 4CUSA 3QBYA 1VQPA 3URGA 2XK0A 5GAN8 3QUIA 2LT1A 5FU6C 4PY6A 1VQ7T 3OYHA 2F5KA 4BI3A 2D9EA 5LKXA 3CXCS 2PVOB 1DJ7B 4DOVA 5E3DA 3ZFJA 1E6IA 5LJ3h 4NYVA 5F3AA 2Y4YA 3L42A 5E73A 1VQMA 1VQ5T 1VQ4A 4NR9A 3JCMb 2DD4A 2YRVA 1M1KC 5CUDA 2LDMA 1VQ9T 5HELA 3HSBA 2DVEA 1WPYA 3I3JA 3META 2QQRA 4CRIA 3P8BB 5L8TA 3RKYA 3M55A 4M7DA 5E9LA 4XUAA 4NL3A 5A5OA 1PSFA 3CBOA 3PNWC 4F7UF 4KV4A 3VV0A 2DK3A 3PT9A 5EM3A 5F1HA 4YYDA 5ENGA 2F6JA 5CP5A 5GANe 5COIA 1K73U 3OYNA 4E7HA 1M1KU 2VC8A 4LDWA 4PS5A 1VQ7A 4N4HA 3X25B 4UIZA 5E0RA 4C92B 4M78D 2KVQG 5G4SA 2P0KA 3NXBA 4Y28E 5A2QE 4XTUA 4Z6IA 3CCVT 2E6ZA 1QVFA 2R0VA 2L84A 1ZS5A 5I2SA 4JDSA 4F7UE 1YJNA 4O7BA 1LNXA 4PNOA 3OA6A 4RKUE 2N9GA 4OB0B 3A8LB 4GPJA 3OW2S 4LDXA 3L2WA 3JVKA 5CQ6A 4TTEA 4YY6A 2ZPFB 3J7AF 3CCVA 4IOQA 4M77A 5IGKA 3SB2A 1K8AC 4XK8E 4NR8A 3WXMB 4YYHA 5I7XA 3NFCA 4HA8A 2LT4A 4NR5A 4M7DE 3HL8A 5CQTA 4XU2A 2YQDA 1KQSS 3MB3A 2OTJA 5BT5A 3NTIA 4HBVA 4O75A 2DVSA 3MHXA 4QSXA 1JSPB 3RESA 3LQHA 5A5RA 5LKZA 2EQMA 1FX7A 4BJXA 5DBMA 3KBGA 5D24A 2L89A 2XI9A 2ZPIB 4NUCA 5GAOp 5FB1A 2GFUA 3DLLA 3JCMV 3AQAA 5HRXA 4QVZA 2YELA 5DY9A 2X4YA 1RI0A 4YABA 5IGMA 2ZGWA 3VUZA 2EJ9A 1VUBA 1M1FA 3PMIA 1VQKT 5EV9A 2EFIA 3U5PA 3DWYA 3QO3A 4IR6A 3HP9A 4QQDA 4ZTFA 3QDRB 3PFSA 2BKDN 1YITT 5DYUA 3CCUT 3FRNA 5DLOA 2XG8D 1JM4B 5HKCA 3HPWA 2V8IA 3OYYA 2RA2A 5CUGA 2E5QA 3ER0A 2WP1A 4C92G 3CCMT 4M77C 1Q82C 4QC3A 4O6JA 4X9DA 3OYAA 3QPHA 1LJOA 4C0DB 3CC2T 2DIQA 2LC4A 2BIVA 3OYJA 5D3LA 5A0LA 4XTWA 3BW1A 3OYDA 3JVLA 4YK0A 5LJ2A 4FIBA 5I89A 1Y71A 2EIFA 1Q81C 2DVRA 1GXIE 5DM7R 5I1QA 3OSVA 3LJWA 3MEVA 5EWCA 2GFAA 4XY9A 3P8HA 1N6AA 5FU7B 4PCEA 3FIFA 2RHUA 5DYCA 4PJOA 4NYXA 2LRQA 3OS1A 2E70A 5CKHA 3BFMA 5E9VA 2E41A 2KSSA 4M7DD 4WIVA 3MULA 4P5NA 3HFOA 2H60A 1BI0A 4GY5A 4BDYA 3G0JA 3V8JA 3LGLA 4LRGA 2JZ2A 3NTHA 3CMET 5D3SA 4N3WA 5C0MA 4MEOA 4D6WA 4HXRA 4B9XA 2ZPHB 1O9SA 3JCMQ 1VQNA 4KUIA 4YYGA 2DO3A 4FT4A 5I88A 2MWPA 2EQKA 3OYLA 3EFRA 1EIFA 4O5VA 4YH4A 2DXBA 4DQ2A 4MZPA 1HXDA 2RJEA 2E3KA 5L8UA 4QR3A 4MEQA 5DKDA 5AMEA 5ENIA 4C92A 3GPLA 2DVVA 4N4IA 2FL7A 1V29B 2JTMA 4B9WA 4PJOB 4HXMA 3RMSA 5ENBA 2DTHA 3OB9A 3LYIA 2DTIA 5LJ3j 5IBNA 2LQ8A 1Q7YC 3CC4A 3P1EA 2R0YA 1H641 4MDWA 5AYFA 4IUQA 1I81A 5AMFA 2GQVA 3SD4A 4HXNA 3CMAT 4KUDK 2F6NA 5FRMA 4NR7A 2A3LA 1VQ4T 1U8RA 5FE8A 4C0FA 4LZSA 3JB9H 5F63A 4KULA 2YLCA 2LCCA 4OMFB 4RVRA 4A4GA 2CS7A 4NRCA 5GAMh 2HBPA 2X4WA 5FU6B 3L2RA 5LJ5g 4M7AA 4MR6A 5H85A 4M77E 3TEEA 4QUTA 2K5LA 4J7IA 1LOJA 3FLGA 5A0GA 5CKBA 5IAYA 5A5NA 2I7KA 2DTOA 5CFWA 2MJVB 4UIWA 5CZGA 5GMKj 2O01E 4XYAA 3JCMJ 1IZ6A 3C4SA 3V8KA 4FLPA 3UVYA 1W4SA 4MDXA 2MWOA 4YY4A 2M0OA 3UPUA 4CUQA 3HRSA 4OGJA 5KO4A 1G3TA 5E9MA 3M56A 2DEQA 3GNGA 3GP8A 1VQOA 1YHQA 4RCCA 1YJ9T 5CO7A 4A54A 1BI1A 4QSWA 3CMAA 4MEPA 2DZ9A 1Y96A 2EWNA 4A9HA 4L6V5 5GANd 5DX4A 4YADA 1N9SA 3FB9A 5D3NA 2X35A 4ZN3A 2L5QA 4OUFA 3VUBA 3SVGA 3V7CA 4CUPA 2L85A 1OZ3A 5F25A 1QVFS 4ALGA 5HJCA 5E9YA 2RNYA 1MHNA 3JB9D 3PIOA 5H1UA 4NUDA 4XAXB 2CZ7B 3HMHA 4HXKA 4C0GA 2QXFA 4M7DG 5KH6A 2FSAA 3MEAA 2QEXA 4JRIA 5ENFA 3BDUA 5GMKm 4O7AA 5A81A 4MZMA 3JRZA 1K73C 5GAN3 3OS2A 1KD1C 5EWDA 2JUFA 1K9MU 4J5YA 5DW2A 2DXUA 5LJ3e 3VU3C 4XU0A 5J0DA 5CQ8A 2WACA 3UV5A 1VQLA 4HXSA 3P5OA 4RCBA 3OYKA 3RIRA 3FEOA 4NR6A 4QB3A 4E7JA 3TLPA 4EMKA 2QTXA 3QZ9B 2IG0A 4XU1A 2FYKA 4WF2A 5GAMj 4M75A 3ZEHA 4BI8B 1I5LA 1M4ZA 4QC1A 1JJ2A 3C12A 3M5AA 4M78A 3G4ST 4BE0A 1YI2A 5GANg 4ALHA 4KV1A 4QYDA 1NJIU 5II2A 5LL6S 3GG3A 4E7IA 1VQOT 2HQXA 3ZYUA 1M90C 4UIVA 2I2LA 5LJ5f 5FB0A 1FXXA 1UGSB 3RMQA 4O76A 2NLUA 5CKFA 3F70A 1WJSA 2R0SA 4Z6HA 5A0DA 4QY4A 3AHUA 2Y4XA 5DLXA 4NQMA 5HENA 4IR4A 3OBYA 5KE2A 1IREB 4YATA 2D6FA 5GMKl 5L99A 1ZHIA 4FM4B 4TYLA 4NRBA 5HQ7A 5GMKi 3OYCA 4QSRA 2P0QA 4CI0C 2OTLT 5DFDA 5IG6A 4ELYC 2RJFA 5DLQE 4Z1SA 4JRQA 5EI4A 4JUVA 5GAN7 5JWMA 5EG2A 4ZN1A 1VIFA 4M75C 2QQ9A 5IT9E 3HRUA 3A8HB 2WSFE 3RKWA 4M75B 4EMKC 2EQJA 3VKIA 5A83A 2CGHA 2MMPA 2PVDB 3OW2A 2OO1A 4MZTA 1KQ1A 2Y90A 3RUXA 2EJGA 3JCMe 1G3SA 2RH2A 4C8QG 4O7CA 3MCAB 2DKWA 5CTLA 1JRIA 2JN0A 3P1DA 3L1AA 1NE8A 2H3JA 4O70A 2K2VA 1Q86C 4JS5A 1N8RC 1N72A 1BKBA 3O35A 4OB3B 4MR4A 2HNIA 3G6ET 2YHTA 5CQYA 3M9QA 3RKXA 3M59A 1X6OA 3DAIA 5DYAA 3CEYA 1I4K1 1YITA 4DONA 5GMKh 2DATA 4HCZA 5HK3A 5CS8A 1AHJB 4MMKA 4HXLA 1YIJA 3UVWA 5J3BA 2ZPEB 3E9FA 2P4TA 4FSXA 3PGGA 4A9LA 5A5SA 2ZZDA 3QYHB 3CXCA 5LJ5j 4IKFA 3V7RA 3FKMX 1BI2A 4BACA 1YJWA 2KTBB 5ENCA 3A8MB 5CUEA 5KCOA 4KCXA 1XQHA 2V8KA 4C92E 5FFYA 4QW2A 5CUCA 4JJNK 4UYFA 5D6XA 3OSSC 4NOYA 1VQKA 2C06A 1P92A 1UB4A 3Q2EA 3QHSA 4M7DC 4UITA 4LYIA 5FG6A 3SWNC 5F36A 1VQNT 5H1TA 1FWZA 4Q0NA 5FBXA 5C89A 4F7UG 5LJ3f 2QA4A 1N27A 2RO1A 3SWNB 3WVEB 3IU6A 4RMOA 1X01A 3CC4T 4Y03A 3CC7A 4TU4A 5D0CA 2L5EA 5GAOn 3QYGB 1VQ8A 1QW1A 5FFVA 3UW9A 4OVAA 3CBMA 4LZRA 4ATOA 3GNFB 4BD3A 4E47A 1KD1U 3U5OA 4YBSA 4R55A 3JVJA 2R5AA 3H6ZA 5GAN4 4Q0OA 2K5IA 1YIJT 3SVFA 4LDUA 4IR3A 1S72A 4BW2A 4IUPA 3HMFA 3KXTA 4EMHA 2F5TX 2K3YA 5HM0A 4YYMA 3HMEA 1D3BA 2GRCA 3HHTB 3EFSA 1WJRA 2VXFA 1HK9A 4PLIA 2HAXA 2RI5A 3UWNA 5LKTA 2DVQA 4OGIA 4QR4A 4CLBA 4L5GA 5GANh 4PLLA 2F69A 2E10A 5HQ5A 1WJQA 5FROA 4Z02A 3QG1A 4F3IA 4J6YA 2MF2A 4M7DB 5A85A 3QJYA 4ME7A 5IGNA 3JCMP 5CQ5A 4CUTA 5KCHA 1MGQA 3U5JA 2FVUA 4QBMA 2VXEA 4IORA 3G71T 2YEMA 3MXFA 4WHWA 2K57A 5CGPA 4TVRA 1QVGA 2QI2A 3JSCA 1KG1A 5E9KA 5JI8A 4UYFB 5DLZA 1WNLA 2RNXA 4CFKA 3QZ5B 3P1FA 5HRWA 3X24B 5D25A 5EICA 3PIPA 3G6EA 4X9CA 2RNWA 4NUEA 4IUUA 5EPRA 5FH8A 1JBMA 3SVHA 3SDZA 5HEMA 4BW4A 4BDZA 2RO0A 3CCSA 4C5GA 3CCET 3OYFA 4J3IA 2RHYA 4IUTA 4JRKA 3QJ6A 3S3OA 2IVWA 3OBWA 4QEUA 1BYMA 4BY6B 4E7KA 2QQSA 3E9GA 4TT2A 2VYTA 3HFNA 3DB3A 4HT8A 3G4SA 1YI2T 5CY9A 1WGSA 5EP7A 1VQ6T 4J6WA 4J7FA 1XTDA 4YBMA 3ONIA 4TQNA 5EWWA 5GANf 1VQ5A 5LJ3d 5LJ5e 4UYHA 2NXBA 4CUUA 5GAN6 1S72T 3U5LA 4C92F 3E19A 3RCWA 3QIIA 5IN1A 3MP8A 5LKUA 1KQ2A 4HXOA 4GLKA 1KHIA 4C67A 3GLXA 1RL2A 4M78C 3CD6A 5CK9A 2MI6A 5EVAA 4QEVA 5L97A 2R57A 4PKCC 1NJIC 4M78B 5E7DA 2YEKA 3VYHB 5C8GA 4Y91A 5I2MA 4M7AB 5TCMA 4M78E 4R56A 3OS0A 4J1PA 2RD1A 4NS5A 4J6XA 4M75E 5KTXA 4PKLA 3I55A 4M7AG 2CZ6B 3S3NA 5TB6A 1SSFA 2YLBA 3CD6T 4QR5A 2VGMA 5C7NA 2CZ0B 3S92A 2WP2A 4NR4A 4A4KA 4FU6A 4YTLA 5GAN5 5L98A 4IURA 5ETDA 3OS5A 3QZTA 3UV2A 5GAN2 3FC3A 1G3YA 1K9MC 4UIUA 2PVGB 4Z1QA 5CRMA 4TZ2A 4CURA 2JTFA 2DXCA 3OYBA 5L8RE 4LD6A 2YDWA 2JVVA 5ETBA 5FE5A 3KUFA 3JCMf 4A9EA 4M77B 2VUBA 5HY6A 3Q2FA 2HD0A 4HBYA 5A7CA 1B34B 2DD5A 4OGEA 4JRPA 5GAMf 4C0DC 4O74A 2QQAA 3CCST 3V8LA 3OYGA 2I8NA 2OAUA 2CYZB 4YYKA 2EQUA 1G3WA 4PCIA 5HRVA 1H3ZA 4QSUA 1Q81U 4M7AF 1U1TA 4M7DF 1XNIA 4ZTJA 5LJ0A 1YJNT 3M4GA 3AADA 1YBYA 4FT2A 4PTBA 2RB6A 4WHUA 4F7UA 3QZVA 3L2UA 2RI7A 3CPFA 5CRZA 4ZQLA 2RM4A 4TT4A 3IU5A 2XICA 2XIDA 4J8OA 4BI4A 1U1SA 5CIUA 2R5MA 4QEWA 4BB7A 4AKNA 4JLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9O A;  3OYJ A;  5D3L A;  5CPE A;  4EDU A;  2O4X A;  5ENE A;  4BW1 A;  3OYD A;  5AD3 A;  5HFR A;  5D26 A;  3JVL A;  4YK0 A;  4YC9 A;  2CKK A;  5I86 A;  3UVX A;  4QNS A;  5LJ2 A;  5CU8 A;  4ZC9 A;  5I89 A;  4YBT A;  2RHZ A;  5F1L A;  2DWW A;  5CQA A;  5I29 A;  2DVR A;  2D82 A;  4O7C A;  4NXJ A;  2DKW A;  5CTL A;  3MB4 A;  4Z93 A;  5I1Q A;  3LJW A;  3P1D A;  5EWH A;  5EWC A;  4O70 A;  2GFA A;  3MEV A;  4XY9 A;  4MR5 A;  4YYN A;  3LLR A;  3P8H A;  4X34 A;  5II1 A;  1N72 A;  4C66 A;  4PCE A;  4QUU A;  3O35 A;  2RHU A;  4MR4 A;  5FG5 A;  5DYC A;  4NYX A;  5M9O A;  2LRQ A;  5CUA A;  3M9Q A;  3OS1 A;  3DAI A;  4O72 A;  3P1C A;  5DYA A;  3CEY A;  5DY7 A;  5E9V A;  5KTU A;  5FE0 A;  4DON A;  4J0R A;  2LTO A;  3S6W A;  3MO8 A;  4J0S A;  2DAT A;  4TT6 A;  4WIV A;  3MUL A;  4HCZ A;  4NYW A;  5CS8 A;  3U5N A;  5ENJ A;  4TZ8 A;  4YYI A;  5HQ6 A;  5KTW A;  2H60 A;  4HXL A;  3MEW A;  4GY5 A;  3G0J A;  4BDY A;  3UVW A;  3LGL A;  4ZW1 A;  5EA1 A;  4Q5W A;  3BDL A;  3FDR A;  5CQ3 A;  4QSQ A;  4LRG A;  2JZ2 A;  2RHX A;  2OSS A;  4QYL A;  3OY9 A;  3NTH A;  3E9F A;  5D3S A;  4N3W A;  4A9L A;  5A5S A;  5C0M A;  3OMC A;  3MP1 A;  5I83 A;  1WUG A;  4IKF A;  4MEO A;  4HXR A;  4B9X A;  4XUB A;  5DKH A;  3EAE A;  4QST A;  3MEU A;  1F68 A;  3FKM X;  3UV4 A;  2R58 A;  4BAC A;  5LJ1 A;  2KTB B;  5CUB A;  5ENC A;  5FE1 A;  4E7L A;  4N4F A;  5CUE A;  4HXP A;  4UYG A;  5KCO A;  4C5I A;  4YYG A;  2RJC A;  5I88 A;  3QKJ A;  2MWP A;  4KCX A;  2EQK A;  5L96 A;  2M16 A;  2RJD A;  1G5V A;  3OYL A;  5EWV A;  4LDF A;  4L59 A;  5FFY A;  4QW2 A;  4YH4 A;  5KHM A;  5CUC A;  3O37 A;  5KE3 A;  5I80 A;  2EKO A;  5LVQ A;  5DW1 A;  5D6W A;  5D3R A;  3O36 A;  4UYF A;  2O4X B;  5D6X A;  3ME9 A;  1EQF A;  4UIX A;  2RJE A;  2E3K A;  5L8U A;  5LVR A;  1OI1 A;  4QR3 A;  3Q2E A;  4UIT A;  4LYI A;  4UYE A;  5FG4 A;  5FG6 A;  5F36 A;  5H1T A;  4MEQ A;  5DKD A;  5AME A;  4O71 A;  5DYX A;  4Q0N A;  5ENI A;  5ACY A;  5FBX A;  2DVV A;  5J39 A;  5C89 A;  4NQN A;  4BHW A;  3UT1 A;  4IUV A;  4N4I A;  1N27 A;  2RO1 A;  3IU6 A;  4NRA A;  2DAQ A;  4Y03 A;  2K3X A;  4B9W A;  4TU4 A;  4FL6 A;  3D7C A;  2RI2 A;  5D0C A;  2L5E A;  4UIY A;  4HXM A;  4XY8 A;  4N4G A;  5ENB A;  4A9K A;  5EQ1 A;  3OB9 A;  3LYI A;  5BT4 A;  5C4Q A;  5IBN A;  5C87 A;  5FE6 A;  3H8Z A;  3P1E A;  5FFV A;  3DB4 A;  4A9M A;  2R0Y A;  4A4H A;  3UW9 A;  4OVA A;  3OYE A;  4LZR A;  3OYI A;  4IUQ A;  4II1 A;  4BD3 A;  5A82 A;  5AMF A;  2GF7 A;  3U5O A;  4YBS A;  4MR3 A;  5E74 A;  5DFB A;  3SD4 A;  3MQM A;  3JVJ A;  4HXN A;  5EK9 A;  2R5A A;  5G4R A;  3U5K A;  3H6Z A;  5EPS A;  2D9T A;  4RG2 A;  2F6N A;  4O7F A;  5FRM A;  4Q0O A;  4NR7 A;  4QQ6 A;  5D3J A;  3SVF A;  5FE8 A;  4LZS A;  4IR3 A;  4YH3 A;  4BW2 A;  5IGL A;  5F63 A;  2E7O A;  2YW5 A;  3O33 A;  4IUP A;  3HMF A;  2LCC A;  4RVR A;  2RI3 A;  4A4G A;  2K3Y A;  4NRC A;  5FRN A;  2FHD A;  5HM0 A;  4YYM A;  3HME A;  1OZ2 A;  2X4W A;  2GRC A;  5BT3 A;  4PL6 A;  3L2R A;  3OYM A;  5DFC A;  4MR6 A;  5H85 A;  1WJR A;  2PQW A;  5D3P A;  5F60 A;  3L2Q A;  5HLS A;  3JVM A;  4QUT A;  4X2I A;  5F5Z A;  5KU3 A;  2LSP B;  3FLG A;  3MP6 A;  4PLI A;  1OYX A;  2RI5 A;  3P8D A;  3UWN A;  4E96 A;  2DVQ A;  4OGI A;  4QR4 A;  5D3T A;  5A5N A;  4CLB A;  4LR6 A;  5LKT A;  2RFJ A;  4PLL A;  2I7K A;  4BE2 A;  3OMG A;  5HQ5 A;  1WJQ A;  3MUK A;  3L2V A;  5FRO A;  5FE2 A;  3LGF A;  5CFW A;  5FH6 A;  4Z02 A;  5FE9 A;  4F3I A;  2MJV B;  4UIW A;  5CZG A;  3G0L A;  4MEN A;  3GOX A;  4XYA A;  3C4S A;  5A85 A;  3PMT A;  4CUS A;  4FLP A;  3O8V A;  3UVY A;  5FE3 A;  5IGN A;  3QBY A;  5CQ5 A;  2XK0 A;  4CUT A;  5KCH A;  3U5J A;  4PY6 A;  2MWO A;  5DKC A;  5F61 A;  4QBM A;  4IOR A;  4UC4 A;  3OYH A;  4YY4 A;  2F5K A;  5FE7 A;  2YEM A;  3MXF A;  2D9E A;  4WHW A;  2M0O A;  5LKX A;  5CGP A;  4HBW A;  4CUQ A;  4OGJ A;  5KO4 A;  2HQE A;  2LVM A;  5E3D A;  4IR5 A;  1E6I A;  5E9M A;  4NYV A;  5E9K A;  5JI8 A;  3S3M A;  5F3A A;  4UYF B;  5DLZ A;  3L42 A;  4LYW A;  2RNX A;  5E73 A;  4CFK A;  4NR9 A;  2DIG A;  3P1F A;  5HRW A;  4QSW A;  2YRV A;  2YYN A;  5LUU A;  5CUD A;  4MEP A;  2LDM A;  5J26 A;  3O34 A;  3LXJ A;  5D25 A;  5EIC A;  5HEL A;  2RNW A;  4NUE A;  3I3J A;  4O7E A;  4A9H A;  4IUU A;  5EPR A;  4CFL A;  5FH8 A;  2QQR A;  3MET A;  4CRI A;  5DX4 A;  4YAD A;  5L8T A;  4QSV A;  5E9L A;  4XUA A;  5D3N A;  2E7N A;  4LYS A;  3SVH A;  5A5O A;  2X35 A;  5HEM A;  4BW4 A;  3PNW C;  4OUF A;  4QZS A;  4BDZ A;  2L8D A;  2RO0 A;  4C5E A;  4C5G A;  3SVG A;  3OYF A;  4J3I A;  4IOO A;  5ENH A;  4KV4 A;  5E3G A;  4CUP A;  2M1H A;  2RHY A;  4IUT A;  4A4F A;  2L85 A;  5A5P A;  1OZ3 A;  3OQ5 A;  5F25 A;  4A9N A;  3QJ6 A;  3S3O A;  4QSS A;  2B8A A;  4QEU A;  5EM3 A;  5F1H A;  5HCL A;  4ALG A;  5HJC A;  5E9Y A;  2RNY A;  1MHN A;  5D6Y A;  4YYD A;  5ENG A;  2F6J A;  2R10 A;  5CP5 A;  4E7K A;  2QQS A;  5COI A;  4YAX A;  5H1U A;  4NUD A;  3E9G A;  4TT2 A;  2VYT A;  3OYN A;  4E7H A;  3DB3 A;  3K2J A;  4PS5 A;  4N4H A;  5CY9 A;  3HMH A;  4BE1 A;  1WGS A;  4HXK A;  5EP7 A;  4UIZ A;  5E0R A;  3LX7 A;  5A5Q A;  4YBM A;  3ONI A;  5KH6 A;  2FSA A;  4TQN A;  5EWW A;  5G4S A;  2P0K A;  3NXB A;  4A9F A;  3MEA A;  4O78 A;  5ENF A;  4UYH A;  2NXB A;  4CUU A;  5IID A;  4O7A A;  5A81 A;  5F2P A;  4Z6I A;  3U5L A;  2R0V A;  3RCW A;  2L84 A;  3QII A;  1ZS5 A;  5IN1 A;  3MP8 A;  5LKU A;  5FH7 A;  4LZ2 A;  3OS2 A;  4LC2 A;  4HXO A;  5CQ4 A;  4C5H A;  4O7B A;  5EWD A;  4C67 A;  5DW2 A;  3OA6 A;  5J0D A;  5CQ8 A;  2N9G A;  5EVA A;  4QEV A;  5L97 A;  2R57 A;  2WAC A;  3DLM A;  4GPJ A;  3L2W A;  3JVK A;  3UV5 A;  5CQ6 A;  5E7D A;  4TTE A;  4YY6 A;  2E6N A;  2YEK A;  4QQG A;  5C8G A;  5CQ7 A;  4HXS A;  3P5O A;  3OYK A;  3Q1J A;  4TU6 A;  4IOQ A;  5EIS A;  5TCM A;  3FEO A;  4NR6 A;  4QB3 A;  4E7J A;  3TLP A;  4J1P A;  3OS0 A;  5IGK A;  5I7Y A;  4NS5 A;  2IG0 A;  5KTX A;  4PKL A;  5EPB A;  4A9I A;  4NR8 A;  4YYH A;  5I7X A;  3S3N A;  5TB6 A;  5I40 A;  4NR5 A;  1SSF A;  3ZEH A;  3S91 A;  4QR5 A;  5CQT A;  5C7N A;  2YQD A;  3MB3 A;  4QC1 A;  3S92 A;  2WP2 A;  4NR4 A;  5FE4 A;  5AD2 A;  4BE0 A;  5K29 A;  2G4A A;  5BT5 A;  3NTI A;  5C6S A;  4HBV A;  4ALH A;  4O75 A;  4KV1 A;  4FU6 A;  2L3R A;  2DVS A;  4QYD A;  4QSX A;  5II2 A;  1JSP B;  5L98 A;  3LQH A;  4IUR A;  3GG3 A;  3LQI A;  4E7I A;  3LQJ A;  5A5R A;  5FDZ A;  5ETD A;  3QZT A;  3UV2 A;  5LKZ A;  2EQM A;  2HQX A;  3FC3 A;  4UIU A;  3ZYU A;  4Z1Q A;  5CRM A;  4BJX A;  2RS9 B;  4TZ2 A;  4CUR A;  2JTF A;  3NTK A;  5DBM A;  3OYB A;  5D24 A;  2L89 A;  4TS8 A;  4UIV A;  4LD6 A;  2YDW A;  4NUC A;  5FB1 A;  4O77 A;  5FB0 A;  5ETB A;  5FE5 A;  2GFU A;  4O76 A;  2NLU A;  3KUF A;  3AQA A;  5HRX A;  4QVZ A;  3F70 A;  4A9J A;  1WJS A;  2YEL A;  4UYD A;  2R0S A;  4Z6H A;  4A9E A;  4QY4 A;  1KHC A;  5IAY A;  5DLX A;  5EGU A;  4NQM A;  2X4Y A;  5FFW A;  1RI0 A;  3ASK A;  5HEN A;  3Q2F A;  4YAB A;  5IGM A;  2RHI A;  4HBY A;  5A7C A;  4IR4 A;  3PMI A;  5KE2 A;  2XDP A;  4QSP A;  5EV9 A;  4YAT A;  2EFI A;  3QZS A;  4O74 A;  5C85 A;  3U5P A;  5L99 A;  3OYG A;  2I8N A;  4CL9 A;  2BUD A;  3DWY A;  4TYL A;  4NRB A;  4IR6 A;  5HQ7 A;  5F62 A;  3U5M A;  3OYC A;  4QSR A;  5H1V A;  4QQD A;  4YYK A;  2EQU A;  4ZTF A;  5DFD A;  5IG6 A;  1WUM A;  4PCI A;  5HRV A;  3PFS A;  2RJF A;  2BKD N;  4Z1S A;  4HBX A;  5DYU A;  5EI4 A;  1H3Z A;  4QSU A;  1X0J A;  5JWM A;  1XNI A;  1JM4 B;  4ZTJ A;  5LJ0 A;  5D3H A;  3AAD A;  5HFQ A;  5CUG A;  2E5Q A;  4PTB A;  4WHU A;  5D7X A;  2WP1 A;  3QZV A;  2X4X A;  3L2U A;  4YYJ A;  3LH0 A;  2RI7 A;  5CRZ A;  4QC3 A;  2OUO A;  4ZQL A;  3UVD A;  2EQJ A;  3OYA A;  5A83 A;  4TT4 A;  3IU5 A;  4BW3 A;  5CIU A;  2R5M A;  2DIQ A;  4A4E A;  4QEW A;  2G3R A;  2OO1 A;  5EU1 A;  4AKN A;  5E9I A;  2BIV A; 
#chains in the Genus database with same CATH topology
 2ZPB B;  5CPE A;  1M9S A;  1GBR A;  4C8Q A;  2O4X A;  4BW1 A;  4JZ3 A;  3OW2 P;  5D26 A;  1QVG S;  1D09 B;  3GIB A;  4YC9 A;  1YCY A;  2V8J A;  5I86 A;  1SHG A;  1VQM T;  4OGC A;  1AOJ A;  5CU8 A;  4ZC9 A;  4DA4 A;  2F2X A;  4YBT A;  2RPN A;  3JB9 F;  1BIA A;  5CQA A;  1NPP A;  1M8M A;  4OML A;  3CCE A;  1QVP A;  5EWH A;  3M0T A;  4QT7 A;  2K79 A;  4YYN A;  4MR5 A;  3LLR A;  1JB0 E;  4X34 A;  1ARK A;  4QUU A;  1UEB A;  2MAM A;  5CUA A;  1AEY A;  3JCM W;  2FB7 A;  1VQP T;  4MML A;  3D1B A;  5CR2 A;  4EIK A;  2LTO A;  3S6W A;  3MO8 A;  4J0S A;  2OI3 A;  1VIE A;  4TT6 A;  5ENJ A;  3A8G B;  1WHJ A;  4YYI A;  5HQ6 A;  5KTW A;  3CPW A;  3RER A;  2G6F X;  4Q5W A;  3BDL A;  3FDR A;  2JMA A;  4QSQ A;  5CKE A;  2ECZ A;  2DJQ A;  1WLP B;  2RHX A;  2OSS A;  1Q7Y R;  1K8A U;  3OY9 A;  1QP3 A;  1X6G A;  5KYW A;  4XQ3 A;  1AWX A;  4NL2 A;  3MP1 A;  1WUG A;  3MKD A;  2P0P A;  4XUB A;  5DKH A;  3EAE A;  3MEU A;  2LQK A;  2X9H A;  5CUB A;  2BE9 B;  4E7L A;  4N4F A;  2I0N A;  4HXP A;  4HKE A;  3CME A;  4IIM A;  4C5I A;  2RJC A;  3EGX B;  2O31 A;  2KAF A;  5L96 A;  2M16 A;  2AZS A;  1BI3 A;  3PVQ A;  2KR3 A;  1G5V A;  5EWV A;  4L59 A;  3I56 Q;  2QG9 B;  5KHM A;  1UUE A;  3O37 A;  3JCM g;  1M90 U;  3INZ A;  4LDV A;  3ME9 A;  2JNG A;  1Q7Y U;  5LVR A;  1ZBJ A;  2DYI A;  5FG4 A;  3G71 A;  2DLP A;  3EGD B;  4LDY A;  1MMD A;  3VYG A;  1Y0M A;  1QP2 A;  2DMO A;  5DYX A;  3DKM A;  3NGP A;  4C92 C;  4LD9 K;  5J39 A;  2CUD A;  4BHW A;  4LUE A;  4NRA A;  2AZV A;  2DAQ A;  2EYY A;  3EG9 B;  2K3X A;  3D7C A;  2DPP B;  3BY7 A;  2KK4 A;  4ANJ A;  3CCR T;  2FZG B;  2NUT A;  4UIY A;  4N4G A;  1X75 C;  2X4J A;  4A9K A;  5GAO q;  4KT0 E;  4B6M A;  2K5F A;  5BT4 A;  5C4Q A;  4ZGE B;  5FE6 A;  1ZUU A;  3OYE A;  2QTV A;  3OYI A;  4II1 A;  3UA7 A;  2GF7 A;  1GCP A;  1SRM A;  4MR3 A;  3GF5 A;  4JJB A;  5DFB A;  3MQM A;  2KDS A;  5EK9 A;  2AKL A;  3X26 B;  1EFN A;  3M4Y A;  1VQ9 A;  3U5K A;  2RQR A;  4C8Q F;  5EPS A;  2YSQ A;  4RG2 A;  3CC2 A;  4BUG A;  4QQ6 A;  5CVI A;  2MCN A;  1YI2 Q;  1FMV A;  2EBP A;  2CUB A;  5IGL A;  3E2U A;  1ZX6 A;  3CCR A;  5CKD A;  4FW2 A;  3VRY A;  1JU5 C;  1E6H A;  4J9C A;  3VS4 A;  1OZ2 A;  3M57 A;  3OYM A;  2QDY B;  1ZQ1 A;  5D3P A;  5HLS A;  4X2I A;  3CCV Q;  3QSU A;  2LX9 A;  5F5Z A;  1RLP C;  5KU3 A;  3EG3 A;  1ZSG A;  3MP6 A;  1IGQ A;  1OYX A;  4M75 D;  2ZCF B;  3WVD B;  4LR6 A;  2RFJ A;  3OMG A;  4M78 G;  2E64 A;  2KY9 A;  4OP0 A;  1YCS B;  3CXC P;  2JMC A;  4M75 G;  1D0Z A;  1LVK A;  4DEX A;  3CCJ T;  3GOX A;  2LJ3 A;  2JM8 A;  3PMT A;  3CC7 T;  3O8V A;  4C8Q B;  1GRI A;  5FE3 A;  2CSQ A;  4ZGJ B;  1D3B B;  3UAT A;  1B3Q A;  2KGT A;  2PUO B;  5DKC A;  5F61 A;  4UC4 A;  5CQX A;  1OU9 A;  5GAM d;  5FE7 A;  1XJW B;  3JAM E;  2MIO A;  4HBW A;  2YUQ A;  1YHQ T;  2HQE A;  2LVM A;  3HRT A;  1M5Q 1;  4IR5 A;  2K6D A;  1WQ7 A;  1PRM C;  2XDB A;  3ZBD A;  2HKN A;  3CQT A;  3JCM X;  1QMC A;  3S3M A;  2HEQ A;  4A53 A;  4LYW A;  2CP7 A;  1UTI A;  1UG1 A;  3L2Z A;  2QEX T;  2XKO C;  1RAA B;  3CBP A;  3EGD A;  3TRE A;  2DIG A;  2YYN A;  2D8J A;  1K1Z A;  5LUU A;  2A36 A;  5J26 A;  3O34 A;  3LXJ A;  3VS0 A;  5GAM g;  4M77 G;  3CCU A;  4OF1 A;  4O7E A;  3I56 T;  1RAF B;  2XDD A;  4CFL A;  3EFO A;  1NZ9 A;  2C0T A;  4QSV A;  3RNJ A;  4HT9 A;  1PHT A;  2QK0 A;  3LWH A;  2OTL A;  2E7N A;  4LYS A;  3UDC A;  4VUB A;  3VKG A;  2NUZ A;  2LCL A;  4RG8 A;  4QZS A;  3M54 A;  2L8D A;  4XTX A;  3A98 A;  4C5E A;  3X20 B;  3G7Z A;  4IOO A;  5ENH A;  2DJZ A;  5E3G A;  2M1H A;  1TH7 A;  4A4F A;  5A5P A;  3OQ5 A;  4A9N A;  3HTR A;  4QSS A;  2B8A A;  5HCL A;  1M1K R;  5D6Y A;  4ELZ C;  2A28 A;  3VS3 A;  3G6E Q;  1VQL T;  2DZC A;  2R10 A;  1H3H A;  1T0J A;  4YAX A;  2VWF A;  4XTZ A;  1C1A A;  3TCJ A;  3I56 A;  3A8O B;  1TXQ A;  4CC4 B;  3K2J A;  4HXJ A;  2JXB A;  4K11 A;  2CP0 A;  4BE1 A;  1AVZ C;  1W70 A;  4OMN A;  5KYN A;  3LX7 A;  4QVD A;  1KK7 A;  5A5Q A;  4A9F A;  2DF6 A;  3HKS A;  4O78 A;  1VQ8 T;  1T3L A;  3CCJ A;  3T9N A;  1ZSZ B;  5IID A;  2L0A A;  5F2P A;  2KEA A;  2GQI A;  3EG0 A;  1IO6 A;  2WSE E;  1M27 C;  2KRM A;  2FZC B;  1KC8 U;  1VQ8 Q;  5FH7 A;  4LZ2 A;  4IIO A;  4LC2 A;  5CQ4 A;  4C5H A;  1N8R U;  1Y57 A;  1W2B S;  1I1J A;  5GAO r;  1PD0 A;  1NJI R;  2BZ8 A;  3N5B B;  3DLM A;  3LW5 E;  1K9A A;  2VGN A;  2E6N A;  2CRE A;  4QQG A;  3I55 T;  5CQ7 A;  4J83 A;  3Q1J A;  4TU6 A;  5EIS A;  3QWY A;  3CCL A;  4M7A D;  5I7Y A;  1T3S A;  3JCM d;  1KC8 C;  4PJO F;  5EPB A;  4A9I A;  4M77 F;  2FZK B;  1R8O B;  1U06 A;  1YJW T;  5I40 A;  3S91 A;  4KGV B;  2K2M A;  5HCK A;  2DL4 A;  1WYX A;  5FE4 A;  5AD2 A;  1W6X A;  5K29 A;  2G4A A;  5C6S A;  5FU7 C;  2L3R A;  4AKG A;  4JZ4 A;  3REA B;  1IGU A;  1UGP B;  3LQI A;  2HQH A;  3LQJ A;  2YRC A;  5FDZ A;  3CCL T;  2LNV A;  2NYS A;  2ATC B;  3NMZ C;  1UGR B;  2QA4 Q;  1K0X A;  3CCQ T;  2RS9 B;  1M1G A;  3NTK A;  2LCS A;  4TS8 A;  3JCM c;  2VVK A;  5LJ5 d;  4O77 A;  3JCM h;  4AFS C;  1UGV A;  2K4Y A;  2QA4 T;  5LJ5 h;  1Q81 R;  2IIM A;  1WHL A;  5KYU A;  4C8Q C;  4A9J A;  4UYD A;  3VJP A;  1KHC A;  4EMK B;  5EGU A;  1MMN A;  5FFW A;  3ASK A;  1VQL Q;  2RHI A;  2CH4 W;  2KMT A;  3VS6 A;  1QLY A;  2XDP A;  4QSP A;  5LJ3 g;  3QZS A;  2J6F A;  5C85 A;  2MK5 A;  1ZA2 B;  2RQU A;  4C8Q E;  4CL9 A;  2BUD A;  2DL7 A;  3U5M A;  1UEC A;  5F62 A;  2ABL A;  3CCM A;  3X28 B;  5H1V A;  1WUM A;  3J81 E;  1UHF A;  2E65 A;  3KFV A;  4HBX A;  2PU9 B;  2RK1 A;  5IXB A;  1NPR A;  1X0J A;  2CT3 A;  1G83 A;  4KBM B;  1YJ9 A;  4PJO D;  5D3H A;  4OB2 B;  2LZ6 B;  5HFQ A;  1XOV A;  5D7X A;  2X4X A;  5IHN A;  4YYJ A;  3LH0 A;  1RAC B;  2OUO A;  3UVD A;  2YUO A;  4PJO G;  2DET A;  1VQK Q;  1D1B A;  1BIB A;  4BW3 A;  2V1Q A;  3CPW P;  1NEB A;  4A4E A;  5CAI A;  1PSE A;  2G3R A;  2DRK A;  5EU1 A;  5E9I A;  5GAO l;  4A9O A;  4EDU A;  4D8D A;  5ENE A;  3QXE B;  1SRL A;  1QQJ A;  5AD3 A;  5HFR A;  2DXT A;  2OX7 A;  2GBQ A;  2CKK A;  3UVX A;  4QNS A;  2EGC A;  3C95 A;  4LE9 A;  2FEI A;  1EX4 A;  2RHZ A;  5F1L A;  2DWW A;  1MUZ A;  1YWO A;  2M9U A;  5I29 A;  2D82 A;  4NXJ A;  2CZ1 B;  1HYO A;  3MB4 A;  1M3B A;  2EGA A;  4Z93 A;  5GAO m;  2WSC E;  4JLG A;  2OTL Q;  1O75 A;  2GNC A;  2W0Z A;  5II1 A;  4C66 A;  2AHJ B;  1UGQ B;  5FG5 A;  2DBM A;  1RUW A;  1Q82 U;  3BE3 A;  1GCQ A;  5M9O A;  5HK0 A;  3M58 A;  4O72 A;  4N0A C;  2OTJ T;  3P1C A;  1G2B A;  1UHC A;  2ZPG B;  5FWC A;  3CCE Q;  5DY7 A;  5KTU A;  4RTX A;  4C92 D;  3CCM Q;  1SHF A;  5FE0 A;  4OB1 B;  4J0R A;  2QQB A;  2MOX A;  4ZNX A;  2CSI A;  1B07 A;  4NYW A;  4XU3 A;  3U5N A;  4TZ8 A;  2QDL A;  1B34 A;  2PUK B;  2JW4 A;  3MEW A;  1M2V A;  1OUL A;  4ZW1 A;  5EA1 A;  2YXY A;  5CQ3 A;  1Q86 U;  3JB9 J;  4QYL A;  2XHC A;  3M53 A;  1M8V A;  2OAW A;  1YIT Q;  2KE9 A;  4C8Q D;  4F16 A;  2SEM A;  3CC4 Q;  1Z9Z A;  2E1H A;  3OMC A;  5I83 A;  4EPC A;  4F7U B;  2A7Y A;  4QST A;  2XU8 A;  1F68 A;  1Y07 A;  2COY A;  2R58 A;  3UV4 A;  5LJ1 A;  5FE1 A;  4UYG A;  5GAM e;  1MV3 A;  1PG5 B;  3QKJ A;  1NLO C;  1A0N B;  1IHV A;  4M77 D;  5GAN j;  2RJD A;  2YT6 A;  4LDF A;  3EG9 A;  2RK2 A;  4M78 F;  3TQ7 P;  5KE3 A;  5I80 A;  2CP2 A;  2EKO A;  5LVQ A;  5DW1 A;  2D0Q B;  5D6W A;  5D3R A;  3O36 A;  2O4X B;  1EQF A;  4UIX A;  4M75 F;  1W2B A;  2XD0 A;  1OI1 A;  4UYE A;  1WFW A;  5ACY A;  4O71 A;  5CCA A;  2W10 A;  3M0U A;  4NQN A;  3UT1 A;  4IUV A;  4PJO C;  1I8F A;  3SWN A;  4PK4 A;  4M7A C;  5IXF A;  4C0Z A;  4PJN A;  4FL6 A;  2RI2 A;  1ZBX A;  4XY8 A;  2DBK A;  5EQ1 A;  4XTY A;  5FLX E;  1BCM A;  3CME Q;  4JS4 A;  5C87 A;  3H8Z A;  3DB4 A;  4A9M A;  4A4H A;  2NUP B;  1VQ6 A;  1ZUK A;  1JJ2 S;  1Y96 B;  5GMK e;  5A82 A;  2X3X D;  4HCB A;  3J80 E;  1N9R A;  5E74 A;  3A5Z B;  4BY6 C;  2EJF A;  5G4R A;  3JB9 G;  1D0X A;  3C94 A;  4DBQ A;  3TU4 K;  2D9T A;  4O7F A;  2JOY A;  1D1A A;  3V7S A;  5D3J A;  3PTA A;  1UE9 A;  3CCQ A;  1Y7X A;  4YH3 A;  1TOV A;  3JB9 I;  1KQS A;  2E7O A;  2YW5 A;  3O33 A;  4EMG A;  4HCC A;  1AZG B;  2QGF B;  4DOW A;  2RI3 A;  2E12 A;  3LWI A;  5FRN A;  2FHD A;  3UA6 A;  5BT3 A;  4PL6 A;  5DFC A;  2L3S A;  2PQW A;  2EYQ A;  5F60 A;  2DKG A;  3L2Q A;  2JTE A;  3JVM A;  4N0A A;  3EHR A;  1M3C A;  3CPW S;  4M7A E;  2LSP B;  2V26 A;  1SG5 A;  3FJP A;  1UDL A;  3P8D A;  1WHK A;  4E96 A;  3H9N A;  4ZGD B;  5D3T A;  3SFM A;  4BE2 A;  3E1S A;  1GFC A;  3MUK A;  3L2V A;  2VV5 A;  5FE2 A;  2EAY A;  2GCX A;  3LGF A;  5FH6 A;  3R6O A;  5FE9 A;  2RNA A;  1WQW A;  4V2S A;  1SKU B;  2LNH B;  4FYY B;  1YJ9 Q;  4QVC A;  3G0L A;  4MEN A;  4PJO E;  2JJ9 A;  2KQW A;  1X69 A;  4XTV A;  5I21 A;  4CUS A;  1V76 A;  3I9Q A;  3QBY A;  1VQP A;  3URG A;  2XK0 A;  5GAN 8;  1Q82 R;  3QUI A;  2LT1 A;  5FU6 C;  1WHM A;  4PY6 A;  1VQ7 T;  3OYH A;  2F5K A;  4BI3 A;  2D9E A;  3H0I A;  5LKX A;  3CXC S;  1FYN A;  2PVO B;  1DJ7 B;  2H3E B;  4J9F A;  4DOV A;  5E3D A;  3ZFJ A;  1E6I A;  5LJ3 h;  4NYV A;  3H0H A;  5F3A A;  4PFZ A;  2Y4Y A;  3L42 A;  5E73 A;  1VQM A;  1VQ5 T;  3QWX X;  4PJL A;  1HD3 A;  1VQ4 A;  4NR9 A;  3JCM b;  2D0N A;  2DD4 A;  2GGR A;  2YRV A;  1M1K C;  4Z88 A;  5CUD A;  2LDM A;  1VQM Q;  1VQ9 T;  5HEL A;  3HSB A;  2DVE A;  1WPY A;  2AIR B;  3I3J A;  1R0C B;  4R0K A;  3MET A;  2QQR A;  4CRI A;  2YWW A;  3P8B B;  5KYY B;  5L8T A;  1WXB A;  3M55 A;  3RKY A;  4M7D A;  1X43 A;  1D1C A;  5E9L A;  4XUA A;  4NL3 A;  5A5O A;  1PSF A;  3CBO A;  1RAE B;  3PNW C;  1PUO A;  4F7U F;  2KRN A;  4KV4 A;  1RI9 A;  3VV0 A;  2DK3 A;  3PT9 A;  5EM3 A;  5F1H A;  2LJ0 A;  4YYD A;  1KD1 R;  5ENG A;  2F6J A;  1IHW A;  5CP5 A;  5GAN e;  1VQP Q;  5COI A;  1K73 U;  3GBQ A;  3OYN A;  4E7H A;  1M1K U;  2VC8 A;  4LDW A;  4PS5 A;  1VQ7 A;  4N4H A;  3X25 B;  3H41 A;  1SPK A;  1YFN A;  4UIZ A;  5E0R A;  4C92 B;  4M78 D;  2CH4 A;  2KVQ G;  5G4S A;  2P0K A;  3NXB A;  4E6R A;  4Y28 E;  5A2Q E;  4XTU A;  1BBZ A;  4Z6I A;  2A0F B;  1VOM A;  3CCV T;  2E6Z A;  1QVF A;  2R0V A;  1AZE A;  2L84 A;  1ZS5 A;  3G1J A;  5I2S A;  1IB8 A;  2L3P A;  4JDS A;  4F7U E;  1YJN A;  4O7B A;  2EQI A;  1LNX A;  1KC8 R;  4PNO A;  3OA6 A;  4RKU E;  2N9G A;  5GJV B;  2IPO B;  2VAS A;  4OB0 B;  2OJ2 A;  3A8L B;  4GPJ A;  3OW2 S;  4AFZ C;  4LDX A;  3L2W A;  4FYV B;  3JVK A;  5CQ6 A;  4TTE A;  4YY6 A;  2HMA A;  2ZPF B;  1KJW A;  3J7A F;  2KT1 A;  3CCV A;  4IOQ A;  2H8H A;  1M3A A;  3VKH A;  4J9G A;  1U3O A;  4M77 A;  5IGK A;  2E3H A;  1Q86 R;  3SB2 A;  1VYV A;  1K8A C;  4XK8 E;  4NR8 A;  3WXM B;  4YYH A;  5I7X A;  2LMJ A;  3NFC A;  4HA8 A;  2LT4 A;  4NR5 A;  4M7D E;  3HL8 A;  5CQT A;  4XU2 A;  2YQD A;  1KQS S;  3MB3 A;  2OTJ A;  3SHW A;  5BT5 A;  3NTI A;  2LX7 A;  4HBV A;  4O75 A;  2RQT A;  2DVS A;  4KGZ B;  3MHX A;  4QSX A;  1JSP B;  1AT1 B;  3RES A;  2VKN A;  3LQH A;  2DRM A;  1YWP A;  4FYW B;  4LN2 A;  1X6B A;  2C0O A;  5A5R A;  4Y92 A;  5LKZ A;  2EQM A;  3EHQ A;  3O5Z A;  1CSK A;  2FRW A;  1FX7 A;  4BJX A;  1QKX A;  5DBM A;  3KBG A;  5D24 A;  2L89 A;  2XI9 A;  2ZPI B;  4NUC A;  5GAO p;  5FB1 A;  2GFU A;  3DLL A;  2BZX A;  3JCM V;  2BTT A;  3AQA A;  5HRX A;  4QVZ A;  4ESR A;  2YEL A;  2K7A A;  5DY9 A;  2X4Y A;  2YUP A;  1RI0 A;  4YAB A;  5IGM A;  2ZGW A;  3VUZ A;  1TTH B;  2EJ9 A;  1VUB A;  1M1F A;  3PMI A;  4X1V A;  1VQK T;  4OMM A;  5EV9 A;  1TWB A;  2EFI A;  3TSW A;  1AWJ A;  1VQ9 Q;  3U5P A;  3DWY A;  3QO3 A;  4IR6 A;  2DVJ A;  3HP9 A;  4QQD A;  4ZTF A;  3QDR B;  3PFS A;  1I0C A;  2QAZ A;  2BKD N;  1YIT T;  5DYU A;  1X27 A;  3CCU T;  3FRN A;  5DLO A;  2XG8 D;  4PFP A;  3JV3 A;  1JM4 B;  5HKC A;  3HPW A;  2V8I A;  3OYY A;  4JJC A;  2RA2 A;  2RQV A;  1PD1 A;  2A08 A;  5CUG A;  2E5Q A;  3CCU Q;  3ER0 A;  2EGE A;  2WP1 A;  3NPF A;  4C92 G;  3CCM T;  4M77 C;  1Q82 C;  2LP5 A;  4QC3 A;  2LQW A;  4O6J A;  4X9D A;  1MNE A;  3OYA A;  1MND A;  1WXU A;  3QPH A;  1N8R R;  1LJO A;  3ZL7 C;  2HSP A;  4E2F B;  4C0D B;  4F04 B;  3CC2 T;  2DIQ A;  2LC4 A;  2MYS A;  2BIV A;  2KYM A;  3OYJ A;  5D3L A;  5A0L A;  4XTW A;  3BW1 A;  3OYD A;  3JVL A;  4YK0 A;  1ACM B;  5LJ2 A;  4FIB A;  1R0B G;  4E7Z A;  3D7S B;  1VA7 A;  5I89 A;  2X3W D;  4PJM A;  1Y71 A;  2D8H A;  2J6K A;  2EIF A;  1Q81 C;  2DVR A;  1GXI E;  3M0S A;  2DIL A;  5DM7 R;  5I1Q A;  1PCX A;  3OSV A;  3LJW A;  2DL3 A;  1K8A R;  3MEV A;  5EWC A;  2GFA A;  4XY9 A;  3P8H A;  1N6A A;  5FU7 B;  3U23 A;  4PCE A;  1PM3 A;  2RHU A;  3FIF A;  5DYC A;  1QWE A;  4PJO A;  4NYX A;  2LRQ A;  3OS1 A;  2ED1 A;  3G71 Q;  3M0P A;  2E70 A;  5CKH A;  3BFM A;  5E9V A;  2DYB A;  1EZZ B;  2E41 A;  2KSS A;  4FW1 A;  4M7D D;  4WIV A;  3MUL A;  3EH1 A;  4P5N A;  3HFO A;  4RTW A;  4GLM A;  2H60 A;  1BI0 A;  3SEM A;  4GY5 A;  4BDY A;  3G0J A;  3V8J A;  3LGL A;  1OQK A;  4LRG A;  2JZ2 A;  3NTH A;  3CME T;  1ZUY A;  4J9D A;  5D3S A;  4N3W A;  5C0M A;  4MEO A;  4D6W A;  4HXR A;  4B9X A;  2ZPH B;  4KRT A;  1O9S A;  3JCM Q;  1VQN A;  4RUG A;  4KUI A;  4YYG A;  2DO3 A;  4FT4 A;  5I88 A;  2MWP A;  1SSH A;  2OTJ Q;  3EGX A;  1SF9 A;  2EQK A;  1WA7 A;  4OMO A;  2FPD A;  3OYL A;  1WIE A;  3EFR A;  2FO0 A;  1EIF A;  4O5V A;  4YH4 A;  1Q95 G;  2DXB A;  4DQ2 A;  4MZP A;  1HXD A;  2RJE A;  2E3K A;  5L8U A;  4QR3 A;  2PZ1 A;  1QWF A;  4MEQ A;  5DKD A;  1BU1 A;  5AME A;  5ENI A;  4C92 A;  3GPL A;  2DVV A;  1VQ5 Q;  4N4I A;  2FL7 A;  1V29 B;  2JTM A;  1W2B P;  1X2Q A;  2CT4 A;  1RAD B;  4B9W A;  4PJO B;  4HXM A;  3RMS A;  5ENB A;  2DTH A;  3OB9 A;  2EYW A;  3LYI A;  1H92 A;  1NYG A;  2DTI A;  4Z8A A;  5LJ3 j;  5IBN A;  2LQ8 A;  4LUD A;  1ABQ A;  1Q7Y C;  3CC4 A;  3RR6 A;  3P1E A;  2R0Y A;  1H64 1;  4MDW A;  5AYF A;  4IUQ A;  1I81 A;  1GFD A;  5AMF A;  2GQV A;  2DX1 A;  3SD4 A;  4HXN A;  3ERR A;  4PFO A;  3CMA T;  2KI7 A;  4KUD K;  2F6N A;  5FRM A;  4NR7 A;  2A3L A;  1VQ4 T;  1U8R A;  5FE8 A;  4C0F A;  4F14 A;  1ZLM A;  4LZS A;  1LCK A;  3JB9 H;  1K0S A;  5F63 A;  4KUL A;  2YLC A;  2LCC A;  4OMF B;  2DER A;  4RVR A;  2HZY A;  4A4G A;  2CS7 A;  4AG1 C;  4NRC A;  1QVG P;  4F17 A;  1MMG A;  5GAM h;  2HBP A;  2X4W A;  5FU6 B;  3L2R A;  5LJ5 g;  4M7A A;  4MR6 A;  5H85 A;  4M77 E;  4DBR A;  3TEE A;  4QUT A;  2K5L A;  4J7I A;  1LOJ A;  3FLG A;  3VS2 A;  4A63 B;  5A0G A;  5CKB A;  5IAY A;  5A5N A;  3CCJ Q;  2EYZ A;  2BE7 D;  2I7K A;  2DTO A;  2ED0 A;  5CFW A;  3REB B;  2K3B A;  2MJV B;  4UIW A;  5CZG A;  5GMK j;  1TS9 A;  1VYU A;  2O01 E;  4XYA A;  3JCM J;  5L23 A;  1IZ6 A;  3C4S A;  1J3T A;  1WX6 A;  3V8K A;  4FLP A;  3UVY A;  2KXC A;  3I55 Q;  1W4S A;  4HVU A;  4MDX A;  2F2V A;  2MWO A;  2E4H A;  4YY4 A;  2CP5 A;  2VB6 A;  1M2V B;  2ESW A;  2M0O A;  3UPU A;  4CUQ A;  3HRS A;  4J9H A;  1S1N A;  3TSZ A;  4OGJ A;  5KO4 A;  1G3T A;  3I35 A;  2KRO A;  2FPF A;  5E9M A;  3M56 A;  2EPD A;  2YRD A;  1WDX A;  2DEQ A;  2E3I A;  3GNG A;  4HVW A;  4CC2 A;  3GP8 A;  1VQO A;  1YHQ A;  3PE0 A;  2O9V A;  4RCC A;  1YJ9 T;  5CO7 A;  4A54 A;  1BI1 A;  4QSW A;  3CMA A;  4AG2 C;  4MEP A;  4FYX B;  2DZ9 A;  1Y96 A;  1AWO A;  2EWN A;  4A9H A;  4L6V 5;  1JO8 A;  5GAN d;  5DX4 A;  4YAD A;  1N9S A;  3FB9 A;  5D3N A;  2X35 A;  3IQL A;  5I22 A;  4ZN3 A;  2L5Q A;  4OUF A;  1OPK A;  3VUB A;  3SVG A;  3V7C A;  1JXO A;  3PVL A;  4CUP A;  2L85 A;  1OZ3 A;  5F25 A;  1QVF S;  1PKT A;  4ALG A;  5HJC A;  5E9Y A;  2RNY A;  1MHN A;  1M90 R;  3JB9 D;  3PIO A;  3VS5 A;  5H1U A;  2KBT A;  4NUD A;  4XAX B;  1K9M R;  1UJY A;  2CZ7 B;  2GTO A;  4AMC A;  1OEB A;  3HMH A;  4KH1 B;  4HXK A;  3AT1 B;  4C0G A;  3EG2 A;  1F1B B;  2QXF A;  4M7D G;  5KH6 A;  1M2O A;  2FSA A;  3MEA A;  3A1P A;  2QEX A;  4JRI A;  5ENF A;  1AD5 A;  3BDU A;  1G8X A;  3ULR B;  5GMK m;  4O7A A;  5A81 A;  2EVR A;  1IXD A;  3EFO B;  4MZM A;  3JRZ A;  1NBE B;  1K73 C;  5GAN 3;  3OS2 A;  1SEM A;  1KD1 C;  5EWD A;  2JUF A;  1X2K A;  1K9M U;  4J5Y A;  5DW2 A;  2DXU A;  3CCL Q;  5LJ3 e;  3VU3 C;  4XU0 A;  5J0D A;  5CQ8 A;  2WAC A;  9ATC B;  4DBF A;  5D7U A;  2K9G A;  3UV5 A;  1VQL A;  1FMK A;  4HXS A;  3P5O A;  1WI7 A;  4RCB A;  3OYK A;  3RIR A;  3FEO A;  4NR6 A;  4QB3 A;  2CP6 A;  4E7J A;  1KFZ A;  3TLP A;  4EMK A;  2QTX A;  3QZ9 B;  2IG0 A;  4XU1 A;  2FYK A;  5KYX A;  4WF2 A;  5GAM j;  4M75 A;  3ZEH A;  1C6V X;  1TU0 B;  4BI8 B;  1I5L A;  1M4Z A;  2DA9 A;  3LH5 A;  4QC1 A;  1JJ2 A;  2ROT A;  3C12 A;  3M5A A;  4M78 A;  3G4S T;  4BE0 A;  1YI2 A;  2PTK A;  4ALH A;  5GAN g;  1B7T A;  4KV1 A;  1OX8 A;  4QYD A;  1NJI U;  5II2 A;  5LL6 S;  3GG3 A;  4E7I A;  1VQO T;  1E7O A;  2HQX A;  1QCO A;  3ZYU A;  3NHN A;  4DEY A;  1VQN Q;  1M90 C;  4UIV A;  2I2L A;  5LJ5 f;  2FG0 A;  5FB0 A;  1RLQ C;  1FXX A;  2YUN A;  1UGS B;  3RMQ A;  4O76 A;  2NLU A;  5CKF A;  3F70 A;  1WJS A;  2R0S A;  4Z6H A;  5A0D A;  4QY4 A;  4D8K A;  3AHU A;  2Y4X A;  5DLX A;  2EKH A;  4NQM A;  5HEN A;  4IR4 A;  3OBY A;  5KE2 A;  4RTV A;  2CDT A;  1IRE B;  4YAT A;  2D6F A;  2FRY A;  5GMK l;  5L99 A;  1ZHI A;  4FM4 B;  4TYL A;  4NRB A;  5HQ7 A;  1MMA A;  4FSS A;  5GMK i;  3OYC A;  4QSR A;  2P0Q A;  4CI0 C;  4JPB W;  2OTL T;  5DFD A;  5IG6 A;  5IHK A;  5ECA A;  2QGG A;  2RJF A;  4ELY C;  5DLQ E;  8ATC B;  4Z1S A;  4JRQ A;  5EI4 A;  4JUV A;  5GAN 7;  5JWM A;  5EG2 A;  4ZN1 A;  1VIF A;  4M75 C;  2QQ9 A;  5IT9 E;  2ZAE A;  3FJ5 A;  3HRU A;  1VQ7 Q;  3A8H B;  2GTJ A;  2WSF E;  3RKW A;  4M75 B;  1JQQ A;  4EMK C;  1E6G A;  2A37 A;  2EQJ A;  5FW9 A;  3VKI A;  5A83 A;  2CGH A;  2MMP A;  2RN8 A;  7AT1 B;  3M0Q A;  2ENM A;  2PVD B;  3OW2 A;  2OO1 A;  3I5S A;  1AWW A;  4MZT A;  4RTU A;  2COW A;  3VS7 A;  1KQ1 A;  1N5Z A;  2Y90 A;  1D0Y A;  3RUX A;  2EJG A;  3JCM e;  1G3S A;  1TUC A;  5EC7 A;  1WZO A;  1FMW A;  2RH2 A;  4C8Q G;  4O7C A;  3CD6 Q;  3MCA B;  2DKW A;  5CTL A;  1JRI A;  2JN0 A;  3P1D A;  3CC7 Q;  3L1A A;  2MPX C;  1NE8 A;  2H3J A;  2DE0 X;  4O70 A;  4RTT A;  2HBW A;  2K2V A;  1Q86 C;  4JS5 A;  1N8R C;  1N72 A;  1BKB A;  4OMQ A;  3O35 A;  4OB3 B;  5GJW B;  4MR4 A;  4AFU C;  1RAH B;  2HNI A;  2KYB A;  2YHT A;  5CQY A;  3M9Q A;  3RKX A;  3M59 A;  3G6E T;  1X6O A;  3DAI A;  5DYA A;  3CEY A;  1I4K 1;  1YIT A;  1TSF A;  4DON A;  5GMK h;  2DAT A;  4HCZ A;  2M51 A;  3R6N A;  5CS8 A;  1AHJ B;  1OX9 A;  4MMK A;  5HK3 A;  2HL3 A;  4HXL A;  1YIJ A;  3G4S Q;  4DBH A;  3UVW A;  5J3B A;  1ZKR A;  2ZPE B;  3C0C A;  3E9F A;  1KIK A;  2B86 A;  2P4T A;  4FSX A;  3PGG A;  1K4U S;  4A9L A;  5A5S A;  3QDF A;  2JM9 A;  4M4Z A;  2ZZD A;  3QYH B;  3CXC A;  5LJ5 j;  4IKF A;  2DEU A;  3V7R A;  3FKM X;  1BI2 A;  4BAC A;  3CCS Q;  1YJW A;  2KTB B;  5ENC A;  3A8M B;  2RQW A;  5CUE A;  5KCO A;  5I11 A;  2NUT B;  2DL8 A;  2LJ1 A;  4KCX A;  4AKI A;  1XQH A;  2V8K A;  4C92 E;  5FFY A;  4QW2 A;  5KYX B;  2J7I A;  5CUC A;  4JJN K;  1K76 A;  4UYF A;  5D6X A;  3OSS C;  4NOY A;  1VQK A;  2L3Q A;  2C06 A;  2HL5 C;  1NYF A;  1P92 A;  4WCI A;  1UB4 A;  3Q2E A;  3QHS A;  4M7D C;  4UIT A;  4LYI A;  1HJD A;  5FG6 A;  2HDA A;  5F36 A;  3SWN C;  5H1T A;  1VQN T;  1C0M A;  4KH0 B;  1FWZ A;  1NLP C;  1IRX A;  4Q0N A;  5FBX A;  5C89 A;  2M0Y A;  4F7U G;  5LJ3 f;  2QEX Q;  2QA4 A;  1I07 A;  2RO1 A;  1N27 A;  2P84 A;  2C0I A;  3SWN B;  3WVE B;  3IU6 A;  4RMO A;  2O88 A;  1X01 A;  1V1C A;  3CC4 T;  4Y03 A;  3CC7 A;  4TU4 A;  1RAG B;  3EG1 A;  5D0C A;  2L5E A;  1YNZ A;  1JJ2 P;  2PNI A;  4J9B A;  4RTZ A;  3VS1 A;  5GAO n;  3QYG B;  1VQ8 A;  1QW1 A;  1WXT A;  5FFV A;  1U5S A;  3UW9 A;  4OVA A;  3CBM A;  4LZR A;  4ATO A;  3GNF B;  1T0H A;  4BD3 A;  4E47 A;  1KD1 U;  3U5O A;  4YBS A;  2X51 A;  2DNU A;  4R55 A;  3JVJ A;  2R5A A;  3I5R A;  3H6Z A;  2L2P A;  5GAN 4;  4Q0O A;  2K5I A;  1YIJ T;  3SVF A;  4LDU A;  4IR3 A;  1S72 A;  4BW2 A;  2F2W A;  4IUP A;  4HCK A;  3HMF A;  3KXT A;  4EMH A;  2KXD A;  2F5T X;  2K3Y A;  1PNJ A;  5HM0 A;  4YYM A;  3HME A;  1D3B A;  2JT4 A;  1YIJ Q;  2GRC A;  3HHT B;  3EFS A;  1WJR A;  3CC2 Q;  2VXF A;  3UF4 A;  1HK9 A;  1S72 Q;  4PLI A;  4ORZ A;  2HAX A;  2KNB B;  2RI5 A;  1LPL A;  1H8K A;  2J05 A;  3UWN A;  5LKT A;  2DVQ A;  4OGI A;  4QR4 A;  4CLB A;  4L5G A;  4OMP A;  5GAN h;  3CCR Q;  4PLL A;  2F69 A;  2E10 A;  5HQ5 A;  1WJQ A;  1Z9Q A;  1JXM A;  5FRO A;  1OV3 A;  1HSQ A;  1PC0 A;  3THK A;  4Z02 A;  2O2O A;  3QG1 A;  4F3I A;  2JS0 A;  4J6Y A;  2MF2 A;  1I5O B;  4M7D B;  2KT8 A;  5A85 A;  1ZSZ A;  3QJY A;  4ME7 A;  1KQS P;  5IGN A;  3JCM P;  5CQ5 A;  2P4R A;  3TVT A;  4CUT A;  1MV0 B;  1MGQ A;  5KCH A;  3U5J A;  4CC7 A;  2FVU A;  4QBM A;  1W1F A;  2VXE A;  1YHQ Q;  4IOR A;  2DM1 A;  3G71 T;  2YEM A;  3MXF A;  4WHW A;  2K57 A;  5KYU B;  1UJ0 A;  5CGP A;  4TVR A;  6AT1 B;  1QVG A;  2DFU A;  2QI2 A;  2HSE B;  2J06 A;  3JSC A;  1KG1 A;  2AK5 A;  5E9K A;  2EYX A;  5JI8 A;  4UYF B;  5DLZ A;  1WNL A;  2RNX A;  1QKW A;  4CFK A;  4AKH A;  3QZ5 B;  4JJD A;  3P1F A;  5HRW A;  3X24 B;  5AT1 B;  5D25 A;  5EIC A;  3PIP A;  3G6E A;  4X9C A;  2RNW A;  4NUE A;  4IUU A;  5EPR A;  5FH8 A;  1QCN A;  3M0R A;  1JBM A;  3SVH A;  3H0F A;  3SDZ A;  5HEM A;  1VQO Q;  4BW4 A;  4RTY A;  4BDZ A;  2RO0 A;  3CCS A;  4C5G A;  3CCE T;  2RF0 A;  3OYF A;  4J3I A;  2RHY A;  4AFQ C;  4IUT A;  8AT1 B;  4JRK A;  3QJ6 A;  3S3O A;  2IVW A;  3EGU A;  3OBW A;  4QEU A;  1CKA A;  3CCQ Q;  2DL5 A;  1BYM A;  4BY6 B;  1WHH A;  4E7K A;  2QQS A;  3E9G A;  4TT2 A;  2VYT A;  3HFN A;  3DB3 A;  2M02 A;  4J9I A;  4Z89 A;  1K73 R;  4HT8 A;  3G4S A;  1YI2 T;  1PKS A;  5CY9 A;  1QCF A;  4HVV A;  4FCY A;  1KSW A;  1WGS A;  5FWB A;  5EP7 A;  2F1L A;  2AT1 B;  1VQ6 T;  4CC3 A;  4J6W A;  4J7F A;  1XTD A;  4YBM A;  3ONI A;  4TQN A;  5EWW A;  5GAN f;  1VQ5 A;  5LJ3 d;  5LJ5 e;  4E7S A;  4J9E A;  4UYH A;  2NXB A;  4WTO B;  4CUU A;  1CKB A;  5GAN 6;  1S72 T;  3RDV A;  2QYZ A;  1YJW Q;  3U5L A;  4C92 F;  1YN8 A;  3E19 A;  5KYY A;  1JEG A;  3RCW A;  3QII A;  1RAB B;  1BCO A;  2QAS A;  5IN1 A;  3MP8 A;  5LKU A;  1KQ2 A;  4HXO A;  4GLK A;  2BZY A;  1KHI A;  4C67 A;  2E5K A;  2FPE A;  3GLX A;  5KYW B;  1RL2 A;  4M78 C;  3CD6 A;  1GCQ C;  1TUD A;  5CK9 A;  1UFF A;  2MI6 A;  5IH2 A;  5EVA A;  4QEV A;  5L97 A;  1ZA1 B;  2R57 A;  4PKC C;  4KGX B;  1BK2 A;  1NJI C;  2LQN A;  1OU8 A;  4M78 B;  1OPL A;  5E7D A;  2YEK A;  3VYH B;  5C8G A;  2AKK A;  4Y91 A;  5I2M A;  2D1X A;  2JS2 A;  4M7A B;  3D1D A;  1OOT A;  5TCM A;  4M78 E;  2O9S A;  4R56 A;  1NG2 A;  3OS0 A;  4J1P A;  3VRZ A;  2RD1 A;  1ABO A;  1M30 A;  4NS5 A;  4J6X A;  4M75 E;  5KTX A;  4PKL A;  3I55 A;  2Z0W A;  4M7A G;  2CZ6 B;  3S3N A;  5TB6 A;  1BB9 A;  1SSF A;  2YLB A;  3CD6 T;  4QR5 A;  2VGM A;  5C7N A;  2CP3 A;  3S92 A;  2CZ0 B;  1GBQ A;  2WP2 A;  4NR4 A;  4A4K A;  2EJN A;  1PWT A;  4FU6 A;  4YTL A;  5GAN 5;  4PJJ A;  2HCK A;  1VQ6 Q;  3MPU B;  5L98 A;  3MJX A;  4IUR A;  5ETD A;  3OS5 A;  2ROL A;  3QZT A;  3UV2 A;  5GAN 2;  2NWM A;  3FC3 A;  1G3Y A;  2KRS A;  4UIU A;  1K9M C;  2PVG B;  4Z1Q A;  5CRM A;  4TZ2 A;  4CUR A;  2JTF A;  2DXC A;  3OYB A;  5L8R E;  4LXC A;  4LD6 A;  2YDW A;  1YJN Q;  2JVV A;  3CMA Q;  5ETB A;  5FE5 A;  2XMF A;  3KUF A;  3JCM f;  2V1R A;  4QKU A;  4A9E A;  4M77 B;  2VUB A;  5HY6 A;  3Q2F A;  1QVF P;  2HD0 A;  5IHI A;  4HBY A;  5A7C A;  1ZSZ C;  1B34 B;  2DD5 A;  4OGE A;  4JRP A;  5GAM f;  4C0D C;  1WHG A;  4O74 A;  2QQA A;  3CCS T;  3V8L A;  3OYG A;  2I8N A;  2SRC A;  2EW3 A;  2OAU A;  2CYZ B;  4YYK A;  2EQU A;  4AT1 B;  1G3W A;  4PCI A;  2J6O A;  5HRV A;  4LNP A;  1TUG B;  1PRL C;  1H3Z A;  4QSU A;  1Q81 U;  4M7A F;  1U1T A;  1R77 A;  2COZ A;  4M7D F;  1XNI A;  2NUP A;  4ZTJ A;  1RAI B;  5LJ0 A;  1VQ4 Q;  1YJN T;  1GL5 A;  2YDL A;  1NEG A;  3M4G A;  3AAD A;  2RMO A;  1YBY A;  2HKQ B;  4FT2 A;  4PTB A;  1VYT A;  2RB6 A;  4WHU A;  4F7U A;  3QZV A;  3L2U A;  2RI7 A;  3CPF A;  5CRZ A;  4ZQL A;  1TG0 A;  2RM4 A;  4TT4 A;  3IU5 A;  1YP5 A;  2XID A;  2XIC A;  3RBB B;  3EH2 A;  4J8O A;  4BI4 A;  1U1S A;  4GBQ A;  5CIU A;  2R5M A;  4QEW A;  1NM7 A;  4BB7 A;  4AKN A;  4JLI A;  4AI6 A; 
#chains in the Genus database with same CATH homology
 2ZPB B;  5CPE A;  1M9S A;  4C8Q A;  2O4X A;  4BW1 A;  5D26 A;  1QVG S;  3GIB A;  4YC9 A;  1YCY A;  2V8J A;  5I86 A;  1VQM T;  4OGC A;  4DA4 A;  5CU8 A;  4ZC9 A;  4YBT A;  3JB9 F;  1BIA A;  5CQA A;  1NPP A;  3CCE A;  1QVP A;  5EWH A;  4YYN A;  4MR5 A;  3LLR A;  1JB0 E;  4X34 A;  4QUU A;  1UEB A;  2MAM A;  5CUA A;  3JCM W;  2FB7 A;  1VQP T;  4MML A;  5CR2 A;  2LTO A;  3S6W A;  3MO8 A;  4J0S A;  1VIE A;  4TT6 A;  5ENJ A;  3A8G B;  3CPW A;  4YYI A;  5HQ6 A;  5KTW A;  3RER A;  4Q5W A;  3BDL A;  3FDR A;  4QSQ A;  5CKE A;  2RHX A;  2OSS A;  1K8A U;  3OY9 A;  1QP3 A;  4XQ3 A;  4NL2 A;  3MP1 A;  1WUG A;  2P0P A;  4XUB A;  5DKH A;  3EAE A;  3MEU A;  2LQK A;  5CUB A;  4E7L A;  4N4F A;  4HXP A;  4HKE A;  3CME A;  4C5I A;  2RJC A;  2KAF A;  5L96 A;  2M16 A;  1BI3 A;  1G5V A;  5EWV A;  4L59 A;  5KHM A;  3O37 A;  3JCM g;  1M90 U;  3INZ A;  4LDV A;  3ME9 A;  2JNG A;  1Q7Y U;  5LVR A;  5FG4 A;  3G71 A;  3VYG A;  4LDY A;  1QP2 A;  4LD9 K;  5DYX A;  3DKM A;  4C92 C;  5J39 A;  4BHW A;  4NRA A;  2DAQ A;  2K3X A;  3D7C A;  2DPP B;  3BY7 A;  2KK4 A;  3CCR T;  4UIY A;  4N4G A;  1X75 C;  2X4J A;  4A9K A;  5GAO q;  4KT0 E;  2K5F A;  5BT4 A;  5C4Q A;  4ZGE B;  5FE6 A;  3OYE A;  3OYI A;  4II1 A;  2GF7 A;  4MR3 A;  3GF5 A;  5DFB A;  3MQM A;  2KDS A;  5EK9 A;  3X26 B;  3M4Y A;  1VQ9 A;  3U5K A;  4C8Q F;  5EPS A;  4RG2 A;  3CC2 A;  4BUG A;  4QQ6 A;  5CVI A;  5IGL A;  3CCR A;  5CKD A;  1OZ2 A;  3M57 A;  3OYM A;  2QDY B;  1ZQ1 A;  5D3P A;  5HLS A;  4X2I A;  3QSU A;  2LX9 A;  5F5Z A;  5KU3 A;  3MP6 A;  1OYX A;  4M75 D;  2ZCF B;  3WVD B;  4LR6 A;  2RFJ A;  3OMG A;  4M78 G;  2E64 A;  2KY9 A;  4OP0 A;  4M75 G;  3CCJ T;  3GOX A;  3PMT A;  3CC7 T;  3O8V A;  4C8Q B;  5FE3 A;  4ZGJ B;  1D3B B;  2PUO B;  5DKC A;  5F61 A;  4UC4 A;  5CQX A;  5GAM d;  5FE7 A;  3JAM E;  4HBW A;  1YHQ T;  2HQE A;  2LVM A;  3HRT A;  1M5Q 1;  4IR5 A;  1WQ7 A;  2XDB A;  3ZBD A;  3JCM X;  3S3M A;  4A53 A;  4LYW A;  3L2Z A;  2QEX T;  2XKO C;  3CBP A;  3TRE A;  2DIG A;  2YYN A;  5LUU A;  5J26 A;  3O34 A;  3LXJ A;  5GAM g;  4M77 G;  3CCU A;  4OF1 A;  4O7E A;  3I56 T;  2XDD A;  4CFL A;  1NZ9 A;  4QSV A;  4HT9 A;  2OTL A;  3LWH A;  2E7N A;  4LYS A;  3UDC A;  4VUB A;  2LCL A;  4RG8 A;  4QZS A;  3M54 A;  2L8D A;  4XTX A;  4C5E A;  3X20 B;  3G7Z A;  4IOO A;  5ENH A;  4A4F A;  5E3G A;  2DJZ A;  1TH7 A;  2M1H A;  5A5P A;  3OQ5 A;  4A9N A;  4QSS A;  2B8A A;  5HCL A;  5D6Y A;  4ELZ C;  1VQL T;  2DZC A;  2R10 A;  4YAX A;  4XTZ A;  3TCJ A;  3I56 A;  3A8O B;  3K2J A;  4BE1 A;  3LX7 A;  4QVD A;  5A5Q A;  4A9F A;  3HKS A;  4O78 A;  1VQ8 T;  3CCJ A;  3T9N A;  5IID A;  5F2P A;  2WSE E;  1KC8 U;  5FH7 A;  4LZ2 A;  1N8R U;  4LC2 A;  5CQ4 A;  4C5H A;  1W2B S;  5GAO r;  3N5B B;  3DLM A;  3LW5 E;  2VGN A;  2E6N A;  4QQG A;  3I55 T;  5CQ7 A;  4J83 A;  3Q1J A;  4TU6 A;  5EIS A;  3CCL A;  4M7A D;  5I7Y A;  3JCM d;  1KC8 C;  4PJO F;  5EPB A;  4A9I A;  4M77 F;  1R8O B;  1YJW T;  5I40 A;  3S91 A;  5FE4 A;  5AD2 A;  5K29 A;  2G4A A;  5C6S A;  5FU7 C;  2L3R A;  1UGP B;  3LQI A;  3LQJ A;  5FDZ A;  3CCL T;  2LNV A;  1UGR B;  3CCQ T;  2RS9 B;  1M1G A;  3NTK A;  4TS8 A;  3JCM c;  5LJ5 d;  4O77 A;  3JCM h;  2K4Y A;  2QA4 T;  5LJ5 h;  4C8Q C;  4A9J A;  4UYD A;  3VJP A;  1KHC A;  4EMK B;  5EGU A;  5FFW A;  3ASK A;  2KMT A;  2RHI A;  2XDP A;  4QSP A;  5LJ3 g;  3QZS A;  5C85 A;  4C8Q E;  4CL9 A;  2BUD A;  3U5M A;  5F62 A;  3CCM A;  3X28 B;  5H1V A;  1WUM A;  3J81 E;  2E65 A;  4HBX A;  2PU9 B;  2RK1 A;  1NPR A;  1X0J A;  4KBM B;  1YJ9 A;  4PJO D;  5D3H A;  4OB2 B;  5HFQ A;  1XOV A;  5D7X A;  2X4X A;  4YYJ A;  3LH0 A;  2OUO A;  3UVD A;  4PJO G;  1BIB A;  4BW3 A;  4A4E A;  5CAI A;  1PSE A;  2G3R A;  5EU1 A;  5E9I A;  5GAO l;  4A9O A;  4EDU A;  5ENE A;  3QXE B;  5AD3 A;  5HFR A;  2DXT A;  2CKK A;  3UVX A;  4QNS A;  3C95 A;  2RHZ A;  5F1L A;  2DWW A;  2M9U A;  5I29 A;  2D82 A;  4NXJ A;  2CZ1 B;  5GAO m;  3MB4 A;  4Z93 A;  2WSC E;  4JLG A;  1O75 A;  5II1 A;  4C66 A;  2AHJ B;  1UGQ B;  5FG5 A;  1Q82 U;  5M9O A;  5HK0 A;  3M58 A;  4O72 A;  4N0A C;  2OTJ T;  3P1C A;  2ZPG B;  5DY7 A;  5KTU A;  4C92 D;  5FE0 A;  4OB1 B;  4J0R A;  2QQB A;  4NYW A;  4XU3 A;  3U5N A;  4TZ8 A;  1B34 A;  2PUK B;  3MEW A;  4ZW1 A;  5EA1 A;  5CQ3 A;  1Q86 U;  3JB9 J;  4QYL A;  2XHC A;  3M53 A;  1M8V A;  4C8Q D;  2E1H A;  3OMC A;  5I83 A;  4EPC A;  4F7U B;  2A7Y A;  4QST A;  2XU8 A;  1F68 A;  1Y07 A;  2R58 A;  3UV4 A;  5LJ1 A;  5FE1 A;  4UYG A;  5GAM e;  3QKJ A;  5GAN j;  4M77 D;  2RJD A;  4LDF A;  2RK2 A;  4M78 F;  5KE3 A;  5I80 A;  2EKO A;  5LVQ A;  5DW1 A;  2D0Q B;  5D6W A;  5D3R A;  3O36 A;  2O4X B;  1EQF A;  4UIX A;  4M75 F;  1W2B A;  2XD0 A;  1OI1 A;  4UYE A;  5ACY A;  4O71 A;  5CCA A;  4NQN A;  3UT1 A;  4IUV A;  4PJO C;  1I8F A;  3SWN A;  4M7A C;  4C0Z A;  4FL6 A;  2RI2 A;  1ZBX A;  4XY8 A;  5EQ1 A;  4XTY A;  5FLX E;  4JS4 A;  5C87 A;  3H8Z A;  3DB4 A;  4A9M A;  4A4H A;  1VQ6 A;  1JJ2 S;  1Y96 B;  5GMK e;  5A82 A;  4HCB A;  3J80 E;  1N9R A;  5E74 A;  3A5Z B;  4BY6 C;  2EJF A;  5G4R A;  3JB9 G;  3C94 A;  3TU4 K;  2D9T A;  4O7F A;  2JOY A;  3V7S A;  5D3J A;  3PTA A;  3CCQ A;  1Y7X A;  4YH3 A;  3JB9 I;  1KQS A;  2E7O A;  2YW5 A;  3O33 A;  4EMG A;  4HCC A;  4DOW A;  2RI3 A;  2E12 A;  3LWI A;  5FRN A;  2FHD A;  5BT3 A;  4PL6 A;  5DFC A;  2PQW A;  2EYQ A;  5F60 A;  2DKG A;  3L2Q A;  3JVM A;  4N0A A;  3CPW S;  4M7A E;  2LSP B;  3FJP A;  3P8D A;  4ZGD B;  4E96 A;  5D3T A;  3SFM A;  4BE2 A;  3E1S A;  3MUK A;  3L2V A;  2VV5 A;  5FE2 A;  2EAY A;  2GCX A;  3LGF A;  5FH6 A;  3R6O A;  5FE9 A;  1WQW A;  4V2S A;  4QVC A;  3G0L A;  4MEN A;  4PJO E;  2KQW A;  4XTV A;  5I21 A;  4CUS A;  3QBY A;  1VQP A;  3URG A;  2XK0 A;  5GAN 8;  3QUI A;  2LT1 A;  5FU6 C;  4PY6 A;  1VQ7 T;  3OYH A;  2F5K A;  4BI3 A;  2D9E A;  5LKX A;  3CXC S;  2PVO B;  1DJ7 B;  4DOV A;  5E3D A;  3ZFJ A;  1E6I A;  5LJ3 h;  4NYV A;  5F3A A;  2Y4Y A;  3L42 A;  5E73 A;  1VQM A;  1VQ5 T;  1VQ4 A;  4NR9 A;  3JCM b;  2DD4 A;  2YRV A;  1M1K C;  5CUD A;  2LDM A;  1VQ9 T;  5HEL A;  3HSB A;  2DVE A;  1WPY A;  3I3J A;  3MET A;  2QQR A;  4CRI A;  3P8B B;  5L8T A;  3RKY A;  3M55 A;  4M7D A;  5E9L A;  4XUA A;  4NL3 A;  5A5O A;  1PSF A;  3CBO A;  3PNW C;  4F7U F;  4KV4 A;  3VV0 A;  2DK3 A;  3PT9 A;  5EM3 A;  5F1H A;  4YYD A;  5ENG A;  2F6J A;  5CP5 A;  5GAN e;  5COI A;  1K73 U;  3OYN A;  4E7H A;  1M1K U;  2VC8 A;  4LDW A;  4PS5 A;  1VQ7 A;  4N4H A;  3X25 B;  4UIZ A;  5E0R A;  4C92 B;  4M78 D;  2KVQ G;  5G4S A;  2P0K A;  3NXB A;  4Y28 E;  5A2Q E;  4XTU A;  4Z6I A;  3CCV T;  2E6Z A;  1QVF A;  2R0V A;  2L84 A;  1ZS5 A;  5I2S A;  4JDS A;  4F7U E;  1YJN A;  4O7B A;  1LNX A;  4PNO A;  3OA6 A;  4RKU E;  2N9G A;  4OB0 B;  3A8L B;  4GPJ A;  3OW2 S;  4LDX A;  3L2W A;  3JVK A;  5CQ6 A;  4TTE A;  4YY6 A;  2ZPF B;  3J7A F;  3CCV A;  4IOQ A;  4M77 A;  5IGK A;  3SB2 A;  1K8A C;  4XK8 E;  4NR8 A;  3WXM B;  4YYH A;  5I7X A;  3NFC A;  4HA8 A;  2LT4 A;  4NR5 A;  4M7D E;  3HL8 A;  5CQT A;  4XU2 A;  2YQD A;  1KQS S;  3MB3 A;  2OTJ A;  5BT5 A;  3NTI A;  4HBV A;  4O75 A;  2DVS A;  3MHX A;  4QSX A;  1JSP B;  3RES A;  3LQH A;  5A5R A;  5LKZ A;  2EQM A;  1FX7 A;  4BJX A;  5DBM A;  3KBG A;  5D24 A;  2L89 A;  2XI9 A;  2ZPI B;  4NUC A;  5GAO p;  5FB1 A;  2GFU A;  3DLL A;  3JCM V;  3AQA A;  5HRX A;  4QVZ A;  2YEL A;  5DY9 A;  2X4Y A;  1RI0 A;  4YAB A;  5IGM A;  2ZGW A;  3VUZ A;  2EJ9 A;  1VUB A;  1M1F A;  3PMI A;  1VQK T;  5EV9 A;  2EFI A;  3U5P A;  3DWY A;  3QO3 A;  4IR6 A;  3HP9 A;  4QQD A;  4ZTF A;  3QDR B;  3PFS A;  2BKD N;  1YIT T;  5DYU A;  3CCU T;  3FRN A;  5DLO A;  2XG8 D;  1JM4 B;  5HKC A;  3HPW A;  2V8I A;  3OYY A;  2RA2 A;  5CUG A;  2E5Q A;  3ER0 A;  2WP1 A;  4C92 G;  3CCM T;  4M77 C;  1Q82 C;  4QC3 A;  4O6J A;  4X9D A;  3OYA A;  3QPH A;  1LJO A;  4C0D B;  3CC2 T;  2DIQ A;  2LC4 A;  2BIV A;  3OYJ A;  5D3L A;  5A0L A;  4XTW A;  3BW1 A;  3OYD A;  3JVL A;  4YK0 A;  5LJ2 A;  4FIB A;  5I89 A;  1Y71 A;  2EIF A;  1Q81 C;  2DVR A;  1GXI E;  5DM7 R;  5I1Q A;  3OSV A;  3LJW A;  3MEV A;  5EWC A;  2GFA A;  4XY9 A;  3P8H A;  1N6A A;  5FU7 B;  4PCE A;  3FIF A;  2RHU A;  5DYC A;  4PJO A;  4NYX A;  2LRQ A;  3OS1 A;  2E70 A;  5CKH A;  3BFM A;  5E9V A;  2E41 A;  2KSS A;  4M7D D;  4WIV A;  3MUL A;  4P5N A;  3HFO A;  2H60 A;  1BI0 A;  4GY5 A;  4BDY A;  3G0J A;  3V8J A;  3LGL A;  4LRG A;  2JZ2 A;  3NTH A;  3CME T;  5D3S A;  4N3W A;  5C0M A;  4MEO A;  4D6W A;  4HXR A;  4B9X A;  2ZPH B;  1O9S A;  3JCM Q;  1VQN A;  4KUI A;  4YYG A;  2DO3 A;  4FT4 A;  5I88 A;  2MWP A;  2EQK A;  3OYL A;  3EFR A;  1EIF A;  4O5V A;  4YH4 A;  2DXB A;  4DQ2 A;  4MZP A;  1HXD A;  2RJE A;  2E3K A;  5L8U A;  4QR3 A;  4MEQ A;  5DKD A;  5AME A;  5ENI A;  4C92 A;  3GPL A;  2DVV A;  4N4I A;  2FL7 A;  1V29 B;  2JTM A;  4B9W A;  4PJO B;  4HXM A;  3RMS A;  5ENB A;  2DTH A;  3OB9 A;  3LYI A;  2DTI A;  5LJ3 j;  5IBN A;  2LQ8 A;  1Q7Y C;  3CC4 A;  3P1E A;  2R0Y A;  1H64 1;  4MDW A;  5AYF A;  4IUQ A;  1I81 A;  5AMF A;  2GQV A;  3SD4 A;  4HXN A;  3CMA T;  4KUD K;  2F6N A;  5FRM A;  4NR7 A;  2A3L A;  1VQ4 T;  1U8R A;  5FE8 A;  4C0F A;  4LZS A;  3JB9 H;  5F63 A;  4KUL A;  2YLC A;  2LCC A;  4OMF B;  4RVR A;  4A4G A;  2CS7 A;  4NRC A;  5GAM h;  2HBP A;  2X4W A;  5FU6 B;  3L2R A;  5LJ5 g;  4M7A A;  4MR6 A;  5H85 A;  4M77 E;  3TEE A;  4QUT A;  2K5L A;  4J7I A;  1LOJ A;  3FLG A;  5A0G A;  5CKB A;  5IAY A;  5A5N A;  2I7K A;  2DTO A;  5CFW A;  2MJV B;  4UIW A;  5CZG A;  5GMK j;  2O01 E;  4XYA A;  3JCM J;  1IZ6 A;  3C4S A;  3V8K A;  4FLP A;  3UVY A;  1W4S A;  4MDX A;  2MWO A;  4YY4 A;  2M0O A;  3UPU A;  4CUQ A;  3HRS A;  4OGJ A;  5KO4 A;  1G3T A;  5E9M A;  3M56 A;  2DEQ A;  3GNG A;  3GP8 A;  1VQO A;  1YHQ A;  4RCC A;  1YJ9 T;  5CO7 A;  4A54 A;  1BI1 A;  4QSW A;  3CMA A;  4MEP A;  2DZ9 A;  1Y96 A;  2EWN A;  4A9H A;  4L6V 5;  5GAN d;  5DX4 A;  4YAD A;  1N9S A;  3FB9 A;  5D3N A;  2X35 A;  4ZN3 A;  2L5Q A;  4OUF A;  3VUB A;  3SVG A;  3V7C A;  4CUP A;  2L85 A;  1OZ3 A;  5F25 A;  1QVF S;  4ALG A;  5HJC A;  5E9Y A;  2RNY A;  1MHN A;  3JB9 D;  3PIO A;  5H1U A;  4NUD A;  4XAX B;  2CZ7 B;  3HMH A;  4HXK A;  4C0G A;  2QXF A;  4M7D G;  5KH6 A;  2FSA A;  3MEA A;  2QEX A;  4JRI A;  5ENF A;  3BDU A;  5GMK m;  4O7A A;  5A81 A;  4MZM A;  3JRZ A;  1K73 C;  5GAN 3;  3OS2 A;  1KD1 C;  5EWD A;  2JUF A;  1K9M U;  4J5Y A;  5DW2 A;  2DXU A;  5LJ3 e;  3VU3 C;  4XU0 A;  5J0D A;  5CQ8 A;  2WAC A;  3UV5 A;  1VQL A;  4HXS A;  3P5O A;  4RCB A;  3OYK A;  3RIR A;  3FEO A;  4NR6 A;  4QB3 A;  4E7J A;  3TLP A;  4EMK A;  2QTX A;  3QZ9 B;  2IG0 A;  4XU1 A;  2FYK A;  4WF2 A;  5GAM j;  4M75 A;  3ZEH A;  4BI8 B;  1I5L A;  1M4Z A;  4QC1 A;  1JJ2 A;  3C12 A;  3M5A A;  4M78 A;  3G4S T;  4BE0 A;  1YI2 A;  5GAN g;  4ALH A;  4KV1 A;  4QYD A;  1NJI U;  5II2 A;  5LL6 S;  3GG3 A;  4E7I A;  1VQO T;  2HQX A;  3ZYU A;  1M90 C;  4UIV A;  2I2L A;  5LJ5 f;  5FB0 A;  1FXX A;  1UGS B;  3RMQ A;  4O76 A;  2NLU A;  5CKF A;  3F70 A;  1WJS A;  2R0S A;  4Z6H A;  5A0D A;  4QY4 A;  3AHU A;  2Y4X A;  5DLX A;  4NQM A;  5HEN A;  4IR4 A;  3OBY A;  5KE2 A;  1IRE B;  4YAT A;  2D6F A;  5GMK l;  5L99 A;  1ZHI A;  4FM4 B;  4TYL A;  4NRB A;  5HQ7 A;  5GMK i;  3OYC A;  4QSR A;  2P0Q A;  4CI0 C;  2OTL T;  5DFD A;  5IG6 A;  4ELY C;  2RJF A;  5DLQ E;  4Z1S A;  4JRQ A;  5EI4 A;  4JUV A;  5GAN 7;  5JWM A;  5EG2 A;  4ZN1 A;  1VIF A;  4M75 C;  2QQ9 A;  5IT9 E;  3HRU A;  3A8H B;  2WSF E;  3RKW A;  4M75 B;  4EMK C;  2EQJ A;  3VKI A;  5A83 A;  2CGH A;  2MMP A;  2PVD B;  3OW2 A;  2OO1 A;  4MZT A;  1KQ1 A;  2Y90 A;  3RUX A;  2EJG A;  3JCM e;  1G3S A;  2RH2 A;  4C8Q G;  4O7C A;  3MCA B;  2DKW A;  5CTL A;  1JRI A;  2JN0 A;  3P1D A;  3L1A A;  1NE8 A;  2H3J A;  4O70 A;  2K2V A;  1Q86 C;  4JS5 A;  1N8R C;  1N72 A;  1BKB A;  3O35 A;  4OB3 B;  4MR4 A;  2HNI A;  3G6E T;  2YHT A;  5CQY A;  3M9Q A;  3RKX A;  3M59 A;  1X6O A;  3DAI A;  5DYA A;  3CEY A;  1I4K 1;  1YIT A;  4DON A;  5GMK h;  2DAT A;  4HCZ A;  5HK3 A;  5CS8 A;  1AHJ B;  4MMK A;  4HXL A;  1YIJ A;  3UVW A;  5J3B A;  2ZPE B;  3E9F A;  2P4T A;  4FSX A;  3PGG A;  4A9L A;  5A5S A;  2ZZD A;  3QYH B;  3CXC A;  5LJ5 j;  4IKF A;  3V7R A;  3FKM X;  1BI2 A;  4BAC A;  1YJW A;  2KTB B;  5ENC A;  3A8M B;  5CUE A;  5KCO A;  4KCX A;  1XQH A;  2V8K A;  4C92 E;  5FFY A;  4QW2 A;  5CUC A;  4JJN K;  4UYF A;  5D6X A;  3OSS C;  4NOY A;  1VQK A;  2C06 A;  1P92 A;  1UB4 A;  3Q2E A;  3QHS A;  4M7D C;  4UIT A;  4LYI A;  5FG6 A;  3SWN C;  5F36 A;  1VQN T;  5H1T A;  1FWZ A;  4Q0N A;  5FBX A;  5C89 A;  4F7U G;  5LJ3 f;  2QA4 A;  1N27 A;  2RO1 A;  3SWN B;  3WVE B;  3IU6 A;  4RMO A;  1X01 A;  3CC4 T;  4Y03 A;  3CC7 A;  4TU4 A;  5D0C A;  2L5E A;  5GAO n;  3QYG B;  1VQ8 A;  1QW1 A;  5FFV A;  3UW9 A;  4OVA A;  3CBM A;  4LZR A;  4ATO A;  3GNF B;  4BD3 A;  4E47 A;  1KD1 U;  3U5O A;  4YBS A;  4R55 A;  3JVJ A;  2R5A A;  3H6Z A;  5GAN 4;  4Q0O A;  2K5I A;  1YIJ T;  3SVF A;  4LDU A;  4IR3 A;  1S72 A;  4BW2 A;  4IUP A;  3HMF A;  3KXT A;  4EMH A;  2F5T X;  2K3Y A;  5HM0 A;  4YYM A;  3HME A;  1D3B A;  2GRC A;  3HHT B;  3EFS A;  1WJR A;  2VXF A;  1HK9 A;  4PLI A;  2HAX A;  2RI5 A;  3UWN A;  5LKT A;  2DVQ A;  4OGI A;  4QR4 A;  4CLB A;  4L5G A;  5GAN h;  4PLL A;  2F69 A;  2E10 A;  5HQ5 A;  1WJQ A;  5FRO A;  4Z02 A;  3QG1 A;  4F3I A;  4J6Y A;  2MF2 A;  4M7D B;  5A85 A;  3QJY A;  4ME7 A;  5IGN A;  3JCM P;  5CQ5 A;  4CUT A;  5KCH A;  1MGQ A;  3U5J A;  2FVU A;  4QBM A;  2VXE A;  4IOR A;  3G71 T;  2YEM A;  3MXF A;  4WHW A;  2K57 A;  5CGP A;  4TVR A;  1QVG A;  2QI2 A;  3JSC A;  1KG1 A;  5E9K A;  5JI8 A;  4UYF B;  5DLZ A;  1WNL A;  2RNX A;  4CFK A;  3QZ5 B;  3P1F A;  5HRW A;  3X24 B;  5D25 A;  5EIC A;  3PIP A;  3G6E A;  4X9C A;  2RNW A;  4NUE A;  4IUU A;  5EPR A;  5FH8 A;  1JBM A;  3SVH A;  3SDZ A;  5HEM A;  4BW4 A;  4BDZ A;  2RO0 A;  3CCS A;  4C5G A;  3CCE T;  3OYF A;  4J3I A;  2RHY A;  4IUT A;  4JRK A;  3QJ6 A;  3S3O A;  2IVW A;  3OBW A;  4QEU A;  1BYM A;  4BY6 B;  4E7K A;  2QQS A;  3E9G A;  4TT2 A;  2VYT A;  3HFN A;  3DB3 A;  4HT8 A;  3G4S A;  1YI2 T;  5CY9 A;  1WGS A;  5EP7 A;  1VQ6 T;  4J6W A;  4J7F A;  1XTD A;  4YBM A;  3ONI A;  4TQN A;  5EWW A;  5GAN f;  1VQ5 A;  5LJ3 d;  5LJ5 e;  4UYH A;  2NXB A;  4CUU A;  5GAN 6;  1S72 T;  3U5L A;  4C92 F;  3E19 A;  3RCW A;  3QII A;  5IN1 A;  3MP8 A;  5LKU A;  1KQ2 A;  4HXO A;  4GLK A;  1KHI A;  4C67 A;  3GLX A;  1RL2 A;  4M78 C;  3CD6 A;  5CK9 A;  2MI6 A;  5EVA A;  4QEV A;  5L97 A;  2R57 A;  4PKC C;  1NJI C;  4M78 B;  5E7D A;  2YEK A;  3VYH B;  5C8G A;  4Y91 A;  5I2M A;  4M7A B;  5TCM A;  4M78 E;  4R56 A;  3OS0 A;  4J1P A;  2RD1 A;  4NS5 A;  4J6X A;  4M75 E;  5KTX A;  4PKL A;  3I55 A;  4M7A G;  2CZ6 B;  3S3N A;  5TB6 A;  1SSF A;  2YLB A;  3CD6 T;  4QR5 A;  2VGM A;  5C7N A;  2CZ0 B;  3S92 A;  2WP2 A;  4NR4 A;  4A4K A;  4FU6 A;  4YTL A;  5GAN 5;  5L98 A;  4IUR A;  5ETD A;  3OS5 A;  3QZT A;  3UV2 A;  5GAN 2;  3FC3 A;  1G3Y A;  1K9M C;  4UIU A;  2PVG B;  4Z1Q A;  5CRM A;  4TZ2 A;  4CUR A;  2JTF A;  2DXC A;  3OYB A;  5L8R E;  4LD6 A;  2YDW A;  2JVV A;  5ETB A;  5FE5 A;  3KUF A;  3JCM f;  4A9E A;  4M77 B;  2VUB A;  5HY6 A;  3Q2F A;  2HD0 A;  4HBY A;  5A7C A;  1B34 B;  2DD5 A;  4OGE A;  4JRP A;  5GAM f;  4C0D C;  4O74 A;  2QQA A;  3CCS T;  3V8L A;  3OYG A;  2I8N A;  2OAU A;  2CYZ B;  4YYK A;  2EQU A;  1G3W A;  4PCI A;  5HRV A;  1H3Z A;  4QSU A;  1Q81 U;  4M7A F;  1U1T A;  4M7D F;  1XNI A;  4ZTJ A;  5LJ0 A;  1YJN T;  3M4G A;  3AAD A;  1YBY A;  4FT2 A;  4PTB A;  2RB6 A;  4WHU A;  4F7U A;  3QZV A;  3L2U A;  2RI7 A;  3CPF A;  5CRZ A;  4ZQL A;  2RM4 A;  4TT4 A;  3IU5 A;  2XIC A;  2XID A;  4J8O A;  4BI4 A;  1U1S A;  5CIU A;  2R5M A;  4QEW A;  4BB7 A;  4AKN A;  4JLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...