4N4HA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.1k36me3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
188
Chain Sequence
b'QEMGTYLRFIVSRMKERAIDLVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 66
structure length 188
sequence length 209
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4hA02
2EQJA 5LKZA 2L85A 5CTLA 5D25A 3MO8A 5L99A 2LRQA 2QQRA 4YADA 3UVDA 4NYXA 4AKNA 1XNIA 2OUOA 4TZ8A 4IR4A 4FL6A 5FRNA 3O33A 2IG0A 5E3DA 4CFKA 5COIA 3NTIA 3I3JA 5E3GA 4O7FA 4XUBA 2X4XA 5F1HA 5HENA 4O70A 5D3HA 3OQ5A 3MULA 2I8NA 3O37A 5A5PA 2DVRA 1JSPB 3L2RA 4KV4A 4BW2A 5FG5A 4YC9A 3OS0A 4LR6A 5CUGA 4X2IA 5KH6A 4QSTA 4YYJA 5CU8A 5L98A 4A9IA 2M0OA 1N27A 3MP1A 3Q1JA 4BW1A 2R5AA 4A4EA 5EWDA 3PFSA 3IU5A 2DIGA 4NQNA 4C67A 5C89A 2YEMA 5BT5A 2FHDA 5ENCA 4CURA 5A82A 1E6IA 3U5NA 5L96A 4TYLA 4QSQA 4XY9A 3JVLA 2R58A 5LVRA 4QSRA 5C8GA 4UYGA 4IUQA 2L5EA 3OYGA 3OYIA 3S92A 5IGNA 3QIIA 4CL9A 4IUPA 5D26A 4YY6A 5CGPA 2NLUA 4BACA 4IOOA 2PQWA 5D0CA 4PLLA 4N4HA 3K2JA 3BDLA 3QBYA 5ETDA 1X0JA 2OSSA 4CUPA 4L59A 4O75A 5F36A 4IKFA 5A5RA 4CUTA 5F2PA 1H3ZA 2G4AA 5A83A 3SVFA 5A5OA 4QZSA 5K29A 4YYHA 2WACA 2D9TA 2DVQA 4CRIA 4QC3A 3UWNA 2KTBB 4E7JA 4NRBA 4FLPA 4QR3A 4QNSA 4OGIA 4TT2A 2EFIA 4TS8A 4HXNA 3JVKA 2L3RA 5FE4A 5HJCA 4FU6A 4UIYA 5HFRA 3QJ6A 2X35A 4PY6A 4HBVA 5FBXA 5DYXA 2LCCA 2G3RA 1G5VA 4YATA 5EWVA 4UITA 2EQKA 4Q5WA 3LXJA 3OS2A 5HRVA 4BDZA 1WJRA 1ZS5A 4YYKA 4ZW1A 4NYVA 4A9NA 3QZSA 3MP8A 5EPRA 5FE9A 3ZEHA 5CZGA 2BIVA 3OYAA 3Q2FA 4LD6A 4PLIA 5C6SA 4RVRA 5IN1A 3ONIA 4WIVA 2F6NA 2K3XA 3OY9A 3P1DA 3DB4A 3S3NA 5CUEA 2GFUA 5CUBA 5DKCA 5F61A 2RJEA 4LZSA 1N72A 2RHUA 4BHWA 3OMGA 3LGLA 5KTUA 4UIWA 4BE0A 2R10A 5FDZA 5F3AA 4MEQA 4O71A 1OI1A 4XY8A 3DB3A 2YDWA 5F1LA 4UIXA 5HQ6A 3NTHA 4YAXA 3JVJA 4QR5A 5HRWA 4QSVA 4MENA 4MR6A 4XYAA 4YBTA 5EVAA 3O34A 4HXKA 5FG6A 5ETBA 2RJCA 5KU3A 5CFWA 5IGLA 4QYDA 5CQAA 4IUUA 2E7NA 4QUTA 5HCLA 5KTWA 4YYIA 4QVZA 3MXFA 4BD3A 4C5IA 4IR6A 5FH7A 5HELA 5CY9A 3O8VA 5D6XA 3OYHA 4ALHA 4LYIA 2JTFA 4B9WA 4QY4A 3CEYA 2RI3A 5EU1A 2RHZA 5KCOA 4QYLA 5FE0A 5ENGA 3G0JA 4TU6A 4QC1A 4TQNA 2F6JA 5FE2A 3PNWC 4KV1A 3HMFA 4UC4A 4NR5A 5KO4A 4YYNA 2I7KA 5IAYA 5HFQA 5EPSA 3LLRA 5DFBA 4ZTJA 4X34A 5H1UA 5DLZA 2O4XA 4NUCA 2P0KA 5FH6A 4N4GA 4YYGA 3P5OA 2FSAA 5CQ4A 4QSUA 2L89A 4OGJA 2LSPB 4NS5A 5EICA 5ENEA 4NR6A 4PL6A 5EM3A 4TZ2A 3UVWA 2LVMA 1OZ2A 4YABA 4PS5A 4CLBA 3MUKA 5ENFA 3OYJA 5A5NA 3LQIA 5H1VA 3LGFA 5CUDA 4UYFB 2E3KA 4WHUA 5IG6A 4O74A 4N4IA 2RNWA 4QQDA 5D3LA 4BDYA 4HXSA 2RO1A 5CQ3A 4HXLA 5DY7A 4ZQLA 5A81A 4HXOA 4Q0NA 5DYCA 5FE5A 3S3OA 3LH0A 5LJ1A 4E7LA 2K3YA 3L2UA 5E73A 2LTOA 4A9OA 2F5KA 3PMIA 4CFLA 2WP1A 4NYWA 5F62A 3L2WA 3M9QA 4N3WA 3UW9A 1WUGA 3OA6A 4EDUA 5G4RA 4BJXA 3DWYA 5FE8A 5CQ8A 4LYSA 2WP2A 3LX7A 4QSSA 3NXBA 5HEMA 2BKDN 2X4YA 4TT4A 5EQ1A 4IUVA 5M9OA 5FFVA 3LYIA 4TT6A 5KTXA 1WJQA 5EA1A 2DKWA 4QUUA 4F3IA 2RO0A 3MEUA 3QZVA 3P8HA 5J39A 5D3SA 3F70A 3U5OA 2E5QA 4YK0A 5FFYA 3E9GA 3FDRA 5H1TA 2YYNA 4A4FA 5I80A 3O35A 5CPEA 1RI0A 2DVVA 5FG4A 4B9XA 3PMTA 5I7YA 4C5EA 4IUTA 2RJDA 2D82A 2DIQA 2XK0A 4HBYA 4PKLA 5I29A 3H8ZA 5J0DA 3UT1A 2RFJA 4A9KA 4MR3A 5DBMA 3O36A 5EP7A 5EWHA 4IR3A 5E9YA 2RS9B 4QQGA 4A4GA 2EQUA 3S3MA 5JI8A 5BT4A 2MJVB 2RHIA 1WGSA 2YW5A 5ENIA 5CQ5A 5DLXA 4BW4A 1WUMA 4LDFA 4DONA 1F68A 3MEVA 4A4HA 4XUAA 2R0YA 4NQMA 3U5KA 4Z1SA 3P1EA 1KHCA 4O78A 4QB3A 3P1FA 5D3TA 2RNYA 2RHXA 4ZC9A 3DAIA 3FKMX 4Z93A 5H85A 4QEWA 5DYUA 3S6WA 4A9LA 5I86A 4O76A 3ZYUA 5IGKA 4Z6HA 4O77A 5KE2A 3NTKA 5HQ5A 3JVMA 2YRVA 2NXBA 3QKJA 4Z6IA 5D3JA 3UV5A 4QSXA 3MP6A 3MEWA 4QSPA 2N9GA 5FH8A 5DYAA 5ENJA 3P8DA 5F63A 3LQHA 4A9MA 5ACYA 2GRCA 5C85A 2DWWA 2M1HA 3ME9A 4KCXA 5DFDA 4CUUA 5E74A 5ENBA 3HMEA 5HRXA 4HBXA 5CRZA 5EPBA 5L97A 2BUDA 3KUFA 4E96A 4NRAA 2MWPA 5D3PA 4QSWA 4HXRA 5A5QA 2DAQA 3META 5A85A 3SD4A 4BE1A 5FFWA 3OYBA 2MWOA 5D24A 3OB9A 3U5MA 3OYNA 5D6WA 5HLSA 3TLPA 4O7BA 5DFCA 4MR4A 4A9EA 3SVGA 4A9JA 3MB3A 5C4QA 2M16A 5E9KA 4GPJA 5F25A 5IBNA 5I40A 5LKXA 4MR5A 4II1A 2OO1A 4HXMA 4E7IA 3U5JA 4YY4A 4QBMA 5FB1A 5CP5A 2E6NA 2CKKA 4MEPA 4HCZA 5DW2A 4OUFA 5EISA 5E7DA 3SVHA 4BE2A 5HM0A 5I1QA 5LUUA 4IOQA 3OS1A 5E9IA 4Y03A 4PCIA 3OMCA 5KHMA 5FE6A 4ZTFA 1EQFA 2HQXA 5C87A 4QQ6A 4TU4A 5ENHA 4RG2A 5KE3A 2RNXA 5EI4A 2RI2A 3OYMA 2E7OA 4A9HA 5HQ7A 3U5LA 4GY5A 2B8AA 4HXPA 5I83A 5E0RA 5FB0A 5C0MA 4NR8A 5I7XA 5CUCA 4NXJA 2L8DA 3H6ZA 2L84A 3E9FA 4Q0OA 4QR4A 3L2QA 2YELA 4UYFA 5LJ2A 4NUEA 4NRCA 5DKDA 2JZ2A 2DATA 2XDPA 5C7NA 2RHYA 3UVXA 3DLMA 4J3IA 5BT3A 4PCEA 4C66A 4LZ2A 4UIZA 4E7KA 5EWWA 4PTBA 3C4SA 5D3RA 5LKUA 2GF7A 2R0SA 3RCWA 5I88A 5AD2A 2R0VA 3MQMA 5D3NA 5A7CA 5E9LA 3EAEA 4NR4A 4YBMA 4Z02A 3GG3A 4NUDA 4UYDA 1SSFA 5F60A 5DKHA 4UIUA 5CUAA 3FLGA 5II1A 3OYDA 5FROA 5AD3A 5CRMA 5CIUA 2LDMA 4O72A 4LC2A 3AQAA 5A5SA 1WJSA 4O7CA 4O7AA 4LRGA 3FC3A 5FE7A 5FE1A 4OVAA 5LVQA 5I89A 5EWCA 4N4FA 1MHNA 5DX4A 4WHWA 5J26A 3LJWA 5E9MA 4QW2A 2RI7A 4QEVA 5D7XA 3L2VA 4YBSA 5L8UA 3D7CA 5FRMA 2YQDA 2VYTA 2R57A 1OYXA 4IURA 3OYFA 4NR7A 4LZRA 3P1CA 3MEAA 3UV4A 1OZ3A 4J0SA 4MEOA 5TB6A 1JM4B 5IIDA 3OYKA 3OYEA 5JWMA 5AMEA 4C5GA 2X4WA 2D9EA 4TTEA 5DW1A 3HMHA 4J1PA 4E7HA 4NR9A 2EQMA 5LJ0A 4UYEA 4YYMA 4YH3A 5E9VA 2DVSA 3G0LA 5II2A 2RI5A 4UIVA 5FE3A 4J0RA 4CUQA 2R5MA 3OYCA 4ALGA 5KCHA 2RJFA 3S91A 3UV2A 4CUSA 3OYLA 3UVYA 4BW3A 3L42A 5F5ZA 4Z1QA 3LQJA 3MB4A 4A9FA 3FEOA 3IU6A 2YEKA 3Q2EA 5TCMA 5CS8A 4HBWA 4YH4A 5EGUA 5G4SA 3ASKA 4O7EA 2HQEA 2GFAA 5L8TA 2H60A 4IORA 4LYWA 4C5HA 5D6YA 5CQ7A 5EK9A 4YYDA 5IGMA 5AMFA 5LKTA 2O4XB 4QEUA 3AADA 3QZTA 4IR5A 3U5PA 5CQTA 5EV9A 2EKOA 3GOXA 4UYHA 2QQSA 5CQ6A
chains in the Genus database with same CATH superfamily
4RTWA 2CZ0B 1XQHA 4M7AE 4KBMB 3RBBB 4RG8A 4AKNA 2ABLA 4IR4A 1CKAA 3VUBA 5E3DA 2LQ8A 2DF6A 1AD5A 1N5ZA 3VYHB 4XUBA 2X4XA 4DQ2A 5F1HA 2DILA 1KSWA 3CCQT 2I8NA 5GMKj 5A5PA 1JSPB 2DVRA 2OI3A 2L3QA 3TREA 1GFCA 3RKYA 4X2IA 1YJNA 4QSTA 2PZ1A 2KK4A 5L98A 2HKNA 1VQMQ 2VASA 3CCEQ 1T0JA 1YJWA 2M0YA 4BW1A 2R5AA 1BI1A 3PFSA 4C67A 2YEMA 1NM7A 2FHDA 5ENCA 4M77F 4JZ4A 4TYLA 4XY9A 2R58A 4BUGA 4QSRA 5C8GA 2HEQA 4IUQA 5LJ5h 3OYIA 3OYGA 4AFUC 2F69A 3CCUA 3SB2A 4YY6A 2NLUA 2PQWA 1ZBJA 4ZGJB 3BDLA 4AFQC 1AZEA 5ETDA 3HHTB 4L59A 2BZYA 1ZHIA 5A5RA 2NUTB 1QCFA 2G4AA 4HCCA 2OTJA 4C8QD 1N8RC 3EGXB 1IHVA 2QEXT 1LVKA 4XU1A 4CRIA 4QC3A 3C95A 2EVRA 5LJ3g 4NRBA 4LDXA 4QR3A 3G4ST 4M78A 5CCAA 1K9MC 1YI2T 4KH1B 1WQ7A 2DL3A 2JN0A 2SEMA 4PY6A 1AOJA 2RF0A 1H92A 5FBXA 2LCCA 3X28B 2HL3A 1U8RA 4UITA 4Q5WA 1D1AA 2D8HA 3ZBDA 4KUIA 4ZW1A 2YUOA 4A9NA 3MP8A 4JLGA 2SRCA 4MMLA 3TSWA 2LQWA 1MMDA 1VQLQ 5C6SA 3CCJT 3L1AA 1RAGB 2K3XA 4KH0B 4ZGEB 3DB4A 3S3NA 4OB0B 3I56T 2GFUA 2GTJA 5DKCA 1OV3A 3H41A 1W2BP 4J9DA 3JB9J 2RHUA 4DEYA 3LGLA 1RAIB 3CCLQ 1VQ4T 4BE0A 5F3AA 2FRYA 4XY8A 3ZL7C 4AFZC 1Q82R 3DB3A 5F1LA 2Y4XA 4MZPA 4PJOD 2KY9A 5CKHA 4DA4A 4FW2A 1NYFA 3RKWA 5GAMf 5ETBA 2D6FA 4HVWA 5CFWA 2DD5A 5CQAA 4M77D 3MXFA 3ZFJA 2AHJB 3X24B 1RUWA 5D6XA 2KI7A 4ALHA 4J6YA 3I9QA 2ZPGB 1WXTA 4LYIA 1X27A 1JU5C 1WHLA 2XDDA 2DTOA 2BTTA 4GLMA 4M78F 5KCOA 2K5IA 3CC2A 1WNLA 1IGUA 1NEGA 4RTZA 1QMCA 3DLLA 1A0NB 4ZTJA 1YJNQ 3QZ9B 4LE9A 4NUCA 2EQIA 2LX7A 5KYXB 5GANf 4N4GA 4YYGA 4JDSA 5GAOq 2DJQA 2P4TA 4J9CA 1YIJT 1FX7A 2EKHA 4PL6A 5EICA 3UVWA 3ERRA 2HQHA 2LVMA 4FM4B 4YABA 2LJ0A 2XI9A 1I5LA 2CP5A 1IXDA 3MUKA 1UE9A 5ENFA 3LQIA 5GAOr 5CUDA 4UYFB 4WHUA 1VQ9T 3CC7A 2RNWA 3D7SB 4FSSA 2JVVA 4ZQLA 1Q7YR 2A0FB 2FO0A 1VQNT 1AEYA 4E7LA 5E73A 4A9OA 2F5KA 2COWA 3L2WA 1WUGA 2LNHB 3OA6A 4EDUA 2P84A 2E3IA 5CQ8A 4LYSA 1YITA 4AT1B 3CXCP 1UECA 1OX8A 4QSSA 1RAHB 7AT1B 4OGEA 2X4YA 1M4ZA 5M9OA 3EG9B 1D1CA 3PIOA 5KTXA 4O6JA 4Y92A 1WYXA 5EA1A 1SSHA 4QUUA 4F3IA 2PUOB 3MEUA 2GQVA 5LJ5j 2K5LA 3HFOA 5J39A 5D3SA 3F70A 4KT0E 1GL5A 2E5QA 1I8FA 4M75C 2E6ZA 4YK0A 5FFYA 2FPFA 2NUTA 5H1TA 3OYYA 2RMOA 1ZKRA 1QVGP 1RI0A 1X75C 2EYYA 3EGXA 5KYWB 3PMTA 5I7YA 4C5EA 2DIQA 3UT1A 4MR3A 5E9YA 3M4GA 2V8KA 1EZZB 2QK0A 1X69A 5DLXA 3JCMf 4XUAA 2R0YA 1KHCA 4QB3A 3CMEA 2V1RA 2B86A 5GAOm 2KVQG 2KXCA 3DAIA 2DL7A 5GAN7 4O76A 2WSFE 1HSQA 4QKUA 1OPKA 4Z6HA 2P4RA 2XU8A 4Z6IA 2CT4A 1N9RA 3MEWA 4QSPA 1U3OA 2N9GA 4M75B 4JS4A 1ZUKA 1MNDA 2EIFA 2Y4YA 3LQHA 3HRSA 4ESRA 4C92E 2DWWA 1UFFA 1Y07A 4GLKA 1PRMC 2JXBA 1QWFA 5E74A 1S72A 3HMEA 2CZ7B 1GRIA 1GXIE 5HRXA 4HBXA 2BUDA 5CK9A 1JJ2A 2XDBA 4F7UB 4QSWA 3L2ZA 5A5QA 3META 3CCMQ 3OB9A 5D6WA 2VVKA 5DFCA 2NUZA 4MR4A 1QKWA 3EH2A 4M75G 3QO3A 4BI8B 5I40A 5F25A 4II1A 4RCCA 3U5JA 4QBMA 3UPUA 1X6OA 3EG1A 3GPLA 5LJ3e 3PIPA 4CC2A 3VS6A 4WF2A 5EISA 2AK5A 2H3EB 2K6DA 4M7DD 3J80E 4X1VA 4PJNA 4XTZA 3REBB 4F7UG 2D8JA 4J7FA 3OS1A 5E9IA 2O88A 3RDVA 3OMCA 5KHMA 5FE6A 1I1JA 2FRWA 5C87A 3JV3A 5KE3A 5KYXA 3WVEB 8AT1B 3OS5A 4OGCA 2BZXA 1M1KR 4JJBA 4OB1B 4J9BA 1I0CA 1GFDA 3C12A 4X9DA 5E0RA 4ELYC 5C0MA 3G1JA 4NR8A 3CMAA 1KD1C 3E9FA 1VQ6A 4UYFA 5LJ2A 2QAZA 4NUEA 4NRCA 4TVRA 1Q7YU 1KQSP 2XDPA 1D0YA 3VS3A 3O5ZA 5CO7A 2YRDA 4PCEA 2J6OA 3JB9G 4LD9K 2V26A 1ABQA 5EWWA 4PTBA 5HCKA 2GF7A 2GNCA 2AT1B 2ED0A 5I88A 2KT8A 3MQMA 5D3NA 5A7CA 4NR4A 3CCRT 5KYUB 2E12A 2PVOB 5CUAA 3RMSA 5II1A 1YHQA 4J83A 2FEIA 1OPLA 5AD3A 1ZSGA 2NYSA 1RI9A 5CIUA 1VQPT 2ZPFB 1F1BB 3EG9A 1PHTA 1VQOA 5A5SA 1RACB 1IB8A 1E6GA 4LRGA 4ANJA 1U1TA 5FE7A 1QVPA 4N4FA 3VS1A 4Z8AA 2K3BA 4M7AD 1T3LA 2EJNA 3LJWA 2VWFA 2E70A 3QDRB 4FCYA 5KYWA 2YQDA 2VYTA 1OYXA 1W2BS 4IURA 2JJ9A 1PG5B 1RADB 3MEAA 1QQJA 3C0CA 2K7AA 1YJ9A 5DW1A 3HMHA 4J1PA 3CD6T 4E7HA 1J3TA 4KRTA 5LJ0A 4YYMA 2L0AA 3G0LA 5II2A 4MZMA 1QVFP 4CUQA 4IIMA 1XOVA 2W10A 2HBPA 3UVYA 1QLYA 4FYXB 3LQJA 3MB4A 2JS2A 4A9FA 4M78E 2YEKA 2YWWA 3I55Q 4MMKA 2KRMA 4FYYB 4PKCC 1G2BA 2GFAA 4IORA 1X43A 4C5HA 5CQ7A 1UHCA 5HK0A 4M75A 2A7YA 3QZTA 3V8KA 2QA4Q 4IR5A 1K1ZA 4CC3A 4UYHA 1B7TA 5FWBA 5LKZA 2K5FA 1AT1B 4AKHA 1UDLA 4YADA 3CCVA 3UVDA 1XNIA 2VXEA 4FL6A 2JUFA 4F7UA 4EIKA 4CFKA 2DEQA 3EGDB 4HCKA 3NTIA 3I3JA 1M2VB 4BI3A 1KHIA 2JNGA 3R6OA 3MULA 1RLQC 4KV4A 5FG5A 5A0DA 4YC9A 3OS0A 4OF1A 5CUGA 3EG2A 5GAN8 4A9IA 1FMVA 4K11A 1K73C 2DIGA 4B6MA 5C89A 1WZOA 1VQMA 1JQQA 5BT5A 1WIEA 3OBYA 3CCEA 3E19A 1NPPA 4CURA 3U5NA 1KC8C 3JCMP 1ARKA 4QSQA 2DZ9A 1Y0MA 2KYMA 5IHIA 5LVRA 1Q81R 4M4ZA 2QASA 3QSUA 4UYGA 3IQLA 1BB9A 3FIFA 1M1KU 5IGNA 1M5Q1 1VOMA 3QIIA 3UA7A 4BACA 1SPKA 4PLLA 4N4HA 3K2JA 2EJGA 1X0JA 4PJJA 1H8KA 4J9IA 4O75A 2DO3A 2DXCA 2ZZDA 2O9SA 4CUTA 4NOYA 5F2PA 3WVDB 5A5OA 4QZSA 3QHSA 5K29A 3MHXA 1MV3A 2WACA 1WHHA 5GJWB 1AWWA 4FLPA 2LNVA 4QNSA 4TT2A 1TU0B 3V7CA 4EMKC 4HXNA 4BI4A 2L3RA 4PFOA 3M55A 4FU6A 4AG1C 1QVGS 4LN2A 2RNAA 1TXQA 1BKBA 4F7UF 3M0UA 3JCMQ 1X6BA 5DYXA 2IPOB 4HKEA 1VQ8T 4OMPA 1G5VA 1K8AR 3G71T 4YYKA 4OB2B 1N8RR 3EFOB 2Y90A 4LXCA 2PVGB 1VA7A 5FE9A 1TG0A 5CZGA 5GAN4 1K9MR 2XHCA 4LD6A 3RUXA 2DFUA 1YJ9Q 1IZ6A 1MUZA 2YHTA 2KDSA 1KQ2A 2JMCA 2A28A 1VQKQ 1G3SA 1P92A 5CUEA 2JTMA 5F61A 2LQNA 4LZSA 1N72A 5I22A 3OMGA 2KT1A 5KTUA 3UDCA 4MEQA 4O71A 4JRQA 5A2QE 1I4K1 4UIXA 3NTHA 2DTIA 2LC4A 3JVJA 3CCLA 1M3AA 4EMKB 5EVAA 3O34A 4RMOA 4MDXA 2CYZB 4QYDA 1D09B 4IUUA 3EFSA 4QUTA 5HCLA 5KTWA 4QVZA 3CPWP 3PE0A 4ZN1A 5CY9A 1YJWT 1VIFA 2RHZA 2X9HA 3T9NA 1HD3A 2KRNA 3M0PA 4QYLA 3NHNA 5ENGA 3H0FA 4TQNA 3U23A 9ATCB 2GGRA 2EJFA 3VYGA 1D0ZA 2NUPB 4NR5A 1ZA1B 2JT4A 3JCMJ 2QQAA 4JRIA 4X34A 3CCUT 4QT7A 1W2BA 3TQ7P 5I2MA 5FH6A 3P5OA 3EG0A 5CQ4A 2RQRA 2L89A 5GAMg 2OTJT 1VUBA 1TUDA 4RTYA 1KG1A 5LJ5f 4PS5A 1TTHB 3EGDA 1ACMB 1SEMA 5H1VA 1M2VA 5IG6A 5D3LA 2RO1A 5CQ3A 5A81A 1VYUA 4HXOA 2DJZA 1K0SA 5LJ1A 4DEXA 2K3YA 2LTOA 1KQSS 2WP1A 4NYWA 5F62A 4F14A 3JCMc 4N3WA 3UW9A 2D1XA 5G4RA 1Q81U 5HKCA 3G6ET 1M30A 2COZA 3FJ5A 5GANg 4P5NA 3LX7A 4TT4A 5EQ1A 3CCVQ 1BIBA 2FZKB 2RO0A 1PM3A 2MI6A 3HPWA 4C92D 3CBPA 5FWCA 1JJ2S 2DERA 1JO8A 5CPEA 1TWBA 1NBEB 4B9XA 2ZPEB 2FZCB 2D82A 4HBYA 5KYUA 3KXTA 4A9KA 2C0TA 3VU3C 5IH2A 4IR3A 2JS0A 4GBQA 2EQUA 5BT4A 2MJVB 2IIMA 3OW2P 2RHIA 1K8AU 1WGSA 1C0MA 3CPFA 3CC4Q 4BW4A 1WUMA 2K2MA 3P1EA 2LCSA 3CC2T 5FW9A 3EFOA 5D3TA 3CXCA 1KQ1A 1K9MU 2ESWA 1O75A 4C0GA 1WXBA 1X01A 3S6WA 1ZQ1A 2DE0X 2QEXA 4O77A 4D6WA 1IO6A 3JVMA 2CT3A 2DZCA 2RD1A 4QSXA 3MP6A 2J6KA 2CP0A 5ENJA 3P8DA 3VV0A 5DM7R 1QVGA 4R56A 3HL8A 4RKUE 2GRCA 4D8DA 1WPYA 3ME9A 5DFDA 5ENBA 5L97A 5EPBA 3KUFA 4EMKA 4NRAA 3TU4K 3CC7T 5CKBA 4HXRA 3LW5E 5A85A 2LJ1A 2DBMA 1Y96B 1AZGB 3JCMg 2MWOA 2H3JA 2VB6A 1UEBA 4JPBW 4O7BA 3UA6A 3CCMA 3CCSQ 4JRKA 4AMCA 4D8KA 5KYYB 4J9FA 3MB3A 5DLQE 5E9KA 4GPJA 1WQWA 2OO1A 2OAWA 2CS7A 2ROLA 5CP5A 2E6NA 1B3QA 1YITT 4MEPA 2A3LA 5DW2A 1HXDA 2EW3A 2MPXC 2NUPA 3SVHA 3PGGA 4Y03A 2DLPA 4ZTFA 1FMKA 4N0AC 1VQ5Q 4TU4A 5ENHA 4RG2A 1PNJA 3HRTA 5LJ3f 2E7OA 2NWMA 2ZAEA 5IXBA 1TUCA 3GP8A 2B8AA 4HXPA 5FB0A 5AT1B 2W0ZA 2YLCA 3H6ZA 5GAN2 2L84A 5DLOA 5LJ3h 2KE9A 2CZ6B 2DATA 4FIBA 3CCQQ 1QCNA 1BCOA 2A36A 2IVWA 2QGFB 2EPDA 4M75E 5BT3A 2YSQA 5GMKm 1HYOA 4KGVB 4OP0A 5LKUA 3CMET 2MOXA 2R0SA 5CQXA 1KD1R 2OAUA 3EAEA 1YIJA 3VS4A 2OTLT 4NUDA 4F7UE 2DVEA 4LDWA 1AWOA 2CREA 1O9SA 4M78D 3OYDA 2LDMA 4JS5A 4O72A 5GAOl 3QJYA 3AQAA 1JEGA 2YLBA 2ZCFB 4XU2A 3TSZA 3FJPA 4OVAA 5I89A 1S72T 4WHWA 1V29B 3ER0A 5J26A 1UGQB 1NYGA 4QEVA 5D7XA 1K9AA 4YTLA 3L2VA 2QEXQ 1KQSA 3D7CA 2HD0A 5DY9A 2R57A 2L5QA 2E4HA 3G4SQ 2KMTA 1OZ3A 1YI2Q 5TB6A 5IIDA 1QWEA 3X25B 5AMEA 2JW4A 4C5GA 2X4WA 1VQ7T 2D9EA 2A37A 5GAMe 1LJOA 2DXUA 1YP5A 1Q82U 3EFRA 4YH3A 2DVSA 2RI5A 5FE3A 2DPPB 4J0RA 1R8OB 2R5MA 2ZPIB 4ALGA 1U06A 4Z89A 3CPWS 2X4JA 2RJFA 2QDLA 4BW3A 3FB9A 3L42A 4RCBA 1QP2A 3FEOA 1YCSB 1C6VX 4Y91A 1TUGB 3CCJQ 5TCMA 4A53A 5CS8A 2EYXA 5G4SA 3ASKA 4O7EA 4JZ3A 3I56Q 5L8TA 4C8QC 1V76A 4YYDA 5AMFA 4JJDA 4QEUA 4AKIA 3AADA 3I55A 5IHNA 3U5PA 4CC4B 3GOXA 2AIRB 1VQ4Q 3QJ6A 2QQSA 5CQ6A 2EQJA 2CH4A 2L85A 4WCIA 2QA4A 3VKGA 3MO8A 1G3WA 2BZ8A 5GANe 2J05A 2MK5A 4HVVA 3CMAT 4DBRA 2DMOA 1VQ6T 3OSSC 1UGRB 5FRNA 2IG0A 2P0QA 1Y96A 5E3GA 4O7FA 1KIKA 4JLIA 1WLPB 4DBFA 3AHUA 4IIOA 3JAME 4XTYA 5KYYA 4OMNA 2FG0A 4YYJA 2M0OA 1N27A 4DOVA 3MP1A 3DKMA 3Q1JA 1NJIR 2CP2A 5EWDA 3IU5A 2DNUA 4NQNA 4F17A 1YHQT 3PTAA 2LT1A 5CVIA 4A63B 5L96A 1JBMA 1YBYA 2JTEA 4C8QB 4FW1A 4PJOC 2KYBA 1VQOT 1WA7A 2O01E 2L5EA 1YCYA 3S92A 2ZGWA 4IUPA 1FYNA 5D26A 1K73R 3EGUA 5CGPA 1YIJQ 4IOOA 3M0TA 5D0CA 2LCLA 3QBYA 4M77C 1NE8A 1GBQA 4CUPA 2O9VA 2RA2A 1KC8R 2F1LA 4J6WA 1VQ9Q 2H8HA 4YYHA 2DL5A 2D9TA 4E7JA 1I81A 2KTBB 5LJ3j 2EFIA 4OGIA 4C8QG 4CC7A 3JVKA 5FE4A 5HJCA 1VQNQ 5HFRA 2CGHA 2DBKA 2X35A 1KD1U 4HT9A 4HBVA 2ATCB 1CSKA 2WSEE 4YATA 1ZLMA 2EQKA 4FYVB 3OS2A 5HRVA 1FMWA 1NEBA 4NYVA 2FPEA 3QZSA 3OW2S 2HL5C 3JCMe 2AZSA 3OYAA 5CKFA 2GTOA 3UATA 4PJOB 4N0AA 3THKA 4NL3A 3VRZA 1YWPA 4RVRA 3ONIA 4WIVA 3M53A 4OMFB 1GBRA 3LH5A 4RTTA 2DVJA 4M77B 5CUBA 1UGSB 1V1CA 3REAB 1VQKA 5FDZA 3HRUA 3CCVT 1OI1A 3QYGB 5GMKi 2L3SA 5HQ6A 1TOVA 3QG1A 1M3BA 3JB9I 4MR6A 4YBTA 1X2QA 2RJCA 4EMGA 5FG6A 4PJOG 1RAFB 1WHJA 5GAN5 5KU3A 3X26B 5GAN6 2K2VA 2E7NA 2PU9B 4YYIA 3BW1A 2PNIA 4BD3A 4C5IA 1K0XA 5I11A 3QPHA 3O8VA 2DYIA 4M77G 2MAMA 3ULRB 3CEYA 2KAFA 2RI3A 3N5BB 3A8LB 3CCET 1Q86R 2AZVA 3G0JA 1BBZA 1QCOA 1IHWA 5FE2A 2QDYB 3PNWC 4KV1A 4UC4A 2I7KA 2X3WD 4ZNXA 2HBWA 3MKDA 1M90R 3A8GB 3UF4A 5KYNA 3GF5A 3NFCA 1UB4A 2XKOC 2FSAA 5GAMd 4PJMA 4RUGA 6AT1B 4QSUA 4OMOA 1VYVA 2LSPB 5ENEA 4LDUA 2HSEB 1GCQC 1M1KC 5EM3A 4TZ2A 1OZ2A 4CLBA 3OYJA 3LGFA 1OQKA 1QW1A 4J8OA 3CPWA 4O74A 4N4IA 1LCKA 4QQDA 2DYBA 4HXSA 1ZA2B 3BFMA 4QVDA 4HXLA 4E7ZA 1TSFA 1MV0B 1NJIU 2HKQB 4LUDA 5CKDA 4ME7A 4EPCA 3L2UA 1R0BG 1UGVA 3CXCS 3PMIA 3M9QA 1WFWA 2DL8A 3I5SA 2I0NA 2O31A 4LUEA 3M56A 4BJXA 4M75F 3OBWA 5GANd 4C8QA 2WP2A 3NXBA 1K73U 5HEMA 3NMZC 4IUVA 4AG2C 1H3HA 2DL4A 2P0PA 1VQLT 4PJLA 4TT6A 4Y28E 3EG3A 4XQ3A 2DKWA 4XU3A 1EIFA 1OULA 1KC8U 1GCPA 2Z0WA 2VUBA 4HA8A 3OSVA 2YYNA 4A4FA 5I80A 3CCLT 3E1SA 2DVVA 1KJWA 2QGGA 3SHWA 8ATCB 1YN8A 4WTOB 4PKLA 1JXMA 3H8ZA 2C0IA 5CQYA 1UHFA 2RFJA 3D1DA 2DRKA 2EGCA 2FL7A 5DBMA 5CR2A 4QQGA 5EP7A 4HCBA 2RS9B 3JB9H 5AYFA 4M7DC 3S3MA 5JI8A 2X51A 2O2OA 2DXBA 4X9CA 2FB7A 5ENIA 4PNOA 4A4HA 4DONA 1F68A 3MEVA 3U5KA 4Z1SA 1Y71A 3CCRQ 5HK3A 2RNYA 3JB9F 3CC4A 2RHXA 3KBGA 4Z93A 5H85A 1I07A 5EC7A 4PJOA 5DYUA 5I86A 5GMKe 1VQPQ 3ZYUA 2CUDA 5IGKA 2DX1A 3NTKA 5HQ5A 2XD0A 2YRVA 4A54A 3QKJA 2K9GA 3M5AA 4LDYA 3CBOA 3TVTA 1YJNT 1XTDA 4M77A 3HFNA 2GCXA 4C8QF 3MPUB 3QWXX 1VQ8A 4KGZB 2M1HA 2PUKB 4KCXA 3G71A 2D0QB 3SWNC 1UUEA 2E1HA 1IRXA 5CRZA 5D3PA 5GJVB 2L3PA 4LNPA 4R55A 3JCMd 2A08A 3SD4A 3OW2A 4XTUA 4M7DB 1OEBA 3OYBA 2BE9B 2RM4A 1T0HA 2EGEA 4M75D 2XG8D 3U5MA 5HLSA 2HMAA 3CD6Q 3QDFA 4Z88A 1Q86U 2RQTA 2M16A 2KROA 5LKXA 1H641 3MJXA 4HXMA 3CCSA 5FB1A 2CKKA 3QYHB 4FYWB 2RQUA 4OUFA 1M90U 2MYSA 1M27C 4F04B 1N6AA 2G6FX 4BY6C 5LUUA 4M7AC 4M7DG 1RAEB 1PKTA 2YRCA 2HQXA 4QQ6A 1D3BB 1Q81C 3GNFB 3V7SA 5EI4A 2RI2A 2RB6A 4PJOF 1UJYA 3VRYA 3OYMA 4A9HA 2YUQA 3U5LA 4GY5A 1D1BA 1VQ5A 1M2OA 3SWNB 4ZN3A 2LX9A 2D0NA 2DA9A 2VV5A 5I83A 1VYTA 3TEEA 3A8OB 3PVQA 4Q0OA 2VXFA 3L2QA 3VS5A 2YELA 2V8JA 4E6RA 1AWXA 1OU9A 1WHMA 3JB9D 2JZ2A 4J9HA 4XTWA 2E10A 2KQWA 2KR3A 3SFMA 1JXOA 3DLMA 2KBTA 4LZ2A 1SF9A 4UIZA 3CCQA 1EX4A 5D3RA 4RTXA 1HK9A 1SRLA 5AD2A 2R0VA 1T3SA 3JCMb 3GG3A 1K8AC 2C06A 4BY6B 1KK7A 2ZPHB 3BY7A 4M7AB 1M8MA 3H9NA 1K4US 3HKSA 4PFPA 1W1FA 5CRMA 4J5YA 2PVDB 4LC2A 2FVUA 1WHGA 3M0RA 2FYKA 4O7AA 1WXUA 1N8RU 2MF2A 1GCQA 5LVQA 3BE3A 5EWCA 1MHNA 1PCXA 2CDTA 4QW2A 2RI7A 1B34B 2F2VA 2DM1A 1Y57A 4M7AG 4NR7A 3P1CA 3UV4A 3G6EA 4MEOA 1JRIA 1JM4B 1QVFS 4VUBA 3CCMT 4ZGDB 5JWMA 2AKLA 3G4SA 1VQ8Q 1YI2A 2KEAA 3G7ZA 4NR9A 3G71Q 3CBMA 5E9VA 2DTHA 4UIVA 2LZ6B 2E3HA 3S91A 3UV2A 1W4SA 1YFNA 4JJCA 3EHRA 5IT9E 5F5ZA 4Z1QA 1BU1A 3IU6A 3Q2EA 3JCMX 4YH4A 2HQEA 4LYWA 4MZTA 3X20B 5LKTA 4XTVA 2O4XB 3CCJA 1OOTA 5GAMh 5CQTA 1M1FA 3I56A 2HZYA 5CTLA 5D25A 2E64A 5L99A 2LRQA 2KXDA 2RQWA 1VQ4A 4HT8A 2QQRA 3J7AF 4NYXA 3FRNA 2OUOA 4TZ8A 2V1QA 2QQ9A 3O33A 4OMQA 5COIA 4M7DA 3M59A 2FPDA 3M54A 5HENA 4O70A 5D3HA 3OQ5A 5LJ5e 1NLOC 2QXFA 1YJWQ 3O37A 3L2RA 4BW2A 3A1PA 5FU6C 4LR6A 5KH6A 4J9EA 5CU8A 2F2WA 5A0LA 4C0ZA 4A4EA 5GMKl 2M02A 4J6XA 5GANh 5L8RE 1LPLA 3GIBA 5A82A 1E6IA 1NLPC 3CCUQ 2EYQA 2JM8A 3JVLA 1HJDA 3RNJA 2QQBA 4BB7A 1D3BA 2J6FA 1X6GA 1G3TA 1LNXA 4CL9A 1R77A 2RQVA 3HTRA 3NPFA 1WHKA 1PKSA 4MDWA 3SWNA 2OTJQ 2DRMA 2OSSA 5F36A 4IKFA 3RMQA 3J81E 1XJWB 1H3ZA 2MCNA 3A8HB 5A83A 3SVFA 5FU7C 2DVQA 1BK2A 3UWNA 3QXEB 4HVUA 4TS8A 5FU6B 3JCMV 4E2FB 3INZA 4J7IA 1VQ9A 2OJ2A 4UIYA 3RESA 4XK8E 1PUOA 2G3RA 3QUIA 1PD0A 4FT4A 1VQNA 5EWVA 3BDUA 4M7DF 3LXJA 4BDZA 5D7UA 1WJRA 3VJPA 1ZS5A 3D1BA 2ENMA 3SDZA 2LMJA 2RK2A 5EPRA 2CP6A 5GAN3 4CI0C 2LQKA 3ZEHA 3G6EQ 4EMHA 4M7AA 2BIVA 3AT1B 2CH4W 1Q82C 4PK4A 3EHQA 3Q2FA 4PLIA 1R0CB 4HXJA 1KFZA 2J06A 2X3XD 3I5RA 2XMFA 1PWTA 5IN1A 2F6NA 3OY9A 3I55T 3P1DA 3M0QA 2DEUA 4E7SA 2HSPA 2ROTA 2RJEA 2QA4T 4BHWA 1QKXA 3NGPA 3I35A 4UIWA 3M4YA 2R10A 5I21A 2LT4A 1B34A 2YDWA 2YXYA 2OTLA 5FU7B 2E65A 4YAXA 5HRWA 4QR5A 4QSVA 4MENA 4XYAA 4C8QE 4JJNK 3JCMh 4AI6A 2JM9A 4HXKA 3VKIA 2E5KA 4JUVA 5IGLA 1UG1A 2DK3A 1N9SA 1BYMA 4E47A 1MMGA 2K79A 4DBHA 3LWIA 2EYZA 4IR6A 5FH7A 5HELA 1LOJA 3OYHA 2DXTA 3CC2Q 2JTFA 4B9WA 2GQIA 4QY4A 3RKXA 4JRPA 2YUNA 4C0DC 5EU1A 5FE0A 4ORZA 4TU6A 4QC1A 4C92C 2F6JA 1RL2A 3HMFA 5KO4A 4YYNA 5IAYA 5HFQA 1MNEA 5EPSA 3LLRA 5DFBA 4R0KA 3LWHA 1U5SA 1YNZA 1PC0A 4KGXB 5H1UA 1E7OA 1S1NA 5J3BA 1BI0A 5DLZA 1PRLC 2O4XA 1VQ7A 4M7AF 2P0KA 1QVFA 2I2LA 1Q7YC 3WXMB 2QI2A 4OGJA 5GAMj 1RLPC 3M58A 5EG2A 4NS5A 4NR6A 3MCAB 3CC7Q 1AVZC 4PJOE 4QVCA 5A5NA 1W6XA 2EBPA 2DETA 3HP9A 3A98A 3C94A 3JCMW 2E3KA 1ZUYA 2LJ3A 1ZSZC 2LP5A 4BDYA 3PT9A 4M77E 5DY7A 4LDVA 3QWYA 1DJ7B 4Q0NA 5DYCA 5FE5A 3JRZA 3S3OA 3LH0A 4C0DB 1BI2A 1M9SA 2HDAA 4XAXB 4XU0A 2CP7A 4CFLA 1ABOA 1M3CA 2CUBA 1E6HA 1Z9QA 3VS2A 1YITQ 2VGNA 4C92B 2C0OA 1FWZA 1MMAA 1AHJB 1CKBA 1SHFA 3DWYA 2GBQA 5FE8A 2KRSA 3GBQA 5GANj 1B07A 2WSCE 2BKDN 2J7IA 5FFVA 3LYIA 1WJQA 1YJ9T 2L2PA 5LJ5d 1MGQA 3QZVA 3P8HA 2M51A 2QTVA 3U5OA 2XIDA 1VQKT 2OX7A 3A5ZB 3E9GA 3FDRA 1BIAA 3O35A 2EGAA 1X2KA 4C92G 5FG4A 4DOWA 1Q95G 3HSBA 4IUTA 1ZSZB 2RJDA 3E2UA 2XK0A 2COYA 5I29A 5J0DA 4DBQA 1JJ2P 3O36A 5EWHA 2CZ1B 4A4GA 2K4YA 2K57A 1W70A 3CMEQ 4AKGA 2F2XA 3M57A 2YW5A 5CQ5A 1UJ0A 4LDFA 1EFNA 1ZUUA 4NQMA 2OTLQ 1TS9A 4O78A 2V8IA 3P1FA 2ZPBB 1BCMA 1BI3A 1IREB 2CSIA 1SRMA 1I5OB 4ZC9A 2F5TX 3P8BB 3FKMX 4C0FA 4QEWA 3CCRA 2PTKA 2QYZA 4A9LA 4RTVA 5FLXE 5KE2A 3PVLA 1QP3A 2NXBA 1VQPA 5D3JA 1IGQA 3EH1A 3UV5A 1JB0E 5FH8A 3SEMA 5DYAA 5F63A 5LL6S 1S72Q 4A9MA 5ACYA 1YWOA 5C85A 2CSQA 1NG2A 3A8MB 5IHKA 1VQMT 4CUUA 2ECZA 4OMMA 4E96A 2MWPA 4L6V5 1AWJA 2MIOA 2EWNA 2DAQA 5CAIA 1FXXA 4A4KA 5GMKh 4BE1A 2FZGB 5FFWA 1VQ7Q 5D24A 3V8JA 1M8VA 1G3YA 4NL2A 3OYNA 3QZ5B 3TLPA 4M78C 4A9EA 3SVGA 4A9JA 5C4QA 4L5GA 2YUPA 1ZBXA 5IBNA 4MR5A 3CD6A 1D0XA 4E7IA 4YY4A 2XICA 2VKNA 2VC8A 1NJIC 4HCZA 5CKEA 3VUZA 5E7DA 3TCJA 3RIRA 4BE2A 5HM0A 5I1QA 4IOQA 4O5VA 4PCIA 2BE7D 5I2SA 1EQFA 3RR6A 3JSCA 4KULA 2RPNA 2RNXA 1MMNA 2VGMA 5HQ7A 3H0IA 3CMAQ 3VKHA 1VQ6Q 2AKKA 4V2SA 4ELZC 2YT6A 5I7XA 5CUCA 4NXJA 2L8DA 1OX9A 1K76A 1NZ9A 2KNBB 2ED1A 4QR4A 4FT2A 4KUDK 1UTIA 4FSXA 5DKDA 1C1AA 2JMAA 5C7NA 1SKUB 3H0HA 2RHYA 4M78B 3UVXA 1G83A 4J3IA 5IXFA 2KSSA 3VS7A 4C66A 1UGPB 4E7KA 3C4SA 2MMPA 2YDLA 5LJ5g 3RCWA 3CC4T 5E9LA 2HCKA 4C92A 4YBMA 4Z02A 1YHQQ 2QTXA 1SHGA 4ATOA 1PSEA 4F16A 4J9GA 4UYDA 1SSFA 4OB3B 5F60A 2CP3A 3V8LA 1RAAB 5DKHA 4UIUA 3FLGA 5GAOn 4M7DE 5LJ3d 1M1GA 5FROA 1VQOQ 2HAXA 2KGTA 4M78G 2QG9B 3RERA 1WJSA 4O7CA 1Z9ZA 3URGA 5A0GA 1WDXA 3FC3A 1TH7A 2JOYA 2M9UA 1PSFA 5FE1A 5DX4A 1ZX6A 1PD1A 4PFZA 5E9MA 1NPRA 4RTUA 4YBSA 5L8UA 2DKGA 5FRMA 2HNIA 1ZSZA 4XTXA 1WI7A 3GNGA 1OU8A 5HY6A 3OYFA 4LZRA 2EYWA 4J0SA 2EJ9A 2DD4A 3OYKA 3OYEA 3M0SA 3CQTA 4OMLA 3KFVA 1VQLA 4TTEA 3GLXA 4AFSC 1WX6A 3V7RA 2EQMA 3CCST 3R6NA 4UYEA 1Y7XA 3VS0A 1U1SA 3OYCA 1SG5A 2EAYA 5KCHA 4CUSA 3OYLA 1RABB 1VIEA 1Q86C 4HBWA 1G8XA 5EGUA 2RN8A 4C92F 5GAOp 2H60A 5D6YA 5EK9A 5L23A 5IGMA 2RH2A 1M90C 2E41A 1VQ5T 5EV9A 2EKOA 5ECAA 2RK1A
chains in the Genus database with same CATH topology
2CZ0B 1XQHA 4M7AE 4KBMB 4RG8A 4AKNA 4IR4A 3VUBA 5E3DA 2LQ8A 3VYHB 4XUBA 2X4XA 4DQ2A 5F1HA 3CCQT 2I8NA 5GMKj 5A5PA 1JSPB 2DVRA 3TREA 3RKYA 4X2IA 1YJNA 4QSTA 2KK4A 5L98A 1YJWA 4BW1A 2R5AA 1BI1A 3PFSA 4C67A 2YEMA 2FHDA 5ENCA 4M77F 4TYLA 4XY9A 2R58A 4BUGA 4QSRA 5C8GA 4IUQA 5LJ5h 3OYIA 3OYGA 2F69A 3CCUA 3SB2A 4YY6A 2NLUA 2PQWA 4ZGJB 3BDLA 5ETDA 3HHTB 4L59A 1ZHIA 5A5RA 2G4AA 4HCCA 2OTJA 4C8QD 1N8RC 2QEXT 4XU1A 4CRIA 4QC3A 3C95A 5LJ3g 4NRBA 4LDXA 4QR3A 3G4ST 4M78A 5CCAA 1K9MC 1YI2T 1WQ7A 2JN0A 4PY6A 5FBXA 2LCCA 3X28B 1U8RA 4UITA 4Q5WA 3ZBDA 4KUIA 4ZW1A 4A9NA 3MP8A 4JLGA 4MMLA 5C6SA 3CCJT 3L1AA 2K3XA 4ZGEB 3DB4A 3S3NA 4OB0B 3I56T 2GFUA 5DKCA 3JB9J 2RHUA 3LGLA 1VQ4T 4BE0A 5F3AA 4XY8A 3DB3A 5F1LA 2Y4XA 4MZPA 4PJOD 2KY9A 5CKHA 4DA4A 3RKWA 5GAMf 5ETBA 2D6FA 5CFWA 2DD5A 5CQAA 4M77D 3MXFA 3ZFJA 2AHJB 3X24B 5D6XA 4ALHA 4J6YA 2ZPGB 4LYIA 2XDDA 2DTOA 4M78F 5KCOA 2K5IA 3CC2A 1WNLA 3DLLA 4ZTJA 3QZ9B 4NUCA 5GANf 4N4GA 4YYGA 4JDSA 5GAOq 2P4TA 1YIJT 1FX7A 4PL6A 5EICA 3UVWA 2LVMA 4FM4B 4YABA 2XI9A 1I5LA 3MUKA 5ENFA 3LQIA 5GAOr 5CUDA 4UYFB 4WHUA 1VQ9T 3CC7A 2RNWA 2JVVA 4ZQLA 1VQNT 4E7LA 5E73A 4A9OA 2F5KA 3L2WA 1WUGA 3OA6A 4EDUA 5CQ8A 4LYSA 1YITA 4QSSA 4OGEA 2X4YA 1M4ZA 5M9OA 3PIOA 5KTXA 4O6JA 5EA1A 4QUUA 4F3IA 2PUOB 3MEUA 2GQVA 5LJ5j 2K5LA 3HFOA 5J39A 5D3SA 3F70A 4KT0E 2E5QA 1I8FA 4M75C 2E6ZA 4YK0A 5FFYA 5H1TA 3OYYA 1RI0A 1X75C 3PMTA 5I7YA 4C5EA 2DIQA 3UT1A 4MR3A 5E9YA 3M4GA 2V8KA 5DLXA 3JCMf 4XUAA 2R0YA 1KHCA 4QB3A 3CMEA 5GAOm 2KVQG 3DAIA 5GAN7 4O76A 2WSFE 4Z6HA 2XU8A 4Z6IA 1N9RA 3MEWA 4QSPA 4M75B 2N9GA 4JS4A 2EIFA 2Y4YA 3LQHA 3HRSA 4C92E 2DWWA 1Y07A 4GLKA 5E74A 1S72A 3HMEA 2CZ7B 1GXIE 5HRXA 4HBXA 2BUDA 5CK9A 1JJ2A 2XDBA 4F7UB 4QSWA 3L2ZA 5A5QA 3META 3OB9A 5D6WA 5DFCA 4MR4A 4M75G 3QO3A 4BI8B 5I40A 5F25A 4II1A 4RCCA 3U5JA 4QBMA 3UPUA 1X6OA 3GPLA 5LJ3e 3PIPA 4WF2A 5EISA 4M7DD 3J80E 4XTZA 4F7UG 4J7FA 3OS1A 5E9IA 3OMCA 5KHMA 5FE6A 5C87A 5KE3A 3WVEB 3OS5A 4OGCA 4OB1B 3C12A 4X9DA 5E0RA 4ELYC 5C0MA 4NR8A 3CMAA 1KD1C 3E9FA 1VQ6A 4UYFA 5LJ2A 1Q7YU 4NUEA 4NRCA 4TVRA 2XDPA 5CO7A 3JB9G 4PCEA 4LD9K 5EWWA 4PTBA 2GF7A 5I88A 3MQMA 5D3NA 5A7CA 4NR4A 3CCRT 2E12A 2PVOB 5CUAA 3RMSA 5II1A 1YHQA 4J83A 5AD3A 5CIUA 1VQPT 2ZPFB 1VQOA 5A5SA 4LRGA 1U1TA 5FE7A 1QVPA 4N4FA 4M7AD 3LJWA 3QDRB 2E70A 2YQDA 2VYTA 1OYXA 1W2BS 4IURA 3MEAA 1YJ9A 5DW1A 3HMHA 4J1PA 3CD6T 4E7HA 5LJ0A 4YYMA 3G0LA 5II2A 4MZMA 4CUQA 1XOVA 2HBPA 3UVYA 3LQJA 3MB4A 4A9FA 4M78E 2YEKA 4MMKA 4PKCC 2GFAA 4IORA 4C5HA 5CQ7A 5HK0A 4M75A 2A7YA 3QZTA 3V8KA 4IR5A 4UYHA 5LKZA 2K5FA 4YADA 3CCVA 3UVDA 1XNIA 2VXEA 4FL6A 2JUFA 4F7UA 4CFKA 2DEQA 3NTIA 3I3JA 4BI3A 1KHIA 2JNGA 3R6OA 3MULA 4KV4A 5FG5A 5A0DA 4YC9A 3OS0A 4OF1A 5CUGA 5GAN8 4A9IA 1K73C 2DIGA 5C89A 1VQMA 3OBYA 5BT5A 3CCEA 3E19A 1NPPA 4CURA 3U5NA 1KC8C 3JCMP 4QSQA 2DZ9A 5LVRA 3QSUA 4UYGA 3FIFA 1M1KU 5IGNA 1M5Q1 3QIIA 4BACA 4PLLA 4N4HA 3K2JA 2EJGA 1X0JA 4O75A 2DO3A 2DXCA 2ZZDA 4CUTA 4NOYA 5F2PA 3WVDB 5A5OA 4QZSA 3QHSA 5K29A 3MHXA 2WACA 4FLPA 2LNVA 4QNSA 4TT2A 3V7CA 4EMKC 4HXNA 4BI4A 2L3RA 3M55A 4FU6A 1QVGS 1BKBA 4F7UF 3JCMQ 5DYXA 4HKEA 1VQ8T 1G5VA 3G71T 4YYKA 4OB2B 2Y90A 2PVGB 5FE9A 5CZGA 5GAN4 2XHCA 4LD6A 3RUXA 1IZ6A 2YHTA 2KDSA 1KQ2A 1G3SA 1P92A 5CUEA 2JTMA 5F61A 4LZSA 1N72A 3OMGA 3UDCA 5KTUA 4MEQA 4O71A 4JRQA 5A2QE 1I4K1 4UIXA 3NTHA 2DTIA 2LC4A 3JVJA 3CCLA 4EMKB 5EVAA 3O34A 4RMOA 4MDXA 2CYZB 4QYDA 4IUUA 3EFSA 4QUTA 5HCLA 5KTWA 4QVZA 4ZN1A 5CY9A 1YJWT 1VIFA 2RHZA 3T9NA 4QYLA 5ENGA 4TQNA 2EJFA 3VYGA 4NR5A 3JCMJ 2QQAA 4JRIA 4X34A 3CCUT 1W2BA 5I2MA 5FH6A 3P5OA 5CQ4A 2L89A 5GAMg 2OTJT 1VUBA 1KG1A 5LJ5f 4PS5A 5H1VA 5IG6A 5D3LA 2RO1A 5CQ3A 5A81A 4HXOA 2DJZA 5LJ1A 2K3YA 2LTOA 1KQSS 2WP1A 4NYWA 5F62A 3JCMc 4N3WA 3UW9A 5G4RA 1Q81U 5HKCA 3G6ET 5GANg 4P5NA 3LX7A 4TT4A 5EQ1A 1BIBA 2RO0A 2MI6A 3HPWA 4C92D 3CBPA 1JJ2S 5CPEA 4B9XA 2ZPEB 2D82A 4HBYA 3KXTA 4A9KA 3VU3C 4IR3A 2EQUA 5BT4A 2MJVB 1K8AU 2RHIA 1WGSA 3CPFA 4BW4A 1WUMA 3P1EA 3CC2T 5D3TA 3CXCA 1KQ1A 1K9MU 1O75A 4C0GA 1X01A 3S6WA 1ZQ1A 2QEXA 4O77A 4D6WA 3JVMA 2DZCA 2RD1A 4QSXA 3MP6A 5ENJA 3P8DA 3VV0A 5DM7R 1QVGA 4R56A 3HL8A 4RKUE 2GRCA 1WPYA 3ME9A 5DFDA 5ENBA 5L97A 5EPBA 3KUFA 4EMKA 4NRAA 3TU4K 3CC7T 5CKBA 4HXRA 3LW5E 5A85A 1Y96B 3JCMg 2MWOA 2H3JA 1UEBA 4O7BA 3CCMA 4JRKA 3MB3A 5DLQE 5E9KA 4GPJA 1WQWA 2OO1A 2CS7A 5CP5A 2E6NA 1YITT 4MEPA 2A3LA 5DW2A 1HXDA 3SVHA 3PGGA 4Y03A 4ZTFA 4N0AC 4TU4A 5ENHA 4RG2A 3HRTA 5LJ3f 2E7OA 3GP8A 2B8AA 4HXPA 5FB0A 3H6ZA 2YLCA 5GAN2 2L84A 5DLOA 5LJ3h 2CZ6B 2DATA 4FIBA 2IVWA 4M75E 5BT3A 5GMKm 4OP0A 5LKUA 3CMET 2R0SA 5CQXA 2OAUA 3EAEA 1YIJA 2OTLT 4NUDA 4F7UE 2DVEA 4LDWA 1O9SA 4M78D 3OYDA 2LDMA 4JS5A 4O72A 5GAOl 3QJYA 3AQAA 2YLBA 2ZCFB 4XU2A 3FJPA 4OVAA 5I89A 1S72T 4WHWA 1V29B 3ER0A 5J26A 1UGQB 4YTLA 4QEVA 5D7XA 3L2VA 1KQSA 3D7CA 2HD0A 5DY9A 2R57A 2L5QA 2KMTA 1OZ3A 5TB6A 5IIDA 3X25B 5AMEA 4C5GA 1VQ7T 2X4WA 2D9EA 5GAMe 1LJOA 2DXUA 1Q82U 3EFRA 4YH3A 2DVSA 2RI5A 5FE3A 2DPPB 4J0RA 1R8OB 2R5MA 2ZPIB 4ALGA 3CPWS 2X4JA 2RJFA 4BW3A 3FB9A 3L42A 4RCBA 1QP2A 3FEOA 4Y91A 5TCMA 4A53A 5CS8A 5G4SA 3ASKA 4O7EA 5L8TA 4C8QC 4YYDA 5AMFA 4QEUA 3AADA 3I55A 3U5PA 3GOXA 3QJ6A 2QQSA 5CQ6A 2EQJA 2L85A 2QA4A 3MO8A 1G3WA 5GANe 3CMAT 1VQ6T 3OSSC 1UGRB 5FRNA 2IG0A 2P0QA 1Y96A 5E3GA 4O7FA 4JLIA 3AHUA 3JAME 4XTYA 4YYJA 2M0OA 1N27A 4DOVA 3MP1A 3DKMA 3Q1JA 5EWDA 3IU5A 4NQNA 1YHQT 3PTAA 2LT1A 5CVIA 5L96A 1JBMA 1YBYA 4C8QB 4PJOC 1VQOT 2O01E 2L5EA 1YCYA 3S92A 2ZGWA 4IUPA 5D26A 5CGPA 4IOOA 5D0CA 2LCLA 3QBYA 4M77C 1NE8A 4CUPA 2RA2A 4J6WA 4YYHA 2D9TA 4E7JA 1I81A 2KTBB 5LJ3j 2EFIA 4OGIA 4C8QG 3JVKA 5FE4A 5HJCA 5HFRA 2CGHA 2X35A 1KD1U 4HT9A 4HBVA 2WSEE 4YATA 2EQKA 3OS2A 5HRVA 4NYVA 3QZSA 3OW2S 3JCMe 3OYAA 5CKFA 4PJOB 4N0AA 4NL3A 4RVRA 3ONIA 4WIVA 3M53A 4OMFB 4M77B 5CUBA 1UGSB 1VQKA 5FDZA 3HRUA 3CCVT 1OI1A 3QYGB 5GMKi 5HQ6A 3QG1A 3JB9I 4MR6A 4YBTA 2RJCA 4EMGA 5FG6A 4PJOG 5GAN5 5KU3A 3X26B 5GAN6 2K2VA 2E7NA 2PU9B 4YYIA 3BW1A 4BD3A 4C5IA 3QPHA 3O8VA 4M77G 2MAMA 3CEYA 2KAFA 2RI3A 3N5BB 3A8LB 3CCET 3G0JA 5FE2A 2QDYB 3PNWC 4KV1A 4UC4A 2I7KA 3A8GB 3GF5A 3NFCA 1UB4A 2XKOC 2FSAA 5GAMd 4QSUA 4LDUA 2LSPB 5ENEA 1M1KC 5EM3A 4TZ2A 1OZ2A 4CLBA 3OYJA 3LGFA 1QW1A 3CPWA 4J8OA 4O74A 4N4IA 4QQDA 4HXSA 3BFMA 4QVDA 4HXLA 1NJIU 5CKDA 4ME7A 4EPCA 3L2UA 3CXCS 3PMIA 3M9QA 3M56A 4BJXA 4M75F 3OBWA 5GANd 4C8QA 2WP2A 3NXBA 1K73U 5HEMA 4IUVA 1VQLT 2P0PA 4TT6A 4Y28E 4XQ3A 2DKWA 4XU3A 1EIFA 1KC8U 2VUBA 4HA8A 3OSVA 2YYNA 4A4FA 5I80A 3CCLT 3E1SA 2DVVA 4PKLA 3H8ZA 5CQYA 2RFJA 2FL7A 5DBMA 5CR2A 4QQGA 5EP7A 4HCBA 2RS9B 3JB9H 5AYFA 4M7DC 3S3MA 5JI8A 2DXBA 4X9CA 2FB7A 5ENIA 4PNOA 4A4HA 4DONA 1F68A 3MEVA 3U5KA 4Z1SA 1Y71A 5HK3A 2RNYA 3JB9F 3CC4A 2RHXA 3KBGA 4Z93A 5H85A 4PJOA 5DYUA 5I86A 5GMKe 3ZYUA 5IGKA 3NTKA 5HQ5A 2XD0A 2YRVA 4A54A 3QKJA 3M5AA 4LDYA 3CBOA 1YJNT 1XTDA 4M77A 3HFNA 2GCXA 4C8QF 1VQ8A 2M1HA 2PUKB 4KCXA 3G71A 2D0QB 3SWNC 2E1HA 5CRZA 5D3PA 4R55A 3JCMd 3SD4A 3OW2A 4M7DB 4XTUA 3OYBA 2RM4A 4M75D 2XG8D 3U5MA 5HLSA 1Q86U 2M16A 5LKXA 1H641 4HXMA 3CCSA 5FB1A 2CKKA 3QYHB 4OUFA 1M90U 1N6AA 4BY6C 5LUUA 4M7AC 4M7DG 2HQXA 4QQ6A 1D3BB 1Q81C 3GNFB 3V7SA 5EI4A 2RI2A 2RB6A 4PJOF 3OYMA 4A9HA 3U5LA 4GY5A 1VQ5A 3SWNB 4ZN3A 2LX9A 2VV5A 5I83A 3TEEA 3A8OB 4Q0OA 2VXFA 3L2QA 2YELA 2V8JA 3JB9D 2JZ2A 4XTWA 2E10A 2KQWA 3SFMA 3DLMA 4LZ2A 4UIZA 3CCQA 5D3RA 1HK9A 5AD2A 2R0VA 3JCMb 3GG3A 1K8AC 2C06A 4BY6B 2ZPHB 3BY7A 4M7AB 3HKSA 5CRMA 4J5YA 2PVDB 4LC2A 2FVUA 2FYKA 4O7AA 1N8RU 2MF2A 5LVQA 5EWCA 1MHNA 4QW2A 2RI7A 1B34B 4M7AG 4NR7A 3P1CA 3UV4A 3G6EA 4MEOA 1JRIA 1JM4B 1QVFS 4VUBA 3CCMT 4ZGDB 5JWMA 3G4SA 1YI2A 3G7ZA 4NR9A 3CBMA 5E9VA 2DTHA 4UIVA 3S91A 3UV2A 1W4SA 5IT9E 5F5ZA 4Z1QA 3IU6A 3Q2EA 3JCMX 4YH4A 2HQEA 4LYWA 4MZTA 3X20B 4XTVA 5LKTA 2O4XB 3CCJA 5GAMh 5CQTA 1M1FA 3I56A 5CTLA 5D25A 2E64A 5L99A 2LRQA 1VQ4A 4HT8A 2QQRA 3J7AF 4NYXA 3FRNA 2OUOA 4TZ8A 2QQ9A 3O33A 5COIA 4M7DA 3M59A 3M54A 5HENA 4O70A 5D3HA 3OQ5A 5LJ5e 2QXFA 3O37A 3L2RA 4BW2A 5FU6C 4LR6A 5KH6A 5CU8A 5A0LA 4C0ZA 4A4EA 5GMKl 4J6XA 5GANh 5L8RE 3GIBA 5A82A 1E6IA 2EYQA 3JVLA 2QQBA 4BB7A 1D3BA 1G3TA 1LNXA 4CL9A 4MDWA 3SWNA 2OSSA 5F36A 4IKFA 3RMQA 3J81E 1H3ZA 3A8HB 5A83A 3SVFA 5FU7C 2DVQA 3UWNA 3QXEB 4TS8A 5FU6B 3JCMV 1VQ9A 3INZA 4J7IA 4UIYA 3RESA 4XK8E 2G3RA 3QUIA 4FT4A 4M7DF 1VQNA 5EWVA 3BDUA 3LXJA 4BDZA 1WJRA 3VJPA 1ZS5A 3SDZA 2RK2A 5EPRA 5GAN3 4CI0C 2LQKA 3ZEHA 4EMHA 4M7AA 2BIVA 1Q82C 3Q2FA 4PLIA 5IN1A 2F6NA 3OY9A 3I55T 3P1DA 2RJEA 2QA4T 4BHWA 3M4YA 4UIWA 2R10A 5I21A 2LT4A 1B34A 2YDWA 2OTLA 5FU7B 2E65A 4YAXA 5HRWA 4QR5A 4QSVA 4MENA 4XYAA 4C8QE 4JJNK 3JCMh 4HXKA 3VKIA 4JUVA 5IGLA 2DK3A 1N9SA 1BYMA 4E47A 3LWIA 4IR6A 5FH7A 5HELA 1LOJA 3OYHA 2DXTA 2JTFA 4B9WA 4QY4A 3RKXA 4JRPA 4C0DC 5EU1A 5FE0A 4TU6A 4QC1A 4C92C 2F6JA 1RL2A 3HMFA 5KO4A 4YYNA 5IAYA 5HFQA 5EPSA 3LLRA 5DFBA 3LWHA 5H1UA 5J3BA 1BI0A 5DLZA 2O4XA 1VQ7A 4M7AF 2P0KA 1QVFA 2I2LA 1Q7YC 3WXMB 2QI2A 4OGJA 5GAMj 5EG2A 3M58A 4NS5A 4NR6A 3MCAB 4PJOE 4QVCA 5A5NA 3HP9A 3C94A 3JCMW 2E3KA 4BDYA 3PT9A 4M77E 5DY7A 4LDVA 1DJ7B 4Q0NA 5DYCA 5FE5A 3JRZA 3S3OA 3LH0A 4C0DB 1BI2A 1M9SA 4XAXB 4XU0A 4CFLA 2VGNA 4C92B 1FWZA 1AHJB 3DWYA 5FE8A 5GANj 2WSCE 2BKDN 5FFVA 3LYIA 1WJQA 1YJ9T 5LJ5d 1MGQA 3QZVA 3P8HA 3U5OA 2XIDA 1VQKT 3A5ZB 3E9GA 3FDRA 1BIAA 3O35A 4C92G 5FG4A 4DOWA 3HSBA 4IUTA 2RJDA 2XK0A 5I29A 5J0DA 3O36A 5EWHA 2CZ1B 4A4GA 2K4YA 2K57A 3M57A 2YW5A 5CQ5A 4LDFA 4NQMA 4O78A 2V8IA 3P1FA 2ZPBB 1BI3A 1IREB 4ZC9A 2F5TX 3P8BB 3FKMX 4C0FA 4QEWA 3CCRA 4A9LA 5FLXE 5KE2A 1QP3A 2NXBA 1VQPA 5D3JA 3UV5A 1JB0E 5FH8A 5DYAA 5F63A 5LL6S 4A9MA 5ACYA 5C85A 3A8MB 1VQMT 4CUUA 4E96A 2MWPA 4L6V5 2EWNA 2DAQA 5CAIA 1FXXA 4A4KA 5GMKh 4BE1A 5FFWA 5D24A 3V8JA 1M8VA 1G3YA 4NL2A 3OYNA 3QZ5B 3TLPA 4M78C 4A9EA 3SVGA 4A9JA 5C4QA 4L5GA 1ZBXA 5IBNA 4MR5A 3CD6A 4E7IA 4YY4A 2XICA 2VC8A 1NJIC 4HCZA 5CKEA 3VUZA 5E7DA 3TCJA 3RIRA 4BE2A 5HM0A 5I1QA 4IOQA 4O5VA 4PCIA 5I2SA 1EQFA 3JSCA 4KULA 2RNXA 2VGMA 5HQ7A 4V2SA 4ELZC 5I7XA 5CUCA 4NXJA 2L8DA 1NZ9A 4QR4A 4FT2A 4KUDK 4FSXA 5DKDA 5C7NA 2RHYA 4M78B 3UVXA 4J3IA 2KSSA 4C66A 1UGPB 4E7KA 3C4SA 2MMPA 5LJ5g 3RCWA 3CC4T 5E9LA 4C92A 4YBMA 4Z02A 2QTXA 4ATOA 1PSEA 4UYDA 1SSFA 4OB3B 5F60A 3V8LA 5DKHA 4UIUA 3FLGA 5GAOn 4M7DE 5LJ3d 1M1GA 5FROA 2HAXA 4M78G 3RERA 1WJSA 4O7CA 3URGA 5A0GA 3FC3A 1TH7A 2JOYA 2M9UA 1PSFA 5FE1A 5DX4A 5E9MA 1NPRA 4YBSA 5L8UA 2DKGA 5FRMA 2HNIA 4XTXA 3GNGA 5HY6A 3OYFA 4LZRA 4J0SA 2EJ9A 2DD4A 3OYKA 3OYEA 1VQLA 4TTEA 3GLXA 3V7RA 2EQMA 3CCST 4UYEA 1Y7XA 1U1SA 3OYCA 2EAYA 5KCHA 4CUSA 3OYLA 1VIEA 1Q86C 4HBWA 5EGUA 4C92F 5GAOp 2H60A 5D6YA 5EK9A 5IGMA 2RH2A 1M90C 2E41A 1VQ5T 5EV9A 2EKOA 2RK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQJ A;  5LKZ A;  2L85 A;  5CTL A;  5D25 A;  3MO8 A;  5L99 A;  2LRQ A;  2QQR A;  4YAD A;  3UVD A;  4NYX A;  4AKN A;  1XNI A;  2OUO A;  4TZ8 A;  4IR4 A;  4FL6 A;  5FRN A;  3O33 A;  2IG0 A;  5E3D A;  4CFK A;  5COI A;  3NTI A;  3I3J A;  5E3G A;  4O7F A;  4XUB A;  2X4X A;  5F1H A;  5HEN A;  4O70 A;  5D3H A;  3OQ5 A;  3MUL A;  2I8N A;  3O37 A;  5A5P A;  2DVR A;  1JSP B;  3L2R A;  4KV4 A;  4BW2 A;  5FG5 A;  4YC9 A;  3OS0 A;  4LR6 A;  5CUG A;  4X2I A;  5KH6 A;  4QST A;  4YYJ A;  5CU8 A;  5L98 A;  4A9I A;  2M0O A;  1N27 A;  3MP1 A;  3Q1J A;  4BW1 A;  2R5A A;  4A4E A;  5EWD A;  3PFS A;  3IU5 A;  2DIG A;  4NQN A;  4C67 A;  5C89 A;  2YEM A;  5BT5 A;  2FHD A;  5ENC A;  4CUR A;  5A82 A;  1E6I A;  3U5N A;  5L96 A;  4TYL A;  4QSQ A;  4XY9 A;  3JVL A;  2R58 A;  5LVR A;  4QSR A;  5C8G A;  4UYG A;  4IUQ A;  2L5E A;  3OYG A;  3OYI A;  3S92 A;  5IGN A;  3QII A;  4CL9 A;  4IUP A;  5D26 A;  4YY6 A;  5CGP A;  2NLU A;  4BAC A;  4IOO A;  2PQW A;  5D0C A;  4PLL A;  4N4H A;  3K2J A;  3BDL A;  3QBY A;  5ETD A;  1X0J A;  2OSS A;  4CUP A;  4L59 A;  4O75 A;  5F36 A;  4IKF A;  5A5R A;  4CUT A;  5F2P A;  1H3Z A;  2G4A A;  5A83 A;  3SVF A;  5A5O A;  4QZS A;  5K29 A;  4YYH A;  2WAC A;  2D9T A;  2DVQ A;  4CRI A;  4QC3 A;  3UWN A;  2KTB B;  4E7J A;  4NRB A;  4FLP A;  4QR3 A;  4QNS A;  4OGI A;  4TT2 A;  2EFI A;  4TS8 A;  4HXN A;  3JVK A;  2L3R A;  5FE4 A;  5HJC A;  4FU6 A;  4UIY A;  5HFR A;  3QJ6 A;  2X35 A;  4PY6 A;  4HBV A;  5FBX A;  5DYX A;  2LCC A;  2G3R A;  1G5V A;  4YAT A;  5EWV A;  4UIT A;  2EQK A;  4Q5W A;  3LXJ A;  3OS2 A;  5HRV A;  4BDZ A;  1WJR A;  1ZS5 A;  4YYK A;  4ZW1 A;  4NYV A;  4A9N A;  3QZS A;  3MP8 A;  5EPR A;  5FE9 A;  3ZEH A;  5CZG A;  2BIV A;  3OYA A;  3Q2F A;  4LD6 A;  4PLI A;  5C6S A;  4RVR A;  5IN1 A;  3ONI A;  4WIV A;  2F6N A;  2K3X A;  3OY9 A;  3P1D A;  3DB4 A;  3S3N A;  5CUE A;  2GFU A;  5CUB A;  5DKC A;  5F61 A;  2RJE A;  4LZS A;  1N72 A;  2RHU A;  4BHW A;  3OMG A;  3LGL A;  5KTU A;  4UIW A;  4BE0 A;  2R10 A;  5FDZ A;  5F3A A;  4MEQ A;  4O71 A;  1OI1 A;  4XY8 A;  3DB3 A;  2YDW A;  5F1L A;  4UIX A;  5HQ6 A;  3NTH A;  4YAX A;  3JVJ A;  4QR5 A;  5HRW A;  4QSV A;  4MEN A;  4MR6 A;  4XYA A;  4YBT A;  5EVA A;  3O34 A;  4HXK A;  5FG6 A;  5ETB A;  2RJC A;  5KU3 A;  5CFW A;  5IGL A;  4QYD A;  5CQA A;  4IUU A;  2E7N A;  4QUT A;  5HCL A;  5KTW A;  4YYI A;  4QVZ A;  3MXF A;  4BD3 A;  4C5I A;  4IR6 A;  5FH7 A;  5HEL A;  5CY9 A;  3O8V A;  5D6X A;  3OYH A;  4ALH A;  4LYI A;  2JTF A;  4B9W A;  4QY4 A;  3CEY A;  2RI3 A;  5EU1 A;  2RHZ A;  5KCO A;  4QYL A;  5FE0 A;  5ENG A;  3G0J A;  4TU6 A;  4QC1 A;  4TQN A;  2F6J A;  5FE2 A;  3PNW C;  4KV1 A;  3HMF A;  4UC4 A;  4NR5 A;  5KO4 A;  4YYN A;  2I7K A;  5IAY A;  5HFQ A;  5EPS A;  3LLR A;  5DFB A;  4ZTJ A;  4X34 A;  5H1U A;  5DLZ A;  2O4X A;  4NUC A;  2P0K A;  5FH6 A;  4N4G A;  4YYG A;  3P5O A;  2FSA A;  5CQ4 A;  4QSU A;  2L89 A;  4OGJ A;  2LSP B;  4NS5 A;  5EIC A;  5ENE A;  4NR6 A;  4PL6 A;  5EM3 A;  4TZ2 A;  3UVW A;  2LVM A;  1OZ2 A;  4YAB A;  4PS5 A;  4CLB A;  3MUK A;  5ENF A;  3OYJ A;  5A5N A;  3LQI A;  5H1V A;  3LGF A;  5CUD A;  4UYF B;  2E3K A;  4WHU A;  5IG6 A;  4O74 A;  4N4I A;  2RNW A;  4QQD A;  5D3L A;  4BDY A;  4HXS A;  2RO1 A;  5CQ3 A;  4HXL A;  5DY7 A;  4ZQL A;  5A81 A;  4HXO A;  4Q0N A;  5DYC A;  5FE5 A;  3S3O A;  3LH0 A;  5LJ1 A;  4E7L A;  2K3Y A;  3L2U A;  5E73 A;  2LTO A;  4A9O A;  2F5K A;  3PMI A;  4CFL A;  2WP1 A;  4NYW A;  5F62 A;  3L2W A;  3M9Q A;  4N3W A;  3UW9 A;  1WUG A;  3OA6 A;  4EDU A;  5G4R A;  4BJX A;  3DWY A;  5FE8 A;  5CQ8 A;  4LYS A;  2WP2 A;  3LX7 A;  4QSS A;  3NXB A;  5HEM A;  2BKD N;  2X4Y A;  4TT4 A;  5EQ1 A;  4IUV A;  5M9O A;  5FFV A;  3LYI A;  4TT6 A;  5KTX A;  1WJQ A;  5EA1 A;  2DKW A;  4QUU A;  4F3I A;  2RO0 A;  3MEU A;  3QZV A;  3P8H A;  5J39 A;  5D3S A;  3F70 A;  3U5O A;  2E5Q A;  4YK0 A;  5FFY A;  3E9G A;  3FDR A;  5H1T A;  2YYN A;  4A4F A;  5I80 A;  3O35 A;  5CPE A;  1RI0 A;  2DVV A;  5FG4 A;  4B9X A;  3PMT A;  5I7Y A;  4C5E A;  4IUT A;  2RJD A;  2D82 A;  2DIQ A;  2XK0 A;  4HBY A;  4PKL A;  5I29 A;  3H8Z A;  5J0D A;  3UT1 A;  2RFJ A;  4A9K A;  4MR3 A;  5DBM A;  3O36 A;  5EP7 A;  5EWH A;  4IR3 A;  5E9Y A;  2RS9 B;  4QQG A;  4A4G A;  2EQU A;  3S3M A;  5JI8 A;  5BT4 A;  2MJV B;  2RHI A;  1WGS A;  2YW5 A;  5ENI A;  5CQ5 A;  5DLX A;  4BW4 A;  1WUM A;  4LDF A;  4DON A;  1F68 A;  3MEV A;  4A4H A;  4XUA A;  2R0Y A;  4NQM A;  3U5K A;  4Z1S A;  3P1E A;  1KHC A;  4O78 A;  4QB3 A;  3P1F A;  5D3T A;  2RNY A;  2RHX A;  4ZC9 A;  3DAI A;  3FKM X;  4Z93 A;  5H85 A;  4QEW A;  5DYU A;  3S6W A;  4A9L A;  5I86 A;  4O76 A;  3ZYU A;  5IGK A;  4Z6H A;  4O77 A;  5KE2 A;  3NTK A;  5HQ5 A;  3JVM A;  2YRV A;  2NXB A;  3QKJ A;  4Z6I A;  5D3J A;  3UV5 A;  4QSX A;  3MP6 A;  3MEW A;  4QSP A;  2N9G A;  5FH8 A;  5DYA A;  5ENJ A;  3P8D A;  5F63 A;  3LQH A;  4A9M A;  5ACY A;  2GRC A;  5C85 A;  2DWW A;  2M1H A;  3ME9 A;  4KCX A;  5DFD A;  4CUU A;  5E74 A;  5ENB A;  3HME A;  5HRX A;  4HBX A;  5CRZ A;  5EPB A;  5L97 A;  2BUD A;  3KUF A;  4E96 A;  4NRA A;  2MWP A;  5D3P A;  4QSW A;  4HXR A;  5A5Q A;  2DAQ A;  3MET A;  5A85 A;  3SD4 A;  4BE1 A;  5FFW A;  3OYB A;  2MWO A;  5D24 A;  3OB9 A;  3U5M A;  3OYN A;  5D6W A;  5HLS A;  3TLP A;  4O7B A;  5DFC A;  4MR4 A;  4A9E A;  3SVG A;  4A9J A;  3MB3 A;  5C4Q A;  2M16 A;  5E9K A;  4GPJ A;  5F25 A;  5IBN A;  5I40 A;  5LKX A;  4MR5 A;  4II1 A;  2OO1 A;  4HXM A;  4E7I A;  3U5J A;  4YY4 A;  4QBM A;  5FB1 A;  5CP5 A;  2E6N A;  2CKK A;  4MEP A;  4HCZ A;  5DW2 A;  4OUF A;  5EIS A;  5E7D A;  3SVH A;  4BE2 A;  5HM0 A;  5I1Q A;  5LUU A;  4IOQ A;  3OS1 A;  5E9I A;  4Y03 A;  4PCI A;  3OMC A;  5KHM A;  5FE6 A;  4ZTF A;  1EQF A;  2HQX A;  5C87 A;  4QQ6 A;  4TU4 A;  5ENH A;  4RG2 A;  5KE3 A;  2RNX A;  5EI4 A;  2RI2 A;  3OYM A;  2E7O A;  4A9H A;  5HQ7 A;  3U5L A;  4GY5 A;  2B8A A;  4HXP A;  5I83 A;  5E0R A;  5FB0 A;  5C0M A;  4NR8 A;  5I7X A;  5CUC A;  4NXJ A;  2L8D A;  3H6Z A;  2L84 A;  3E9F A;  4Q0O A;  4QR4 A;  3L2Q A;  2YEL A;  4UYF A;  5LJ2 A;  4NUE A;  4NRC A;  5DKD A;  2JZ2 A;  2DAT A;  2XDP A;  5C7N A;  2RHY A;  3UVX A;  3DLM A;  4J3I A;  5BT3 A;  4PCE A;  4C66 A;  4LZ2 A;  4UIZ A;  4E7K A;  5EWW A;  4PTB A;  3C4S A;  5D3R A;  5LKU A;  2GF7 A;  2R0S A;  3RCW A;  5I88 A;  5AD2 A;  2R0V A;  3MQM A;  5D3N A;  5A7C A;  5E9L A;  3EAE A;  4NR4 A;  4YBM A;  4Z02 A;  3GG3 A;  4NUD A;  4UYD A;  1SSF A;  5F60 A;  5DKH A;  4UIU A;  5CUA A;  3FLG A;  5II1 A;  3OYD A;  5FRO A;  5AD3 A;  5CRM A;  5CIU A;  2LDM A;  4O72 A;  4LC2 A;  3AQA A;  5A5S A;  1WJS A;  4O7C A;  4O7A A;  4LRG A;  3FC3 A;  5FE7 A;  5FE1 A;  4OVA A;  5LVQ A;  5I89 A;  5EWC A;  4N4F A;  1MHN A;  5DX4 A;  4WHW A;  5J26 A;  3LJW A;  5E9M A;  4QW2 A;  2RI7 A;  4QEV A;  5D7X A;  3L2V A;  4YBS A;  5L8U A;  3D7C A;  5FRM A;  2YQD A;  2VYT A;  2R57 A;  1OYX A;  4IUR A;  3OYF A;  4NR7 A;  4LZR A;  3P1C A;  3MEA A;  3UV4 A;  1OZ3 A;  4J0S A;  4MEO A;  5TB6 A;  1JM4 B;  5IID A;  3OYK A;  3OYE A;  5JWM A;  5AME A;  4C5G A;  2X4W A;  2D9E A;  4TTE A;  5DW1 A;  3HMH A;  4J1P A;  4E7H A;  4NR9 A;  2EQM A;  5LJ0 A;  4UYE A;  4YYM A;  4YH3 A;  5E9V A;  2DVS A;  3G0L A;  5II2 A;  2RI5 A;  4UIV A;  5FE3 A;  4J0R A;  4CUQ A;  2R5M A;  3OYC A;  4ALG A;  5KCH A;  2RJF A;  3S91 A;  3UV2 A;  4CUS A;  3OYL A;  3UVY A;  4BW3 A;  3L42 A;  5F5Z A;  4Z1Q A;  3LQJ A;  3MB4 A;  4A9F A;  3FEO A;  3IU6 A;  2YEK A;  3Q2E A;  5TCM A;  5CS8 A;  4HBW A;  4YH4 A;  5EGU A;  5G4S A;  3ASK A;  4O7E A;  2HQE A;  2GFA A;  5L8T A;  2H60 A;  4IOR A;  4LYW A;  4C5H A;  5D6Y A;  5CQ7 A;  5EK9 A;  4YYD A;  5IGM A;  5AMF A;  5LKT A;  2O4X B;  4QEU A;  3AAD A;  3QZT A;  4IR5 A;  3U5P A;  5CQT A;  5EV9 A;  2EKO A;  3GOX A;  4UYH A;  2QQS A;  5CQ6 A; 
#chains in the Genus database with same CATH topology
 4RTW A;  2CZ0 B;  1XQH A;  4M7A E;  4KBM B;  3RBB B;  4RG8 A;  4AKN A;  2ABL A;  4IR4 A;  1CKA A;  3VUB A;  5E3D A;  2LQ8 A;  2DF6 A;  1AD5 A;  1N5Z A;  3VYH B;  4XUB A;  2X4X A;  4DQ2 A;  5F1H A;  2DIL A;  1KSW A;  3CCQ T;  2I8N A;  5GMK j;  5A5P A;  1JSP B;  2DVR A;  2OI3 A;  2L3Q A;  3TRE A;  1GFC A;  3RKY A;  4X2I A;  1YJN A;  4QST A;  2PZ1 A;  2KK4 A;  5L98 A;  2HKN A;  1VQM Q;  2VAS A;  3CCE Q;  1T0J A;  1YJW A;  2M0Y A;  4BW1 A;  2R5A A;  1BI1 A;  3PFS A;  4C67 A;  2YEM A;  1NM7 A;  2FHD A;  5ENC A;  4M77 F;  4JZ4 A;  4TYL A;  4XY9 A;  2R58 A;  4BUG A;  4QSR A;  5C8G A;  2HEQ A;  4IUQ A;  5LJ5 h;  3OYI A;  3OYG A;  4AFU C;  2F69 A;  3CCU A;  3SB2 A;  4YY6 A;  2NLU A;  2PQW A;  1ZBJ A;  4ZGJ B;  3BDL A;  4AFQ C;  1AZE A;  5ETD A;  3HHT B;  4L59 A;  2BZY A;  1ZHI A;  5A5R A;  2NUT B;  1QCF A;  2G4A A;  4HCC A;  2OTJ A;  4C8Q D;  1N8R C;  3EGX B;  1IHV A;  2QEX T;  1LVK A;  4XU1 A;  4CRI A;  4QC3 A;  3C95 A;  2EVR A;  5LJ3 g;  4NRB A;  4LDX A;  4QR3 A;  3G4S T;  4M78 A;  5CCA A;  1K9M C;  1YI2 T;  4KH1 B;  1WQ7 A;  2DL3 A;  2JN0 A;  2SEM A;  4PY6 A;  1AOJ A;  2RF0 A;  1H92 A;  5FBX A;  2LCC A;  3X28 B;  2HL3 A;  1U8R A;  4UIT A;  4Q5W A;  1D1A A;  2D8H A;  3ZBD A;  4KUI A;  4ZW1 A;  2YUO A;  4A9N A;  3MP8 A;  4JLG A;  2SRC A;  4MML A;  3TSW A;  2LQW A;  1MMD A;  1VQL Q;  5C6S A;  3CCJ T;  3L1A A;  1RAG B;  2K3X A;  4KH0 B;  4ZGE B;  3DB4 A;  3S3N A;  4OB0 B;  3I56 T;  2GFU A;  2GTJ A;  5DKC A;  1OV3 A;  3H41 A;  1W2B P;  4J9D A;  3JB9 J;  2RHU A;  4DEY A;  3LGL A;  1RAI B;  3CCL Q;  1VQ4 T;  4BE0 A;  5F3A A;  2FRY A;  4XY8 A;  3ZL7 C;  4AFZ C;  1Q82 R;  3DB3 A;  5F1L A;  2Y4X A;  4MZP A;  4PJO D;  2KY9 A;  5CKH A;  4DA4 A;  4FW2 A;  1NYF A;  3RKW A;  5GAM f;  5ETB A;  2D6F A;  4HVW A;  5CFW A;  2DD5 A;  5CQA A;  4M77 D;  3MXF A;  3ZFJ A;  2AHJ B;  3X24 B;  1RUW A;  5D6X A;  2KI7 A;  4ALH A;  4J6Y A;  3I9Q A;  2ZPG B;  1WXT A;  4LYI A;  1X27 A;  1JU5 C;  1WHL A;  2XDD A;  2DTO A;  2BTT A;  4GLM A;  4M78 F;  5KCO A;  2K5I A;  3CC2 A;  1WNL A;  1IGU A;  1NEG A;  4RTZ A;  1QMC A;  3DLL A;  1A0N B;  4ZTJ A;  1YJN Q;  3QZ9 B;  4LE9 A;  4NUC A;  2EQI A;  2LX7 A;  5KYX B;  5GAN f;  4N4G A;  4YYG A;  4JDS A;  5GAO q;  2DJQ A;  2P4T A;  4J9C A;  1YIJ T;  1FX7 A;  2EKH A;  4PL6 A;  5EIC A;  3UVW A;  3ERR A;  2HQH A;  2LVM A;  4FM4 B;  4YAB A;  2LJ0 A;  2XI9 A;  1I5L A;  2CP5 A;  1IXD A;  3MUK A;  1UE9 A;  5ENF A;  3LQI A;  5GAO r;  5CUD A;  4UYF B;  4WHU A;  1VQ9 T;  3CC7 A;  2RNW A;  3D7S B;  4FSS A;  2JVV A;  4ZQL A;  1Q7Y R;  2A0F B;  2FO0 A;  1VQN T;  1AEY A;  4E7L A;  5E73 A;  4A9O A;  2F5K A;  2COW A;  3L2W A;  1WUG A;  2LNH B;  3OA6 A;  4EDU A;  2P84 A;  2E3I A;  5CQ8 A;  4LYS A;  1YIT A;  4AT1 B;  3CXC P;  1UEC A;  1OX8 A;  4QSS A;  1RAH B;  7AT1 B;  4OGE A;  2X4Y A;  1M4Z A;  5M9O A;  3EG9 B;  1D1C A;  3PIO A;  5KTX A;  4O6J A;  4Y92 A;  1WYX A;  5EA1 A;  1SSH A;  4QUU A;  4F3I A;  2PUO B;  3MEU A;  2GQV A;  5LJ5 j;  2K5L A;  3HFO A;  5J39 A;  5D3S A;  3F70 A;  4KT0 E;  1GL5 A;  2E5Q A;  1I8F A;  4M75 C;  2E6Z A;  4YK0 A;  5FFY A;  2FPF A;  2NUT A;  5H1T A;  3OYY A;  2RMO A;  1ZKR A;  1QVG P;  1RI0 A;  1X75 C;  2EYY A;  3EGX A;  5KYW B;  3PMT A;  5I7Y A;  4C5E A;  2DIQ A;  3UT1 A;  4MR3 A;  5E9Y A;  3M4G A;  2V8K A;  1EZZ B;  2QK0 A;  1X69 A;  5DLX A;  3JCM f;  4XUA A;  2R0Y A;  1KHC A;  4QB3 A;  3CME A;  2V1R A;  2B86 A;  5GAO m;  2KVQ G;  2KXC A;  3DAI A;  2DL7 A;  5GAN 7;  4O76 A;  2WSF E;  1HSQ A;  4QKU A;  1OPK A;  4Z6H A;  2P4R A;  2XU8 A;  4Z6I A;  2CT4 A;  1N9R A;  3MEW A;  4QSP A;  1U3O A;  2N9G A;  4M75 B;  4JS4 A;  1ZUK A;  1MND A;  2EIF A;  2Y4Y A;  3LQH A;  3HRS A;  4ESR A;  4C92 E;  2DWW A;  1UFF A;  1Y07 A;  4GLK A;  1PRM C;  2JXB A;  1QWF A;  5E74 A;  1S72 A;  3HME A;  2CZ7 B;  1GRI A;  1GXI E;  5HRX A;  4HBX A;  2BUD A;  5CK9 A;  1JJ2 A;  2XDB A;  4F7U B;  4QSW A;  3L2Z A;  5A5Q A;  3MET A;  3CCM Q;  3OB9 A;  5D6W A;  2VVK A;  5DFC A;  2NUZ A;  4MR4 A;  1QKW A;  3EH2 A;  4M75 G;  3QO3 A;  4BI8 B;  5I40 A;  5F25 A;  4II1 A;  4RCC A;  3U5J A;  4QBM A;  3UPU A;  1X6O A;  3EG1 A;  3GPL A;  5LJ3 e;  3PIP A;  4CC2 A;  3VS6 A;  4WF2 A;  5EIS A;  2AK5 A;  2H3E B;  2K6D A;  4M7D D;  3J80 E;  4X1V A;  4PJN A;  4XTZ A;  3REB B;  4F7U G;  2D8J A;  4J7F A;  3OS1 A;  5E9I A;  2O88 A;  3RDV A;  3OMC A;  5KHM A;  5FE6 A;  1I1J A;  2FRW A;  5C87 A;  3JV3 A;  5KE3 A;  5KYX A;  3WVE B;  8AT1 B;  3OS5 A;  4OGC A;  2BZX A;  1M1K R;  4JJB A;  4OB1 B;  4J9B A;  1I0C A;  1GFD A;  3C12 A;  4X9D A;  5E0R A;  4ELY C;  5C0M A;  3G1J A;  4NR8 A;  3CMA A;  1KD1 C;  3E9F A;  1VQ6 A;  4UYF A;  5LJ2 A;  2QAZ A;  4NUE A;  4NRC A;  4TVR A;  1Q7Y U;  1KQS P;  2XDP A;  1D0Y A;  3VS3 A;  3O5Z A;  5CO7 A;  2YRD A;  4PCE A;  2J6O A;  3JB9 G;  4LD9 K;  2V26 A;  1ABQ A;  5EWW A;  4PTB A;  5HCK A;  2GF7 A;  2GNC A;  2AT1 B;  2ED0 A;  5I88 A;  2KT8 A;  3MQM A;  5D3N A;  5A7C A;  4NR4 A;  3CCR T;  5KYU B;  2E12 A;  2PVO B;  5CUA A;  3RMS A;  5II1 A;  1YHQ A;  4J83 A;  2FEI A;  1OPL A;  5AD3 A;  1ZSG A;  2NYS A;  1RI9 A;  5CIU A;  1VQP T;  2ZPF B;  1F1B B;  3EG9 A;  1PHT A;  1VQO A;  5A5S A;  1RAC B;  1IB8 A;  1E6G A;  4LRG A;  4ANJ A;  1U1T A;  5FE7 A;  1QVP A;  4N4F A;  3VS1 A;  4Z8A A;  2K3B A;  4M7A D;  1T3L A;  2EJN A;  3LJW A;  2VWF A;  2E70 A;  3QDR B;  4FCY A;  5KYW A;  2YQD A;  2VYT A;  1OYX A;  1W2B S;  4IUR A;  2JJ9 A;  1PG5 B;  1RAD B;  3MEA A;  1QQJ A;  3C0C A;  2K7A A;  1YJ9 A;  5DW1 A;  3HMH A;  4J1P A;  3CD6 T;  4E7H A;  1J3T A;  4KRT A;  5LJ0 A;  4YYM A;  2L0A A;  3G0L A;  5II2 A;  4MZM A;  1QVF P;  4CUQ A;  4IIM A;  1XOV A;  2W10 A;  2HBP A;  3UVY A;  1QLY A;  4FYX B;  3LQJ A;  3MB4 A;  2JS2 A;  4A9F A;  4M78 E;  2YEK A;  2YWW A;  3I55 Q;  4MMK A;  2KRM A;  4FYY B;  4PKC C;  1G2B A;  2GFA A;  4IOR A;  1X43 A;  4C5H A;  5CQ7 A;  1UHC A;  5HK0 A;  4M75 A;  2A7Y A;  3QZT A;  3V8K A;  2QA4 Q;  4IR5 A;  1K1Z A;  4CC3 A;  4UYH A;  1B7T A;  5FWB A;  5LKZ A;  2K5F A;  1AT1 B;  4AKH A;  1UDL A;  4YAD A;  3CCV A;  3UVD A;  1XNI A;  2VXE A;  4FL6 A;  2JUF A;  4F7U A;  4EIK A;  4CFK A;  2DEQ A;  3EGD B;  4HCK A;  3NTI A;  3I3J A;  1M2V B;  4BI3 A;  1KHI A;  2JNG A;  3R6O A;  3MUL A;  1RLQ C;  4KV4 A;  5FG5 A;  5A0D A;  4YC9 A;  3OS0 A;  4OF1 A;  5CUG A;  3EG2 A;  5GAN 8;  4A9I A;  1FMV A;  4K11 A;  1K73 C;  2DIG A;  4B6M A;  5C89 A;  1WZO A;  1VQM A;  1JQQ A;  5BT5 A;  1WIE A;  3OBY A;  3CCE A;  3E19 A;  1NPP A;  4CUR A;  3U5N A;  1KC8 C;  3JCM P;  1ARK A;  4QSQ A;  2DZ9 A;  1Y0M A;  2KYM A;  5IHI A;  5LVR A;  1Q81 R;  4M4Z A;  2QAS A;  3QSU A;  4UYG A;  3IQL A;  1BB9 A;  3FIF A;  1M1K U;  5IGN A;  1M5Q 1;  1VOM A;  3QII A;  3UA7 A;  4BAC A;  1SPK A;  4PLL A;  4N4H A;  3K2J A;  2EJG A;  1X0J A;  4PJJ A;  1H8K A;  4J9I A;  4O75 A;  2DO3 A;  2DXC A;  2ZZD A;  2O9S A;  4CUT A;  4NOY A;  5F2P A;  3WVD B;  5A5O A;  4QZS A;  3QHS A;  5K29 A;  3MHX A;  1MV3 A;  2WAC A;  1WHH A;  5GJW B;  1AWW A;  4FLP A;  2LNV A;  4QNS A;  4TT2 A;  1TU0 B;  3V7C A;  4EMK C;  4HXN A;  4BI4 A;  2L3R A;  4PFO A;  3M55 A;  4FU6 A;  4AG1 C;  1QVG S;  4LN2 A;  2RNA A;  1TXQ A;  1BKB A;  4F7U F;  3M0U A;  3JCM Q;  1X6B A;  5DYX A;  2IPO B;  4HKE A;  1VQ8 T;  4OMP A;  1G5V A;  1K8A R;  3G71 T;  4YYK A;  4OB2 B;  1N8R R;  3EFO B;  2Y90 A;  4LXC A;  2PVG B;  1VA7 A;  5FE9 A;  1TG0 A;  5CZG A;  5GAN 4;  1K9M R;  2XHC A;  4LD6 A;  3RUX A;  2DFU A;  1YJ9 Q;  1IZ6 A;  1MUZ A;  2YHT A;  2KDS A;  1KQ2 A;  2JMC A;  2A28 A;  1VQK Q;  1G3S A;  1P92 A;  5CUE A;  2JTM A;  5F61 A;  2LQN A;  4LZS A;  1N72 A;  5I22 A;  3OMG A;  2KT1 A;  5KTU A;  3UDC A;  4MEQ A;  4O71 A;  4JRQ A;  5A2Q E;  1I4K 1;  4UIX A;  3NTH A;  2DTI A;  2LC4 A;  3JVJ A;  3CCL A;  1M3A A;  4EMK B;  5EVA A;  3O34 A;  4RMO A;  4MDX A;  2CYZ B;  4QYD A;  1D09 B;  4IUU A;  3EFS A;  4QUT A;  5HCL A;  5KTW A;  4QVZ A;  3CPW P;  3PE0 A;  4ZN1 A;  5CY9 A;  1YJW T;  1VIF A;  2RHZ A;  2X9H A;  3T9N A;  1HD3 A;  2KRN A;  3M0P A;  4QYL A;  3NHN A;  5ENG A;  3H0F A;  4TQN A;  3U23 A;  9ATC B;  2GGR A;  2EJF A;  3VYG A;  1D0Z A;  2NUP B;  4NR5 A;  1ZA1 B;  2JT4 A;  3JCM J;  2QQA A;  4JRI A;  4X34 A;  3CCU T;  4QT7 A;  1W2B A;  3TQ7 P;  5I2M A;  5FH6 A;  3P5O A;  3EG0 A;  5CQ4 A;  2RQR A;  2L89 A;  5GAM g;  2OTJ T;  1VUB A;  1TUD A;  4RTY A;  1KG1 A;  5LJ5 f;  4PS5 A;  1TTH B;  3EGD A;  1ACM B;  1SEM A;  5H1V A;  1M2V A;  5IG6 A;  5D3L A;  2RO1 A;  5CQ3 A;  5A81 A;  1VYU A;  4HXO A;  2DJZ A;  1K0S A;  5LJ1 A;  4DEX A;  2K3Y A;  2LTO A;  1KQS S;  2WP1 A;  4NYW A;  5F62 A;  4F14 A;  3JCM c;  4N3W A;  3UW9 A;  2D1X A;  5G4R A;  1Q81 U;  5HKC A;  3G6E T;  1M30 A;  2COZ A;  3FJ5 A;  5GAN g;  4P5N A;  3LX7 A;  4TT4 A;  5EQ1 A;  3CCV Q;  1BIB A;  2FZK B;  2RO0 A;  1PM3 A;  2MI6 A;  3HPW A;  4C92 D;  3CBP A;  5FWC A;  1JJ2 S;  2DER A;  1JO8 A;  5CPE A;  1TWB A;  1NBE B;  4B9X A;  2ZPE B;  2FZC B;  2D82 A;  4HBY A;  5KYU A;  3KXT A;  4A9K A;  2C0T A;  3VU3 C;  5IH2 A;  4IR3 A;  2JS0 A;  4GBQ A;  2EQU A;  5BT4 A;  2MJV B;  2IIM A;  3OW2 P;  2RHI A;  1K8A U;  1WGS A;  1C0M A;  3CPF A;  3CC4 Q;  4BW4 A;  1WUM A;  2K2M A;  3P1E A;  2LCS A;  3CC2 T;  5FW9 A;  3EFO A;  5D3T A;  3CXC A;  1KQ1 A;  1K9M U;  2ESW A;  1O75 A;  4C0G A;  1WXB A;  1X01 A;  3S6W A;  1ZQ1 A;  2DE0 X;  2QEX A;  4O77 A;  4D6W A;  1IO6 A;  3JVM A;  2CT3 A;  2DZC A;  2RD1 A;  4QSX A;  3MP6 A;  2J6K A;  2CP0 A;  5ENJ A;  3P8D A;  3VV0 A;  5DM7 R;  1QVG A;  4R56 A;  3HL8 A;  4RKU E;  2GRC A;  4D8D A;  1WPY A;  3ME9 A;  5DFD A;  5ENB A;  5L97 A;  5EPB A;  3KUF A;  4EMK A;  4NRA A;  3TU4 K;  3CC7 T;  5CKB A;  4HXR A;  3LW5 E;  5A85 A;  2LJ1 A;  2DBM A;  1Y96 B;  1AZG B;  3JCM g;  2MWO A;  2H3J A;  2VB6 A;  1UEB A;  4JPB W;  4O7B A;  3UA6 A;  3CCM A;  3CCS Q;  4JRK A;  4AMC A;  4D8K A;  5KYY B;  4J9F A;  3MB3 A;  5DLQ E;  5E9K A;  4GPJ A;  1WQW A;  2OO1 A;  2OAW A;  2CS7 A;  2ROL A;  5CP5 A;  2E6N A;  1B3Q A;  1YIT T;  4MEP A;  2A3L A;  5DW2 A;  1HXD A;  2EW3 A;  2MPX C;  2NUP A;  3SVH A;  3PGG A;  4Y03 A;  2DLP A;  4ZTF A;  1FMK A;  4N0A C;  1VQ5 Q;  4TU4 A;  5ENH A;  4RG2 A;  1PNJ A;  3HRT A;  5LJ3 f;  2E7O A;  2NWM A;  2ZAE A;  5IXB A;  1TUC A;  3GP8 A;  2B8A A;  4HXP A;  5FB0 A;  5AT1 B;  2W0Z A;  2YLC A;  3H6Z A;  5GAN 2;  2L84 A;  5DLO A;  5LJ3 h;  2KE9 A;  2CZ6 B;  2DAT A;  4FIB A;  3CCQ Q;  1QCN A;  1BCO A;  2A36 A;  2IVW A;  2QGF B;  2EPD A;  4M75 E;  5BT3 A;  2YSQ A;  5GMK m;  1HYO A;  4KGV B;  4OP0 A;  5LKU A;  3CME T;  2MOX A;  2R0S A;  5CQX A;  1KD1 R;  2OAU A;  3EAE A;  1YIJ A;  3VS4 A;  2OTL T;  4NUD A;  4F7U E;  2DVE A;  4LDW A;  1AWO A;  2CRE A;  1O9S A;  4M78 D;  3OYD A;  2LDM A;  4JS5 A;  4O72 A;  5GAO l;  3QJY A;  3AQA A;  1JEG A;  2YLB A;  2ZCF B;  4XU2 A;  3TSZ A;  3FJP A;  4OVA A;  5I89 A;  1S72 T;  4WHW A;  1V29 B;  3ER0 A;  5J26 A;  1UGQ B;  1NYG A;  4QEV A;  5D7X A;  1K9A A;  4YTL A;  3L2V A;  2QEX Q;  1KQS A;  3D7C A;  2HD0 A;  5DY9 A;  2R57 A;  2L5Q A;  2E4H A;  3G4S Q;  2KMT A;  1OZ3 A;  1YI2 Q;  5TB6 A;  5IID A;  1QWE A;  3X25 B;  5AME A;  2JW4 A;  4C5G A;  2X4W A;  1VQ7 T;  2D9E A;  2A37 A;  5GAM e;  1LJO A;  2DXU A;  1YP5 A;  1Q82 U;  3EFR A;  4YH3 A;  2DVS A;  2RI5 A;  5FE3 A;  2DPP B;  4J0R A;  1R8O B;  2R5M A;  2ZPI B;  4ALG A;  1U06 A;  4Z89 A;  3CPW S;  2X4J A;  2RJF A;  2QDL A;  4BW3 A;  3FB9 A;  3L42 A;  4RCB A;  1QP2 A;  3FEO A;  1YCS B;  1C6V X;  4Y91 A;  1TUG B;  3CCJ Q;  5TCM A;  4A53 A;  5CS8 A;  2EYX A;  5G4S A;  3ASK A;  4O7E A;  4JZ3 A;  3I56 Q;  5L8T A;  4C8Q C;  1V76 A;  4YYD A;  5AMF A;  4JJD A;  4QEU A;  4AKI A;  3AAD A;  3I55 A;  5IHN A;  3U5P A;  4CC4 B;  3GOX A;  2AIR B;  1VQ4 Q;  3QJ6 A;  2QQS A;  5CQ6 A;  2EQJ A;  2CH4 A;  2L85 A;  4WCI A;  2QA4 A;  3VKG A;  3MO8 A;  1G3W A;  2BZ8 A;  5GAN e;  2J05 A;  2MK5 A;  4HVV A;  3CMA T;  4DBR A;  2DMO A;  1VQ6 T;  3OSS C;  1UGR B;  5FRN A;  2IG0 A;  2P0Q A;  1Y96 A;  5E3G A;  4O7F A;  1KIK A;  4JLI A;  1WLP B;  4DBF A;  3AHU A;  4IIO A;  3JAM E;  4XTY A;  5KYY A;  4OMN A;  2FG0 A;  4YYJ A;  2M0O A;  1N27 A;  4DOV A;  3MP1 A;  3DKM A;  3Q1J A;  1NJI R;  2CP2 A;  5EWD A;  3IU5 A;  2DNU A;  4NQN A;  4F17 A;  1YHQ T;  3PTA A;  2LT1 A;  5CVI A;  4A63 B;  5L96 A;  1JBM A;  1YBY A;  2JTE A;  4C8Q B;  4FW1 A;  4PJO C;  2KYB A;  1VQO T;  1WA7 A;  2O01 E;  2L5E A;  1YCY A;  3S92 A;  2ZGW A;  4IUP A;  1FYN A;  5D26 A;  1K73 R;  3EGU A;  5CGP A;  1YIJ Q;  4IOO A;  3M0T A;  5D0C A;  2LCL A;  3QBY A;  4M77 C;  1NE8 A;  1GBQ A;  4CUP A;  2O9V A;  2RA2 A;  1KC8 R;  2F1L A;  4J6W A;  1VQ9 Q;  2H8H A;  4YYH A;  2DL5 A;  2D9T A;  4E7J A;  1I81 A;  2KTB B;  5LJ3 j;  2EFI A;  4OGI A;  4C8Q G;  4CC7 A;  3JVK A;  5FE4 A;  5HJC A;  1VQN Q;  5HFR A;  2CGH A;  2DBK A;  2X35 A;  1KD1 U;  4HT9 A;  4HBV A;  2ATC B;  1CSK A;  2WSE E;  4YAT A;  1ZLM A;  2EQK A;  4FYV B;  3OS2 A;  5HRV A;  1FMW A;  1NEB A;  4NYV A;  2FPE A;  3QZS A;  3OW2 S;  2HL5 C;  3JCM e;  2AZS A;  3OYA A;  5CKF A;  2GTO A;  3UAT A;  4PJO B;  4N0A A;  3THK A;  4NL3 A;  3VRZ A;  1YWP A;  4RVR A;  3ONI A;  4WIV A;  3M53 A;  4OMF B;  1GBR A;  3LH5 A;  4RTT A;  2DVJ A;  4M77 B;  5CUB A;  1UGS B;  1V1C A;  3REA B;  1VQK A;  5FDZ A;  3HRU A;  3CCV T;  1OI1 A;  3QYG B;  5GMK i;  2L3S A;  5HQ6 A;  1TOV A;  3QG1 A;  1M3B A;  3JB9 I;  4MR6 A;  4YBT A;  1X2Q A;  2RJC A;  4EMG A;  5FG6 A;  4PJO G;  1RAF B;  1WHJ A;  5GAN 5;  5KU3 A;  3X26 B;  5GAN 6;  2K2V A;  2E7N A;  2PU9 B;  4YYI A;  3BW1 A;  2PNI A;  4BD3 A;  4C5I A;  1K0X A;  5I11 A;  3QPH A;  3O8V A;  2DYI A;  4M77 G;  2MAM A;  3ULR B;  3CEY A;  2KAF A;  2RI3 A;  3N5B B;  3A8L B;  3CCE T;  1Q86 R;  2AZV A;  3G0J A;  1BBZ A;  1QCO A;  1IHW A;  5FE2 A;  2QDY B;  3PNW C;  4KV1 A;  4UC4 A;  2I7K A;  2X3W D;  4ZNX A;  2HBW A;  3MKD A;  1M90 R;  3A8G B;  3UF4 A;  5KYN A;  3GF5 A;  3NFC A;  1UB4 A;  2XKO C;  2FSA A;  5GAM d;  4PJM A;  4RUG A;  6AT1 B;  4QSU A;  4OMO A;  1VYV A;  2LSP B;  5ENE A;  4LDU A;  2HSE B;  1GCQ C;  1M1K C;  5EM3 A;  4TZ2 A;  1OZ2 A;  4CLB A;  3OYJ A;  3LGF A;  1OQK A;  1QW1 A;  4J8O A;  3CPW A;  4O74 A;  4N4I A;  1LCK A;  4QQD A;  2DYB A;  4HXS A;  1ZA2 B;  3BFM A;  4QVD A;  4HXL A;  4E7Z A;  1TSF A;  1MV0 B;  1NJI U;  2HKQ B;  4LUD A;  5CKD A;  4ME7 A;  4EPC A;  3L2U A;  1R0B G;  1UGV A;  3CXC S;  3PMI A;  3M9Q A;  1WFW A;  2DL8 A;  3I5S A;  2I0N A;  2O31 A;  4LUE A;  3M56 A;  4BJX A;  4M75 F;  3OBW A;  5GAN d;  4C8Q A;  2WP2 A;  3NXB A;  1K73 U;  5HEM A;  3NMZ C;  4IUV A;  4AG2 C;  1H3H A;  2DL4 A;  2P0P A;  1VQL T;  4PJL A;  4TT6 A;  4Y28 E;  3EG3 A;  4XQ3 A;  2DKW A;  4XU3 A;  1EIF A;  1OUL A;  1KC8 U;  1GCP A;  2Z0W A;  2VUB A;  4HA8 A;  3OSV A;  2YYN A;  4A4F A;  5I80 A;  3CCL T;  3E1S A;  2DVV A;  1KJW A;  2QGG A;  3SHW A;  8ATC B;  1YN8 A;  4WTO B;  4PKL A;  1JXM A;  3H8Z A;  2C0I A;  5CQY A;  1UHF A;  2RFJ A;  3D1D A;  2DRK A;  2EGC A;  2FL7 A;  5DBM A;  5CR2 A;  4QQG A;  5EP7 A;  4HCB A;  2RS9 B;  3JB9 H;  5AYF A;  4M7D C;  3S3M A;  5JI8 A;  2X51 A;  2O2O A;  2DXB A;  4X9C A;  2FB7 A;  5ENI A;  4PNO A;  4A4H A;  4DON A;  1F68 A;  3MEV A;  3U5K A;  4Z1S A;  1Y71 A;  3CCR Q;  5HK3 A;  2RNY A;  3JB9 F;  3CC4 A;  2RHX A;  3KBG A;  4Z93 A;  5H85 A;  1I07 A;  5EC7 A;  4PJO A;  5DYU A;  5I86 A;  5GMK e;  1VQP Q;  3ZYU A;  2CUD A;  5IGK A;  2DX1 A;  3NTK A;  5HQ5 A;  2XD0 A;  2YRV A;  4A54 A;  3QKJ A;  2K9G A;  3M5A A;  4LDY A;  3CBO A;  3TVT A;  1YJN T;  1XTD A;  4M77 A;  3HFN A;  2GCX A;  4C8Q F;  3MPU B;  3QWX X;  1VQ8 A;  4KGZ B;  2M1H A;  2PUK B;  4KCX A;  3G71 A;  2D0Q B;  3SWN C;  1UUE A;  2E1H A;  1IRX A;  5CRZ A;  5D3P A;  5GJV B;  2L3P A;  4LNP A;  4R55 A;  3JCM d;  2A08 A;  3SD4 A;  3OW2 A;  4XTU A;  4M7D B;  1OEB A;  3OYB A;  2BE9 B;  2RM4 A;  1T0H A;  2EGE A;  4M75 D;  2XG8 D;  3U5M A;  5HLS A;  2HMA A;  3CD6 Q;  3QDF A;  4Z88 A;  1Q86 U;  2RQT A;  2M16 A;  2KRO A;  5LKX A;  1H64 1;  3MJX A;  4HXM A;  3CCS A;  5FB1 A;  2CKK A;  3QYH B;  4FYW B;  2RQU A;  4OUF A;  1M90 U;  2MYS A;  1M27 C;  4F04 B;  1N6A A;  2G6F X;  4BY6 C;  5LUU A;  4M7A C;  4M7D G;  1RAE B;  1PKT A;  2YRC A;  2HQX A;  4QQ6 A;  1D3B B;  1Q81 C;  3GNF B;  3V7S A;  5EI4 A;  2RI2 A;  2RB6 A;  4PJO F;  1UJY A;  3VRY A;  3OYM A;  4A9H A;  2YUQ A;  3U5L A;  4GY5 A;  1D1B A;  1VQ5 A;  1M2O A;  3SWN B;  4ZN3 A;  2LX9 A;  2D0N A;  2DA9 A;  2VV5 A;  5I83 A;  1VYT A;  3TEE A;  3A8O B;  3PVQ A;  4Q0O A;  2VXF A;  3L2Q A;  3VS5 A;  2YEL A;  2V8J A;  4E6R A;  1AWX A;  1OU9 A;  1WHM A;  3JB9 D;  2JZ2 A;  4J9H A;  4XTW A;  2E10 A;  2KQW A;  2KR3 A;  3SFM A;  1JXO A;  3DLM A;  2KBT A;  4LZ2 A;  1SF9 A;  4UIZ A;  3CCQ A;  1EX4 A;  5D3R A;  4RTX A;  1HK9 A;  1SRL A;  5AD2 A;  2R0V A;  1T3S A;  3JCM b;  3GG3 A;  1K8A C;  2C06 A;  4BY6 B;  1KK7 A;  2ZPH B;  3BY7 A;  4M7A B;  1M8M A;  3H9N A;  1K4U S;  3HKS A;  4PFP A;  1W1F A;  5CRM A;  4J5Y A;  2PVD B;  4LC2 A;  2FVU A;  1WHG A;  3M0R A;  2FYK A;  4O7A A;  1WXU A;  1N8R U;  2MF2 A;  1GCQ A;  5LVQ A;  3BE3 A;  5EWC A;  1MHN A;  1PCX A;  2CDT A;  4QW2 A;  2RI7 A;  1B34 B;  2F2V A;  2DM1 A;  1Y57 A;  4M7A G;  4NR7 A;  3P1C A;  3UV4 A;  3G6E A;  4MEO A;  1JRI A;  1JM4 B;  1QVF S;  4VUB A;  3CCM T;  4ZGD B;  5JWM A;  2AKL A;  3G4S A;  1VQ8 Q;  1YI2 A;  2KEA A;  3G7Z A;  4NR9 A;  3G71 Q;  3CBM A;  5E9V A;  2DTH A;  4UIV A;  2LZ6 B;  2E3H A;  3S91 A;  3UV2 A;  1W4S A;  1YFN A;  4JJC A;  3EHR A;  5IT9 E;  5F5Z A;  4Z1Q A;  1BU1 A;  3IU6 A;  3Q2E A;  3JCM X;  4YH4 A;  2HQE A;  4LYW A;  4MZT A;  3X20 B;  5LKT A;  4XTV A;  2O4X B;  3CCJ A;  1OOT A;  5GAM h;  5CQT A;  1M1F A;  3I56 A;  2HZY A;  5CTL A;  5D25 A;  2E64 A;  5L99 A;  2LRQ A;  2KXD A;  2RQW A;  1VQ4 A;  4HT8 A;  2QQR A;  3J7A F;  4NYX A;  3FRN A;  2OUO A;  4TZ8 A;  2V1Q A;  2QQ9 A;  3O33 A;  4OMQ A;  5COI A;  4M7D A;  3M59 A;  2FPD A;  3M54 A;  5HEN A;  4O70 A;  5D3H A;  3OQ5 A;  5LJ5 e;  1NLO C;  2QXF A;  1YJW Q;  3O37 A;  3L2R A;  4BW2 A;  3A1P A;  5FU6 C;  4LR6 A;  5KH6 A;  4J9E A;  5CU8 A;  2F2W A;  5A0L A;  4C0Z A;  4A4E A;  5GMK l;  2M02 A;  4J6X A;  5GAN h;  5L8R E;  1LPL A;  3GIB A;  5A82 A;  1E6I A;  1NLP C;  3CCU Q;  2EYQ A;  2JM8 A;  3JVL A;  1HJD A;  3RNJ A;  2QQB A;  4BB7 A;  1D3B A;  2J6F A;  1X6G A;  1G3T A;  1LNX A;  4CL9 A;  1R77 A;  2RQV A;  3HTR A;  3NPF A;  1WHK A;  1PKS A;  4MDW A;  3SWN A;  2OTJ Q;  2DRM A;  2OSS A;  5F36 A;  4IKF A;  3RMQ A;  3J81 E;  1XJW B;  1H3Z A;  2MCN A;  3A8H B;  5A83 A;  3SVF A;  5FU7 C;  2DVQ A;  1BK2 A;  3UWN A;  3QXE B;  4HVU A;  4TS8 A;  5FU6 B;  3JCM V;  4E2F B;  3INZ A;  4J7I A;  1VQ9 A;  2OJ2 A;  4UIY A;  3RES A;  4XK8 E;  1PUO A;  2G3R A;  3QUI A;  1PD0 A;  4FT4 A;  1VQN A;  5EWV A;  3BDU A;  4M7D F;  3LXJ A;  4BDZ A;  5D7U A;  1WJR A;  3VJP A;  1ZS5 A;  3D1B A;  2ENM A;  3SDZ A;  2LMJ A;  2RK2 A;  5EPR A;  2CP6 A;  5GAN 3;  4CI0 C;  2LQK A;  3ZEH A;  3G6E Q;  4EMH A;  4M7A A;  2BIV A;  3AT1 B;  2CH4 W;  1Q82 C;  4PK4 A;  3EHQ A;  3Q2F A;  4PLI A;  1R0C B;  4HXJ A;  1KFZ A;  2J06 A;  2X3X D;  3I5R A;  2XMF A;  1PWT A;  5IN1 A;  2F6N A;  3OY9 A;  3I55 T;  3P1D A;  3M0Q A;  2DEU A;  4E7S A;  2HSP A;  2ROT A;  2RJE A;  2QA4 T;  4BHW A;  1QKX A;  3NGP A;  3I35 A;  4UIW A;  3M4Y A;  2R10 A;  5I21 A;  2LT4 A;  1B34 A;  2YDW A;  2YXY A;  2OTL A;  5FU7 B;  2E65 A;  4YAX A;  5HRW A;  4QR5 A;  4QSV A;  4MEN A;  4XYA A;  4C8Q E;  4JJN K;  3JCM h;  4AI6 A;  2JM9 A;  4HXK A;  3VKI A;  2E5K A;  4JUV A;  5IGL A;  1UG1 A;  2DK3 A;  1N9S A;  1BYM A;  4E47 A;  1MMG A;  2K79 A;  4DBH A;  3LWI A;  2EYZ A;  4IR6 A;  5FH7 A;  5HEL A;  1LOJ A;  3OYH A;  2DXT A;  3CC2 Q;  2JTF A;  4B9W A;  2GQI A;  4QY4 A;  3RKX A;  4JRP A;  2YUN A;  4C0D C;  5EU1 A;  5FE0 A;  4ORZ A;  4TU6 A;  4QC1 A;  4C92 C;  2F6J A;  1RL2 A;  3HMF A;  5KO4 A;  4YYN A;  5IAY A;  5HFQ A;  1MNE A;  5EPS A;  3LLR A;  5DFB A;  4R0K A;  3LWH A;  1U5S A;  1YNZ A;  1PC0 A;  4KGX B;  5H1U A;  1E7O A;  1S1N A;  5J3B A;  1BI0 A;  5DLZ A;  1PRL C;  2O4X A;  1VQ7 A;  4M7A F;  2P0K A;  1QVF A;  2I2L A;  1Q7Y C;  3WXM B;  2QI2 A;  4OGJ A;  5GAM j;  1RLP C;  3M58 A;  5EG2 A;  4NS5 A;  4NR6 A;  3MCA B;  3CC7 Q;  1AVZ C;  4PJO E;  4QVC A;  5A5N A;  1W6X A;  2EBP A;  2DET A;  3HP9 A;  3A98 A;  3C94 A;  3JCM W;  2E3K A;  1ZUY A;  2LJ3 A;  1ZSZ C;  2LP5 A;  4BDY A;  3PT9 A;  4M77 E;  5DY7 A;  4LDV A;  3QWY A;  1DJ7 B;  4Q0N A;  5DYC A;  5FE5 A;  3JRZ A;  3S3O A;  3LH0 A;  4C0D B;  1BI2 A;  1M9S A;  2HDA A;  4XAX B;  4XU0 A;  2CP7 A;  4CFL A;  1ABO A;  1M3C A;  2CUB A;  1E6H A;  1Z9Q A;  3VS2 A;  1YIT Q;  2VGN A;  4C92 B;  2C0O A;  1FWZ A;  1MMA A;  1AHJ B;  1CKB A;  1SHF A;  3DWY A;  2GBQ A;  5FE8 A;  2KRS A;  3GBQ A;  5GAN j;  1B07 A;  2WSC E;  2BKD N;  2J7I A;  5FFV A;  3LYI A;  1WJQ A;  1YJ9 T;  2L2P A;  5LJ5 d;  1MGQ A;  3QZV A;  3P8H A;  2M51 A;  2QTV A;  3U5O A;  2XID A;  1VQK T;  2OX7 A;  3A5Z B;  3E9G A;  3FDR A;  1BIA A;  3O35 A;  2EGA A;  1X2K A;  4C92 G;  5FG4 A;  4DOW A;  1Q95 G;  3HSB A;  4IUT A;  1ZSZ B;  2RJD A;  3E2U A;  2XK0 A;  2COY A;  5I29 A;  5J0D A;  4DBQ A;  1JJ2 P;  3O36 A;  5EWH A;  2CZ1 B;  4A4G A;  2K4Y A;  2K57 A;  1W70 A;  3CME Q;  4AKG A;  2F2X A;  3M57 A;  2YW5 A;  5CQ5 A;  1UJ0 A;  4LDF A;  1EFN A;  1ZUU A;  4NQM A;  2OTL Q;  1TS9 A;  4O78 A;  2V8I A;  3P1F A;  2ZPB B;  1BCM A;  1BI3 A;  1IRE B;  2CSI A;  1SRM A;  1I5O B;  4ZC9 A;  2F5T X;  3P8B B;  3FKM X;  4C0F A;  4QEW A;  3CCR A;  2PTK A;  2QYZ A;  4A9L A;  4RTV A;  5FLX E;  5KE2 A;  3PVL A;  1QP3 A;  2NXB A;  1VQP A;  5D3J A;  1IGQ A;  3EH1 A;  3UV5 A;  1JB0 E;  5FH8 A;  3SEM A;  5DYA A;  5F63 A;  5LL6 S;  1S72 Q;  4A9M A;  5ACY A;  1YWO A;  5C85 A;  2CSQ A;  1NG2 A;  3A8M B;  5IHK A;  1VQM T;  4CUU A;  2ECZ A;  4OMM A;  4E96 A;  2MWP A;  4L6V 5;  1AWJ A;  2MIO A;  2EWN A;  2DAQ A;  5CAI A;  1FXX A;  4A4K A;  5GMK h;  4BE1 A;  2FZG B;  5FFW A;  1VQ7 Q;  5D24 A;  3V8J A;  1M8V A;  1G3Y A;  4NL2 A;  3OYN A;  3QZ5 B;  3TLP A;  4M78 C;  4A9E A;  3SVG A;  4A9J A;  5C4Q A;  4L5G A;  2YUP A;  1ZBX A;  5IBN A;  4MR5 A;  3CD6 A;  1D0X A;  4E7I A;  4YY4 A;  2XIC A;  2VKN A;  2VC8 A;  1NJI C;  4HCZ A;  5CKE A;  3VUZ A;  5E7D A;  3TCJ A;  3RIR A;  4BE2 A;  5HM0 A;  5I1Q A;  4IOQ A;  4O5V A;  4PCI A;  2BE7 D;  5I2S A;  1EQF A;  3RR6 A;  3JSC A;  4KUL A;  2RPN A;  2RNX A;  1MMN A;  2VGM A;  5HQ7 A;  3H0I A;  3CMA Q;  3VKH A;  1VQ6 Q;  2AKK A;  4V2S A;  4ELZ C;  2YT6 A;  5I7X A;  5CUC A;  4NXJ A;  2L8D A;  1OX9 A;  1K76 A;  1NZ9 A;  2KNB B;  2ED1 A;  4QR4 A;  4FT2 A;  4KUD K;  1UTI A;  4FSX A;  5DKD A;  1C1A A;  2JMA A;  5C7N A;  1SKU B;  3H0H A;  2RHY A;  4M78 B;  3UVX A;  1G83 A;  4J3I A;  5IXF A;  2KSS A;  3VS7 A;  4C66 A;  1UGP B;  4E7K A;  3C4S A;  2MMP A;  2YDL A;  5LJ5 g;  3RCW A;  3CC4 T;  5E9L A;  2HCK A;  4C92 A;  4YBM A;  4Z02 A;  1YHQ Q;  2QTX A;  1SHG A;  4ATO A;  1PSE A;  4F16 A;  4J9G A;  4UYD A;  1SSF A;  4OB3 B;  5F60 A;  2CP3 A;  3V8L A;  1RAA B;  5DKH A;  4UIU A;  3FLG A;  5GAO n;  4M7D E;  5LJ3 d;  1M1G A;  5FRO A;  1VQO Q;  2HAX A;  2KGT A;  4M78 G;  2QG9 B;  3RER A;  1WJS A;  4O7C A;  1Z9Z A;  3URG A;  5A0G A;  1WDX A;  3FC3 A;  1TH7 A;  2JOY A;  2M9U A;  1PSF A;  5FE1 A;  5DX4 A;  1ZX6 A;  1PD1 A;  4PFZ A;  5E9M A;  1NPR A;  4RTU A;  4YBS A;  5L8U A;  2DKG A;  5FRM A;  2HNI A;  1ZSZ A;  4XTX A;  1WI7 A;  3GNG A;  1OU8 A;  5HY6 A;  3OYF A;  4LZR A;  2EYW A;  4J0S A;  2EJ9 A;  2DD4 A;  3OYK A;  3OYE A;  3M0S A;  3CQT A;  4OML A;  3KFV A;  1VQL A;  4TTE A;  3GLX A;  4AFS C;  1WX6 A;  3V7R A;  2EQM A;  3CCS T;  3R6N A;  4UYE A;  1Y7X A;  3VS0 A;  1U1S A;  3OYC A;  1SG5 A;  2EAY A;  5KCH A;  4CUS A;  3OYL A;  1RAB B;  1VIE A;  1Q86 C;  4HBW A;  1G8X A;  5EGU A;  2RN8 A;  4C92 F;  5GAO p;  2H60 A;  5D6Y A;  5EK9 A;  5L23 A;  5IGM A;  2RH2 A;  1M90 C;  2E41 A;  1VQ5 T;  5EV9 A;  2EKO A;  5ECA A;  2RK1 A; 
#chains in the Genus database with same CATH homology
 2CZ0 B;  1XQH A;  4M7A E;  4KBM B;  4RG8 A;  4AKN A;  4IR4 A;  3VUB A;  5E3D A;  2LQ8 A;  3VYH B;  4XUB A;  2X4X A;  4DQ2 A;  5F1H A;  3CCQ T;  2I8N A;  5GMK j;  5A5P A;  1JSP B;  2DVR A;  3TRE A;  3RKY A;  4X2I A;  1YJN A;  4QST A;  2KK4 A;  5L98 A;  1YJW A;  4BW1 A;  2R5A A;  1BI1 A;  3PFS A;  4C67 A;  2YEM A;  2FHD A;  5ENC A;  4M77 F;  4TYL A;  4XY9 A;  2R58 A;  4BUG A;  4QSR A;  5C8G A;  4IUQ A;  5LJ5 h;  3OYI A;  3OYG A;  2F69 A;  3CCU A;  3SB2 A;  4YY6 A;  2NLU A;  2PQW A;  4ZGJ B;  3BDL A;  5ETD A;  3HHT B;  4L59 A;  1ZHI A;  5A5R A;  2G4A A;  4HCC A;  2OTJ A;  4C8Q D;  1N8R C;  2QEX T;  4XU1 A;  4CRI A;  4QC3 A;  3C95 A;  5LJ3 g;  4NRB A;  4LDX A;  4QR3 A;  3G4S T;  4M78 A;  5CCA A;  1K9M C;  1YI2 T;  1WQ7 A;  2JN0 A;  4PY6 A;  5FBX A;  2LCC A;  3X28 B;  1U8R A;  4UIT A;  4Q5W A;  3ZBD A;  4KUI A;  4ZW1 A;  4A9N A;  3MP8 A;  4JLG A;  4MML A;  5C6S A;  3CCJ T;  3L1A A;  2K3X A;  4ZGE B;  3DB4 A;  3S3N A;  4OB0 B;  3I56 T;  2GFU A;  5DKC A;  3JB9 J;  2RHU A;  3LGL A;  1VQ4 T;  4BE0 A;  5F3A A;  4XY8 A;  3DB3 A;  5F1L A;  2Y4X A;  4MZP A;  4PJO D;  2KY9 A;  5CKH A;  4DA4 A;  3RKW A;  5GAM f;  5ETB A;  2D6F A;  5CFW A;  2DD5 A;  5CQA A;  4M77 D;  3MXF A;  3ZFJ A;  2AHJ B;  3X24 B;  5D6X A;  4ALH A;  4J6Y A;  2ZPG B;  4LYI A;  2XDD A;  2DTO A;  4M78 F;  5KCO A;  2K5I A;  3CC2 A;  1WNL A;  3DLL A;  4ZTJ A;  3QZ9 B;  4NUC A;  5GAN f;  4N4G A;  4YYG A;  4JDS A;  5GAO q;  2P4T A;  1YIJ T;  1FX7 A;  4PL6 A;  5EIC A;  3UVW A;  2LVM A;  4FM4 B;  4YAB A;  2XI9 A;  1I5L A;  3MUK A;  5ENF A;  3LQI A;  5GAO r;  5CUD A;  4UYF B;  4WHU A;  1VQ9 T;  3CC7 A;  2RNW A;  2JVV A;  4ZQL A;  1VQN T;  4E7L A;  5E73 A;  4A9O A;  2F5K A;  3L2W A;  1WUG A;  3OA6 A;  4EDU A;  5CQ8 A;  4LYS A;  1YIT A;  4QSS A;  4OGE A;  2X4Y A;  1M4Z A;  5M9O A;  3PIO A;  5KTX A;  4O6J A;  5EA1 A;  4QUU A;  4F3I A;  2PUO B;  3MEU A;  2GQV A;  5LJ5 j;  2K5L A;  3HFO A;  5J39 A;  5D3S A;  3F70 A;  4KT0 E;  2E5Q A;  1I8F A;  4M75 C;  2E6Z A;  4YK0 A;  5FFY A;  5H1T A;  3OYY A;  1RI0 A;  1X75 C;  3PMT A;  5I7Y A;  4C5E A;  2DIQ A;  3UT1 A;  4MR3 A;  5E9Y A;  3M4G A;  2V8K A;  5DLX A;  3JCM f;  4XUA A;  2R0Y A;  1KHC A;  4QB3 A;  3CME A;  5GAO m;  2KVQ G;  3DAI A;  5GAN 7;  4O76 A;  2WSF E;  4Z6H A;  2XU8 A;  4Z6I A;  1N9R A;  3MEW A;  4QSP A;  4M75 B;  2N9G A;  4JS4 A;  2EIF A;  2Y4Y A;  3LQH A;  3HRS A;  4C92 E;  2DWW A;  1Y07 A;  4GLK A;  5E74 A;  1S72 A;  3HME A;  2CZ7 B;  1GXI E;  5HRX A;  4HBX A;  2BUD A;  5CK9 A;  1JJ2 A;  2XDB A;  4F7U B;  4QSW A;  3L2Z A;  5A5Q A;  3MET A;  3OB9 A;  5D6W A;  5DFC A;  4MR4 A;  4M75 G;  3QO3 A;  4BI8 B;  5I40 A;  5F25 A;  4II1 A;  4RCC A;  3U5J A;  4QBM A;  3UPU A;  1X6O A;  3GPL A;  5LJ3 e;  3PIP A;  4WF2 A;  5EIS A;  4M7D D;  3J80 E;  4XTZ A;  4F7U G;  4J7F A;  3OS1 A;  5E9I A;  3OMC A;  5KHM A;  5FE6 A;  5C87 A;  5KE3 A;  3WVE B;  3OS5 A;  4OGC A;  4OB1 B;  3C12 A;  4X9D A;  5E0R A;  4ELY C;  5C0M A;  4NR8 A;  3CMA A;  1KD1 C;  3E9F A;  1VQ6 A;  4UYF A;  5LJ2 A;  1Q7Y U;  4NUE A;  4NRC A;  4TVR A;  2XDP A;  5CO7 A;  3JB9 G;  4PCE A;  4LD9 K;  5EWW A;  4PTB A;  2GF7 A;  5I88 A;  3MQM A;  5D3N A;  5A7C A;  4NR4 A;  3CCR T;  2E12 A;  2PVO B;  5CUA A;  3RMS A;  5II1 A;  1YHQ A;  4J83 A;  5AD3 A;  5CIU A;  1VQP T;  2ZPF B;  1VQO A;  5A5S A;  4LRG A;  1U1T A;  5FE7 A;  1QVP A;  4N4F A;  4M7A D;  3LJW A;  3QDR B;  2E70 A;  2YQD A;  2VYT A;  1OYX A;  1W2B S;  4IUR A;  3MEA A;  1YJ9 A;  5DW1 A;  3HMH A;  4J1P A;  3CD6 T;  4E7H A;  5LJ0 A;  4YYM A;  3G0L A;  5II2 A;  4MZM A;  4CUQ A;  1XOV A;  2HBP A;  3UVY A;  3LQJ A;  3MB4 A;  4A9F A;  4M78 E;  2YEK A;  4MMK A;  4PKC C;  2GFA A;  4IOR A;  4C5H A;  5CQ7 A;  5HK0 A;  4M75 A;  2A7Y A;  3QZT A;  3V8K A;  4IR5 A;  4UYH A;  5LKZ A;  2K5F A;  4YAD A;  3CCV A;  3UVD A;  1XNI A;  2VXE A;  4FL6 A;  2JUF A;  4F7U A;  4CFK A;  2DEQ A;  3NTI A;  3I3J A;  4BI3 A;  1KHI A;  2JNG A;  3R6O A;  3MUL A;  4KV4 A;  5FG5 A;  5A0D A;  4YC9 A;  3OS0 A;  4OF1 A;  5CUG A;  5GAN 8;  4A9I A;  1K73 C;  2DIG A;  5C89 A;  1VQM A;  3OBY A;  5BT5 A;  3CCE A;  3E19 A;  1NPP A;  4CUR A;  3U5N A;  1KC8 C;  3JCM P;  4QSQ A;  2DZ9 A;  5LVR A;  3QSU A;  4UYG A;  3FIF A;  1M1K U;  5IGN A;  1M5Q 1;  3QII A;  4BAC A;  4PLL A;  4N4H A;  3K2J A;  2EJG A;  1X0J A;  4O75 A;  2DO3 A;  2DXC A;  2ZZD A;  4CUT A;  4NOY A;  5F2P A;  3WVD B;  5A5O A;  4QZS A;  3QHS A;  5K29 A;  3MHX A;  2WAC A;  4FLP A;  2LNV A;  4QNS A;  4TT2 A;  3V7C A;  4EMK C;  4HXN A;  4BI4 A;  2L3R A;  3M55 A;  4FU6 A;  1QVG S;  1BKB A;  4F7U F;  3JCM Q;  5DYX A;  4HKE A;  1VQ8 T;  1G5V A;  3G71 T;  4YYK A;  4OB2 B;  2Y90 A;  2PVG B;  5FE9 A;  5CZG A;  5GAN 4;  2XHC A;  4LD6 A;  3RUX A;  1IZ6 A;  2YHT A;  2KDS A;  1KQ2 A;  1G3S A;  1P92 A;  5CUE A;  2JTM A;  5F61 A;  4LZS A;  1N72 A;  3OMG A;  3UDC A;  5KTU A;  4MEQ A;  4O71 A;  4JRQ A;  5A2Q E;  1I4K 1;  4UIX A;  3NTH A;  2DTI A;  2LC4 A;  3JVJ A;  3CCL A;  4EMK B;  5EVA A;  3O34 A;  4RMO A;  4MDX A;  2CYZ B;  4QYD A;  4IUU A;  3EFS A;  4QUT A;  5HCL A;  5KTW A;  4QVZ A;  4ZN1 A;  5CY9 A;  1YJW T;  1VIF A;  2RHZ A;  3T9N A;  4QYL A;  5ENG A;  4TQN A;  2EJF A;  3VYG A;  4NR5 A;  3JCM J;  2QQA A;  4JRI A;  4X34 A;  3CCU T;  1W2B A;  5I2M A;  5FH6 A;  3P5O A;  5CQ4 A;  2L89 A;  5GAM g;  2OTJ T;  1VUB A;  1KG1 A;  5LJ5 f;  4PS5 A;  5H1V A;  5IG6 A;  5D3L A;  2RO1 A;  5CQ3 A;  5A81 A;  4HXO A;  2DJZ A;  5LJ1 A;  2K3Y A;  2LTO A;  1KQS S;  2WP1 A;  4NYW A;  5F62 A;  3JCM c;  4N3W A;  3UW9 A;  5G4R A;  1Q81 U;  5HKC A;  3G6E T;  5GAN g;  4P5N A;  3LX7 A;  4TT4 A;  5EQ1 A;  1BIB A;  2RO0 A;  2MI6 A;  3HPW A;  4C92 D;  3CBP A;  1JJ2 S;  5CPE A;  4B9X A;  2ZPE B;  2D82 A;  4HBY A;  3KXT A;  4A9K A;  3VU3 C;  4IR3 A;  2EQU A;  5BT4 A;  2MJV B;  1K8A U;  2RHI A;  1WGS A;  3CPF A;  4BW4 A;  1WUM A;  3P1E A;  3CC2 T;  5D3T A;  3CXC A;  1KQ1 A;  1K9M U;  1O75 A;  4C0G A;  1X01 A;  3S6W A;  1ZQ1 A;  2QEX A;  4O77 A;  4D6W A;  3JVM A;  2DZC A;  2RD1 A;  4QSX A;  3MP6 A;  5ENJ A;  3P8D A;  3VV0 A;  5DM7 R;  1QVG A;  4R56 A;  3HL8 A;  4RKU E;  2GRC A;  1WPY A;  3ME9 A;  5DFD A;  5ENB A;  5L97 A;  5EPB A;  3KUF A;  4EMK A;  4NRA A;  3TU4 K;  3CC7 T;  5CKB A;  4HXR A;  3LW5 E;  5A85 A;  1Y96 B;  3JCM g;  2MWO A;  2H3J A;  1UEB A;  4O7B A;  3CCM A;  4JRK A;  3MB3 A;  5DLQ E;  5E9K A;  4GPJ A;  1WQW A;  2OO1 A;  2CS7 A;  5CP5 A;  2E6N A;  1YIT T;  4MEP A;  2A3L A;  5DW2 A;  1HXD A;  3SVH A;  3PGG A;  4Y03 A;  4ZTF A;  4N0A C;  4TU4 A;  5ENH A;  4RG2 A;  3HRT A;  5LJ3 f;  2E7O A;  3GP8 A;  2B8A A;  4HXP A;  5FB0 A;  3H6Z A;  2YLC A;  5GAN 2;  2L84 A;  5DLO A;  5LJ3 h;  2CZ6 B;  2DAT A;  4FIB A;  2IVW A;  4M75 E;  5BT3 A;  5GMK m;  4OP0 A;  5LKU A;  3CME T;  2R0S A;  5CQX A;  2OAU A;  3EAE A;  1YIJ A;  2OTL T;  4NUD A;  4F7U E;  2DVE A;  4LDW A;  1O9S A;  4M78 D;  3OYD A;  2LDM A;  4JS5 A;  4O72 A;  5GAO l;  3QJY A;  3AQA A;  2YLB A;  2ZCF B;  4XU2 A;  3FJP A;  4OVA A;  5I89 A;  1S72 T;  4WHW A;  1V29 B;  3ER0 A;  5J26 A;  1UGQ B;  4YTL A;  4QEV A;  5D7X A;  3L2V A;  1KQS A;  3D7C A;  2HD0 A;  5DY9 A;  2R57 A;  2L5Q A;  2KMT A;  1OZ3 A;  5TB6 A;  5IID A;  3X25 B;  5AME A;  4C5G A;  1VQ7 T;  2X4W A;  2D9E A;  5GAM e;  1LJO A;  2DXU A;  1Q82 U;  3EFR A;  4YH3 A;  2DVS A;  2RI5 A;  5FE3 A;  2DPP B;  4J0R A;  1R8O B;  2R5M A;  2ZPI B;  4ALG A;  3CPW S;  2X4J A;  2RJF A;  4BW3 A;  3FB9 A;  3L42 A;  4RCB A;  1QP2 A;  3FEO A;  4Y91 A;  5TCM A;  4A53 A;  5CS8 A;  5G4S A;  3ASK A;  4O7E A;  5L8T A;  4C8Q C;  4YYD A;  5AMF A;  4QEU A;  3AAD A;  3I55 A;  3U5P A;  3GOX A;  3QJ6 A;  2QQS A;  5CQ6 A;  2EQJ A;  2L85 A;  2QA4 A;  3MO8 A;  1G3W A;  5GAN e;  3CMA T;  1VQ6 T;  3OSS C;  1UGR B;  5FRN A;  2IG0 A;  2P0Q A;  1Y96 A;  5E3G A;  4O7F A;  4JLI A;  3AHU A;  3JAM E;  4XTY A;  4YYJ A;  2M0O A;  1N27 A;  4DOV A;  3MP1 A;  3DKM A;  3Q1J A;  5EWD A;  3IU5 A;  4NQN A;  1YHQ T;  3PTA A;  2LT1 A;  5CVI A;  5L96 A;  1JBM A;  1YBY A;  4C8Q B;  4PJO C;  1VQO T;  2O01 E;  2L5E A;  1YCY A;  3S92 A;  2ZGW A;  4IUP A;  5D26 A;  5CGP A;  4IOO A;  5D0C A;  2LCL A;  3QBY A;  4M77 C;  1NE8 A;  4CUP A;  2RA2 A;  4J6W A;  4YYH A;  2D9T A;  4E7J A;  1I81 A;  2KTB B;  5LJ3 j;  2EFI A;  4OGI A;  4C8Q G;  3JVK A;  5FE4 A;  5HJC A;  5HFR A;  2CGH A;  2X35 A;  1KD1 U;  4HT9 A;  4HBV A;  2WSE E;  4YAT A;  2EQK A;  3OS2 A;  5HRV A;  4NYV A;  3QZS A;  3OW2 S;  3JCM e;  3OYA A;  5CKF A;  4PJO B;  4N0A A;  4NL3 A;  4RVR A;  3ONI A;  4WIV A;  3M53 A;  4OMF B;  4M77 B;  5CUB A;  1UGS B;  1VQK A;  5FDZ A;  3HRU A;  3CCV T;  1OI1 A;  3QYG B;  5GMK i;  5HQ6 A;  3QG1 A;  3JB9 I;  4MR6 A;  4YBT A;  2RJC A;  4EMG A;  5FG6 A;  4PJO G;  5GAN 5;  5KU3 A;  3X26 B;  5GAN 6;  2K2V A;  2E7N A;  2PU9 B;  4YYI A;  3BW1 A;  4BD3 A;  4C5I A;  3QPH A;  3O8V A;  4M77 G;  2MAM A;  3CEY A;  2KAF A;  2RI3 A;  3N5B B;  3A8L B;  3CCE T;  3G0J A;  5FE2 A;  2QDY B;  3PNW C;  4KV1 A;  4UC4 A;  2I7K A;  3A8G B;  3GF5 A;  3NFC A;  1UB4 A;  2XKO C;  2FSA A;  5GAM d;  4QSU A;  4LDU A;  2LSP B;  5ENE A;  1M1K C;  5EM3 A;  4TZ2 A;  1OZ2 A;  4CLB A;  3OYJ A;  3LGF A;  1QW1 A;  3CPW A;  4J8O A;  4O74 A;  4N4I A;  4QQD A;  4HXS A;  3BFM A;  4QVD A;  4HXL A;  1NJI U;  5CKD A;  4ME7 A;  4EPC A;  3L2U A;  3CXC S;  3PMI A;  3M9Q A;  3M56 A;  4BJX A;  4M75 F;  3OBW A;  5GAN d;  4C8Q A;  2WP2 A;  3NXB A;  1K73 U;  5HEM A;  4IUV A;  1VQL T;  2P0P A;  4TT6 A;  4Y28 E;  4XQ3 A;  2DKW A;  4XU3 A;  1EIF A;  1KC8 U;  2VUB A;  4HA8 A;  3OSV A;  2YYN A;  4A4F A;  5I80 A;  3CCL T;  3E1S A;  2DVV A;  4PKL A;  3H8Z A;  5CQY A;  2RFJ A;  2FL7 A;  5DBM A;  5CR2 A;  4QQG A;  5EP7 A;  4HCB A;  2RS9 B;  3JB9 H;  5AYF A;  4M7D C;  3S3M A;  5JI8 A;  2DXB A;  4X9C A;  2FB7 A;  5ENI A;  4PNO A;  4A4H A;  4DON A;  1F68 A;  3MEV A;  3U5K A;  4Z1S A;  1Y71 A;  5HK3 A;  2RNY A;  3JB9 F;  3CC4 A;  2RHX A;  3KBG A;  4Z93 A;  5H85 A;  4PJO A;  5DYU A;  5I86 A;  5GMK e;  3ZYU A;  5IGK A;  3NTK A;  5HQ5 A;  2XD0 A;  2YRV A;  4A54 A;  3QKJ A;  3M5A A;  4LDY A;  3CBO A;  1YJN T;  1XTD A;  4M77 A;  3HFN A;  2GCX A;  4C8Q F;  1VQ8 A;  2M1H A;  2PUK B;  4KCX A;  3G71 A;  2D0Q B;  3SWN C;  2E1H A;  5CRZ A;  5D3P A;  4R55 A;  3JCM d;  3SD4 A;  3OW2 A;  4M7D B;  4XTU A;  3OYB A;  2RM4 A;  4M75 D;  2XG8 D;  3U5M A;  5HLS A;  1Q86 U;  2M16 A;  5LKX A;  1H64 1;  4HXM A;  3CCS A;  5FB1 A;  2CKK A;  3QYH B;  4OUF A;  1M90 U;  1N6A A;  4BY6 C;  5LUU A;  4M7A C;  4M7D G;  2HQX A;  4QQ6 A;  1D3B B;  1Q81 C;  3GNF B;  3V7S A;  5EI4 A;  2RI2 A;  2RB6 A;  4PJO F;  3OYM A;  4A9H A;  3U5L A;  4GY5 A;  1VQ5 A;  3SWN B;  4ZN3 A;  2LX9 A;  2VV5 A;  5I83 A;  3TEE A;  3A8O B;  4Q0O A;  2VXF A;  3L2Q A;  2YEL A;  2V8J A;  3JB9 D;  2JZ2 A;  4XTW A;  2E10 A;  2KQW A;  3SFM A;  3DLM A;  4LZ2 A;  4UIZ A;  3CCQ A;  5D3R A;  1HK9 A;  5AD2 A;  2R0V A;  3JCM b;  3GG3 A;  1K8A C;  2C06 A;  4BY6 B;  2ZPH B;  3BY7 A;  4M7A B;  3HKS A;  5CRM A;  4J5Y A;  2PVD B;  4LC2 A;  2FVU A;  2FYK A;  4O7A A;  1N8R U;  2MF2 A;  5LVQ A;  5EWC A;  1MHN A;  4QW2 A;  2RI7 A;  1B34 B;  4M7A G;  4NR7 A;  3P1C A;  3UV4 A;  3G6E A;  4MEO A;  1JRI A;  1JM4 B;  1QVF S;  4VUB A;  3CCM T;  4ZGD B;  5JWM A;  3G4S A;  1YI2 A;  3G7Z A;  4NR9 A;  3CBM A;  5E9V A;  2DTH A;  4UIV A;  3S91 A;  3UV2 A;  1W4S A;  5IT9 E;  5F5Z A;  4Z1Q A;  3IU6 A;  3Q2E A;  3JCM X;  4YH4 A;  2HQE A;  4LYW A;  4MZT A;  3X20 B;  4XTV A;  5LKT A;  2O4X B;  3CCJ A;  5GAM h;  5CQT A;  1M1F A;  3I56 A;  5CTL A;  5D25 A;  2E64 A;  5L99 A;  2LRQ A;  1VQ4 A;  4HT8 A;  2QQR A;  3J7A F;  4NYX A;  3FRN A;  2OUO A;  4TZ8 A;  2QQ9 A;  3O33 A;  5COI A;  4M7D A;  3M59 A;  3M54 A;  5HEN A;  4O70 A;  5D3H A;  3OQ5 A;  5LJ5 e;  2QXF A;  3O37 A;  3L2R A;  4BW2 A;  5FU6 C;  4LR6 A;  5KH6 A;  5CU8 A;  5A0L A;  4C0Z A;  4A4E A;  5GMK l;  4J6X A;  5GAN h;  5L8R E;  3GIB A;  5A82 A;  1E6I A;  2EYQ A;  3JVL A;  2QQB A;  4BB7 A;  1D3B A;  1G3T A;  1LNX A;  4CL9 A;  4MDW A;  3SWN A;  2OSS A;  5F36 A;  4IKF A;  3RMQ A;  3J81 E;  1H3Z A;  3A8H B;  5A83 A;  3SVF A;  5FU7 C;  2DVQ A;  3UWN A;  3QXE B;  4TS8 A;  5FU6 B;  3JCM V;  1VQ9 A;  3INZ A;  4J7I A;  4UIY A;  3RES A;  4XK8 E;  2G3R A;  3QUI A;  4FT4 A;  4M7D F;  1VQN A;  5EWV A;  3BDU A;  3LXJ A;  4BDZ A;  1WJR A;  3VJP A;  1ZS5 A;  3SDZ A;  2RK2 A;  5EPR A;  5GAN 3;  4CI0 C;  2LQK A;  3ZEH A;  4EMH A;  4M7A A;  2BIV A;  1Q82 C;  3Q2F A;  4PLI A;  5IN1 A;  2F6N A;  3OY9 A;  3I55 T;  3P1D A;  2RJE A;  2QA4 T;  4BHW A;  3M4Y A;  4UIW A;  2R10 A;  5I21 A;  2LT4 A;  1B34 A;  2YDW A;  2OTL A;  5FU7 B;  2E65 A;  4YAX A;  5HRW A;  4QR5 A;  4QSV A;  4MEN A;  4XYA A;  4C8Q E;  4JJN K;  3JCM h;  4HXK A;  3VKI A;  4JUV A;  5IGL A;  2DK3 A;  1N9S A;  1BYM A;  4E47 A;  3LWI A;  4IR6 A;  5FH7 A;  5HEL A;  1LOJ A;  3OYH A;  2DXT A;  2JTF A;  4B9W A;  4QY4 A;  3RKX A;  4JRP A;  4C0D C;  5EU1 A;  5FE0 A;  4TU6 A;  4QC1 A;  4C92 C;  2F6J A;  1RL2 A;  3HMF A;  5KO4 A;  4YYN A;  5IAY A;  5HFQ A;  5EPS A;  3LLR A;  5DFB A;  3LWH A;  5H1U A;  5J3B A;  1BI0 A;  5DLZ A;  2O4X A;  1VQ7 A;  4M7A F;  2P0K A;  1QVF A;  2I2L A;  1Q7Y C;  3WXM B;  2QI2 A;  4OGJ A;  5GAM j;  5EG2 A;  3M58 A;  4NS5 A;  4NR6 A;  3MCA B;  4PJO E;  4QVC A;  5A5N A;  3HP9 A;  3C94 A;  3JCM W;  2E3K A;  4BDY A;  3PT9 A;  4M77 E;  5DY7 A;  4LDV A;  1DJ7 B;  4Q0N A;  5DYC A;  5FE5 A;  3JRZ A;  3S3O A;  3LH0 A;  4C0D B;  1BI2 A;  1M9S A;  4XAX B;  4XU0 A;  4CFL A;  2VGN A;  4C92 B;  1FWZ A;  1AHJ B;  3DWY A;  5FE8 A;  5GAN j;  2WSC E;  2BKD N;  5FFV A;  3LYI A;  1WJQ A;  1YJ9 T;  5LJ5 d;  1MGQ A;  3QZV A;  3P8H A;  3U5O A;  2XID A;  1VQK T;  3A5Z B;  3E9G A;  3FDR A;  1BIA A;  3O35 A;  4C92 G;  5FG4 A;  4DOW A;  3HSB A;  4IUT A;  2RJD A;  2XK0 A;  5I29 A;  5J0D A;  3O36 A;  5EWH A;  2CZ1 B;  4A4G A;  2K4Y A;  2K57 A;  3M57 A;  2YW5 A;  5CQ5 A;  4LDF A;  4NQM A;  4O78 A;  2V8I A;  3P1F A;  2ZPB B;  1BI3 A;  1IRE B;  4ZC9 A;  2F5T X;  3P8B B;  3FKM X;  4C0F A;  4QEW A;  3CCR A;  4A9L A;  5FLX E;  5KE2 A;  1QP3 A;  2NXB A;  1VQP A;  5D3J A;  3UV5 A;  1JB0 E;  5FH8 A;  5DYA A;  5F63 A;  5LL6 S;  4A9M A;  5ACY A;  5C85 A;  3A8M B;  1VQM T;  4CUU A;  4E96 A;  2MWP A;  4L6V 5;  2EWN A;  2DAQ A;  5CAI A;  1FXX A;  4A4K A;  5GMK h;  4BE1 A;  5FFW A;  5D24 A;  3V8J A;  1M8V A;  1G3Y A;  4NL2 A;  3OYN A;  3QZ5 B;  3TLP A;  4M78 C;  4A9E A;  3SVG A;  4A9J A;  5C4Q A;  4L5G A;  1ZBX A;  5IBN A;  4MR5 A;  3CD6 A;  4E7I A;  4YY4 A;  2XIC A;  2VC8 A;  1NJI C;  4HCZ A;  5CKE A;  3VUZ A;  5E7D A;  3TCJ A;  3RIR A;  4BE2 A;  5HM0 A;  5I1Q A;  4IOQ A;  4O5V A;  4PCI A;  5I2S A;  1EQF A;  3JSC A;  4KUL A;  2RNX A;  2VGM A;  5HQ7 A;  4V2S A;  4ELZ C;  5I7X A;  5CUC A;  4NXJ A;  2L8D A;  1NZ9 A;  4QR4 A;  4FT2 A;  4KUD K;  4FSX A;  5DKD A;  5C7N A;  2RHY A;  4M78 B;  3UVX A;  4J3I A;  2KSS A;  4C66 A;  1UGP B;  4E7K A;  3C4S A;  2MMP A;  5LJ5 g;  3RCW A;  3CC4 T;  5E9L A;  4C92 A;  4YBM A;  4Z02 A;  2QTX A;  4ATO A;  1PSE A;  4UYD A;  1SSF A;  4OB3 B;  5F60 A;  3V8L A;  5DKH A;  4UIU A;  3FLG A;  5GAO n;  4M7D E;  5LJ3 d;  1M1G A;  5FRO A;  2HAX A;  4M78 G;  3RER A;  1WJS A;  4O7C A;  3URG A;  5A0G A;  3FC3 A;  1TH7 A;  2JOY A;  2M9U A;  1PSF A;  5FE1 A;  5DX4 A;  5E9M A;  1NPR A;  4YBS A;  5L8U A;  2DKG A;  5FRM A;  2HNI A;  4XTX A;  3GNG A;  5HY6 A;  3OYF A;  4LZR A;  4J0S A;  2EJ9 A;  2DD4 A;  3OYK A;  3OYE A;  1VQL A;  4TTE A;  3GLX A;  3V7R A;  2EQM A;  3CCS T;  4UYE A;  1Y7X A;  1U1S A;  3OYC A;  2EAY A;  5KCH A;  4CUS A;  3OYL A;  1VIE A;  1Q86 C;  4HBW A;  5EGU A;  4C92 F;  5GAO p;  2H60 A;  5D6Y A;  5EK9 A;  5IGM A;  2RH2 A;  1M90 C;  2E41 A;  1VQ5 T;  5EV9 A;  2EKO A;  2RK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...