4N4HA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.1k36me3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
188
Chain Sequence
QEMGTYLRFIVSRMKERAIDLVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 66
structure length 188
sequence length 209
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4hA02
5CUGA 4F3IA 5J26A 3MQMA 5EWCA 3U5MA 2X4WA 4HXNA 3MEVA 2DAQA 3LLRA 5ENGA 4LYSA 4EDUA 2R0SA 4YY4A 1X0JA 5CQAA 4QC3A 2L5EA 5CUDA 2K3YA 5E3DA 5HLSA 3NTIA 5LKUA 3AQAA 3LQHA 5ETDA 4HXOA 4C5IA 3FKMX 5FFVA 5BT3A 2RHXA 4UIVA 2BUDA 1N27A 4YYKA 2RI3A 4BD3A 5D6WA 3P1FA 4A4FA 5C7NA 4WHWA 2RFJA 4NYWA 4XUAA 2LSPB 4L59A 2E7OA 2YEKA 5EI4A 2RI5A 4HXKA 4TU6A 4YBSA 5CRMA 5F62A 5COIA 3NTKA 4PLIA 3P1CA 5FRMA 4TQNA 4A9NA 5FFWA 5FFYA 2EQJA 5EP7A 4OGJA 4GY5A 5EQ1A 5AMFA 5ENFA 3QIIA 5ENBA 5FG5A 4IR4A 5IGNA 2RJCA 4J3IA 3L2UA 3OYMA 4C5GA 3ASKA 4NR5A 3OYNA 4NRAA 2G4AA 5DLZA 5I1QA 4BW2A 5HFRA 3PFSA 4PLLA 5H85A 5CIUA 5A7CA 5EWDA 4X2IA 4Z1SA 2LCCA 4J0SA 3LGLA 5E3GA 3NTHA 5LVRA 4TS8A 3Q1JA 2I8NA 3AADA 3OB9A 4UIZA 5L97A 5I40A 5II1A 4NRCA 5I29A 4Q5WA 3MEUA 5F3AA 5KHMA 5H1UA 5FE8A 4BE2A 3SD4A 5CQ6A 4QEWA 5L99A 5FBXA 3TLPA 5J39A 4QSWA 4QSVA 5LKZA 4QR4A 5FROA 5LJ2A 4NUCA 2MJVB 4FLPA 5C85A 3MP1A 5C0MA 5CQ8A 3O37A 4O76A 4CRIA 5E9LA 4QUUA 2LRQA 2F6JA 4MR5A 2RS9B 5E9KA 5L98A 5G4RA 1KHCA 3OYIA 5EU1A 3UV4A 5L8TA 2X4YA 5KCHA 5E74A 5IBNA 5D26A 4Q0OA 4YABA 3QBYA 5FE7A 5LVQA 5EVAA 2D9EA 3OY9A 4QSQA 5D0CA 2RNXA 3NXBA 5F1HA 5BT4A 5KE2A 4LD6A 4KV4A 4O7EA 5FE4A 4KCXA 4XYAA 5DX4A 4LR6A 2RO1A 1OI1A 2RJDA 5AMEA 3KUFA 5HQ5A 4Z6IA 2YRVA 3O33A 2EQMA 5CUEA 5HCLA 2M0OA 4TTEA 5FB0A 4LZ2A 3OYBA 3Q2FA 3MB4A 2DVQA 3S91A 3OYFA 4Z93A 2X35A 5G4SA 4BDZA 5DYXA 5A5PA 5HQ6A 5IGLA 4O75A 5C6SA 4NYXA 5FH6A 3L2QA 5C8GA 4UITA 4PY6A 5CTLA 3QZTA 5FH7A 4O7BA 5D3TA 2PQWA 1SSFA 5KO4A 5CQ5A 5CUCA 5HENA 3MO8A 3DLMA 4OGIA 4NR7A 5HRXA 2YW5A 3LQIA 4IOOA 4O77A 5E9MA 5FG6A 4YY6A 4O7FA 5HFQA 4TZ2A 4NS5A 3M9QA 3S6WA 5ENEA 3P1DA 5ACYA 3BDLA 3E9FA 4J1PA 5CZGA 2E7NA 4QC1A 2EFIA 5EGUA 4ALGA 4YC9A 4IOQA 4MR3A 3LX7A 4O71A 3U5PA 5EK9A 3O8VA 5IN1A 5I83A 4UYEA 2R58A 1N72A 1EQFA 2YQDA 3O35A 5HRWA 2LVMA 4LDFA 2HQEA 2WP1A 2P0KA 3UT1A 4NR4A 5F61A 4HCZA 3RCWA 5IGMA 2L89A 5DKHA 3JVJA 5F25A 4QQ6A 4QVZA 5D6XA 3ONIA 5CRZA 2DVSA 4Z1QA 2GF7A 3UV5A 4ZQLA 3U5KA 3OYJA 5E9IA 4PS5A 4YYHA 3OS0A 4MENA 4UIWA 3MUKA 3OA6A 4MEQA 5A5OA 2WACA 2RO0A 4A9MA 5CUBA 5FB1A 5I86A 3HMEA 4OVAA 5F1LA 3UVWA 5A5RA 4B9WA 5A85A 5HEMA 3JVLA 4BDYA 5EWVA 3MP8A 3OQ5A 2L85A 1JSPB 2LDMA 5L96A 2WP2A 4CFLA 4X34A 5CQ3A 4QSRA 5EPBA 5FG4A 4B9XA 4NXJA 2RI2A 5EICA 4MEOA 1RI0A 4C5EA 4LYIA 3SVGA 5L8UA 4WHUA 5C87A 4LYWA 3U5NA 4HBYA 4QBMA 5FH8A 4QR5A 3L2RA 5DKDA 5HELA 2QQRA 4O7CA 4ZC9A 5FE9A 4UYHA 5CY9A 5I88A 4YADA 3UWNA 2QQSA 2GFUA 3LJWA 5D24A 5DW1A 4HXRA 2DKWA 4UYGA 3SVHA 4BHWA 3QZSA 2D82A 5A81A 4LC2A 3P8DA 5BT5A 5D3HA 3U5JA 2JTFA 2D9TA 3LH0A 5CU8A 4LZRA 2FHDA 4QQDA 4QQGA 4QUTA 5D3NA 2HQXA 3OYAA 5EV9A 3UVDA 2RNYA 3EAEA 3UW9A 4ZTFA 4UIXA 3OMGA 5F2PA 4Q0NA 5TB6A 5KTWA 4CURA 2EQKA 3UV2A 4A9FA 5AD2A 4O70A 4XUBA 5IG6A 3META 2NXBA 2EQUA 2XK0A 5FE6A 2RHIA 2L8DA 4CLBA 4NR6A 3U5OA 5KH6A 5FDZA 4HXPA 4NYVA 2NLUA 3DAIA 4CUPA 2VYTA 5TCMA 4RG2A 3DWYA 1OYXA 5DFCA 5FE0A 5A5SA 3OYHA 4BE0A 1OZ2A 4PL6A 5KTUA 4Z02A 3MB3A 2IG0A 4QZSA 4MR4A 3F70A 3MEAA 5DKCA 4QW2A 2RNWA 4QY4A 2L84A 3D7CA 5D3RA 1WJSA 5ENHA 3HMFA 2DATA 4BW3A 2E5QA 3C4SA 3OYKA 1OZ3A 5EM3A 4AKNA 4DONA 5A5QA 4A4GA 4E7KA 4FL6A 5CS8A 2M1HA 3IU6A 5DY7A 4A9OA 5CQ4A 4HXMA 4ZTJA 4QSPA 4N4FA 5FE1A 5I80A 4NQMA 4IR5A 5F63A 4TT4A 5LKXA 4TT6A 4A9HA 3O34A 5J0DA 1WUMA 5CUAA 3UVXA 4A9IA 2CKKA 2EKOA 5A82A 5F60A 2XDPA 3PMIA 4E7IA 4Y03A 3FDRA 5A83A 3OYCA 4UC4A 5E9VA 5EWWA 4IURA 4HBWA 4PKLA 2GFAA 4O74A 4N4GA 5DFDA 4NQNA 1XNIA 4YYDA 4IR6A 3PNWC 4CUTA 4YBMA 4A9JA 5KCOA 4BE1A 4HXLA 5A5NA 4FU6A 3OYGA 2E6NA 3Q2EA 1G5VA 2MWOA 4YAXA 5C4QA 4IKFA 4QEUA 3JVMA 5D3PA 5E0RA 4N4IA 2DIGA 4KV1A 4LZSA 4IORA 2R0YA 3FEOA 2DIQA 5K29A 4UYFB 2MWPA 2YEMA 4QNSA 3UVYA 5JWMA 2R57A 4MEPA 2RHYA 3HMHA 4QSTA 3SVFA 4IUTA 4UYFA 4TT2A 4BW4A 1H3ZA 2X4XA 5DYCA 2RJEA 3S3MA 5KTXA 4WIVA 4IUUA 4A4EA 3P1EA 5EWHA 3OMCA 5H1VA 5LKTA 3QKJA 4NR8A 3P8HA 2F5KA 4ZW1A 4TZ8A 5FE3A 3MULA 4PCEA 3L2VA 5HRVA 2RHUA 3QZVA 4YATA 4NRBA 4E96A 4O7AA 3FLGA 3LQJA 3LXJA 3L42A 4J0RA 3CEYA 5CQTA 2FSAA 5D7XA 1E6IA 5CQ7A 4NUDA 5E73A 2N9GA 4UIYA 4XY8A 5HQ7A 2L3RA 5DBMA 4PCIA 1WJQA 4IUVA 3S3NA 2OSSA 5HM0A 3PMTA 5FE2A 4A4HA 4E7LA 3LGFA 5I89A 3S92A 4N4HA 4A9EA 4RVRA 4C67A 5CPEA 3JVKA 4MR6A 4HXSA 4GPJA 5AD3A 5FRNA 5F5ZA 2R10A 4QEVA 5C89A 1ZS5A 3G0LA 3H6ZA 3MEWA 3GOXA 2RI7A 3OS2A 5DW2A 2BKDN 2R0VA 5KU3A 5IGKA 5EISA 2DWWA 4YBTA 4C5HA 4II1A 3MP6A 2O4XB 3DB4A 4YYJA 3OYLA 3IU5A 2OO1A 4N3WA 2RJFA 5FE5A 4IUQA 3OS1A 3ZYUA 2YELA 4QYLA 3E9GA 4BW1A 2F6NA 4YYNA 1WUGA 2O4XA 4ALHA 4O72A 5ENCA 2JZ2A 2E3KA 3G0JA 2GRCA 5CP5A 4YH3A 4C66A 2K3XA 3O36A 4UYDA 4LRGA 4O78A 5E7DA 4YYIA 5LJ0A 4A9KA 5D3LA 4HBVA 3GG3A 3I3JA 4CL9A 3LYIA 2DVRA 5CGPA 5I7YA 5IAYA 4E7HA 3P5OA 5DLXA 4CUSA 2R5MA 4QB3A 2RHZA 2LTOA 4NR9A 1JM4B 5KE3A 4E7JA 5DYAA 5LJ1A 2B8AA 3ME9A 5D25A 2BIVA 4TU4A 2M16A 2YDWA 4Z6HA 3ZEHA 5LUUA 2OUOA 1WGSA 4QSXA 4IR3A 2H60A 5F36A 5HJCA 3K2JA 3FC3A 5DFBA 5D3SA 3QJ6A 3DB3A 2YYNA 4YYMA 1MHNA 4XY9A 3L2WA 5EPRA 5EPSA 2R5AA 3OYEA 5CFWA 4YK0A 1WJRA 3S3OA 3U5LA 5D3JA 4CFKA 5EA1A 5IIDA 5M9OA 4BACA 4QYDA 4UIUA 2DVVA 2KTBB 5H1TA 1F68A 5ETBA 5I7XA 4HBXA 4YH4A 5II2A 4CUUA 5JI8A 2I7KA 4PTBA 4QSSA 4YYGA 4NUEA 4OUFA 2G3RA 4A9LA 5DYUA 4QSUA 4TYLA 3MXFA 4BJXA 3H8ZA 3OYDA 5ENIA 5ENJA 5E9YA 5D6YA 4IUPA 4QR3A 4CUQA
chains in the Genus database with same CATH superfamily
4F3IA 1D0XA 2LT4A 2DAQA 4LYSA 2DX1A 4QC3A 3JCMP 2EYWA 4ESRA 2K3YA 1K8AR 4M7AE 5HLSA 2QDLA 1HYOA 1MMDA 3VRYA 1G2BA 2QAZA 1H92A 4CC4B 5GANf 2RHXA 4UIVA 3X25B 1N27A 4YYKA 3I56T 5D6WA 3P1FA 4A4FA 3CXCS 2E3IA 5C7NA 2DNUA 4HCCA 4NYWA 4XUAA 4D8KA 2E4HA 2E7OA 1HD3A 2YEKA 5EI4A 4EMGA 4LUDA 1X2QA 2W0ZA 4RTVA 2CH4A 2ED0A 1SG5A 4PLIA 1GBQA 2KRSA 2L0AA 2QASA 3JAME 5FFYA 3OSVA 2MCNA 4A53A 3TREA 1S72T 2VB6A 5FG5A 5IGNA 2RJCA 3L2UA 1B7TA 4C5GA 4C8QG 2A28A 2QQ9A 5HFRA 1PG5B 4PLLA 5H85A 5CIUA 5EWDA 4Z1SA 4KH1B 4AKIA 3LW5E 3GBQA 5KYXB 2KY9A 2I8NA 1M90C 5L97A 1YWPA 2FEIA 4Q5WA 4NRCA 1IXDA 5KHMA 3J80E 2VGMA 1NM7A 2DMOA 1Q81C 5IXBA 2CZ7B 5FBXA 4M77B 3EFSA 4HVVA 2VV5A 4QSWA 3CCVQ 5LJ2A 4NUCA 2MJVB 2VASA 3MP1A 4O76A 1NLOC 5E9LA 4QUUA 3QSUA 4B6MA 2LQWA 4PJOC 1UB4A 3OYIA 5EU1A 2LT1A 4XTZA 5KYUB 1IGUA 3C12A 4PJOF 3EG3A 2DYBA 5GJVB 5HCKA 3SB2A 2CH4W 1S72A 5D26A 5CO7A 1PD0A 5FU6C 1VQMA 3HSBA 5LVQA 1M3AA 3CC2Q 5EVAA 1EFNA 2A36A 2V26A 4JRPA 3CCRA 5F1HA 2V8IA 5BT4A 4LD6A 4RG8A 5DX4A 2E10A 4LR6A 1I8FA 5KYWB 3KUFA 1G8XA 1QWFA 2YWWA 4BY6B 5A0LA 3CCET 2YRVA 5LJ3j 2K3BA 3TU4K 2EQMA 2EYXA 1M1KC 2RK2A 3EG9A 5FB0A 4M7DF 4JPBW 3H0HA 4LZ2A 4M77E 3BW1A 3S91A 3X24B 4CI0C 4Z93A 1VOMA 3I9QA 3VUZA 1ZUUA 4BDZA 2EJGA 1K76A 5A5PA 2QA4Q 2K79A 5C8GA 5FH7A 4HXJA 5GJWB 4CC7A 3JCMW 3SWNC 3HRSA 2GGRA 3R6OA 5FG6A 4O7FA 1MNEA 4TZ2A 3M9QA 4KUIA 3RKYA 3L1AA 5CZGA 1T3SA 4QC1A 1ZX6A 2OJ2A 2C06A 5IH2A 1RADB 4ALGA 4FCYA 2KYMA 4MR3A 3LX7A 3U5PA 2EJFA 3JB9G 3RBBB 2QG9B 1U5SA 1FX7A 1YJNT 3CCEA 1EQFA 4R0KA 2YQDA 2HMAA 1VQ7Q 2EYQA 1VQ9T 2ZPEB 4LDFA 4NR4A 2DXBA 4V2SA 3QG1A 1JBMA 5F61A 4HCZA 4OB2B 4HA8A 1O75A 1QCOA 2CS7A 1XQHA 4QQ6A 1PRMC 3OBWA 3UV5A 1OV3A 4YYHA 1GCPA 3OS0A 3I35A 3MUKA 2QEXQ 3PGGA 1IREB 1QP2A 1RACB 3RESA 2OTLQ 3GLXA 1AWJA 5FLXE 4DOWA 3CC4T 2VXEA 5A85A 5HEMA 2FL7A 3OQ5A 1KSWA 4ME7A 1NYFA 4KT0E 1IHVA 3V7CA 4M7DA 2F1LA 1JXOA 4QSRA 2RI2A 5GAMj 4MEOA 1YJNA 1RI0A 2X3WD 3SVGA 5L8UA 1LPLA 1PD1A 1VQ9A 4LYWA 4HBYA 2M9UA 3JCMe 4QR5A 3MCAB 5HELA 3QYGB 2A3LA 2ENMA 4LDXA 5D24A 1QP3A 1RAEB 3SVHA 4A63B 2O88A 4RTUA 1QVFS 4MZPA 4M78G 2KMTA 2JTFA 5HK3A 3CC7Q 1AHJB 4LZRA 1Q95G 2FHDA 3OYAA 3EAEA 3EG1A 2JJ9A 4L6V5 2KAFA 3CCJQ 4M75B 4DEXA 4CURA 3THKA 3CC4A 3UV2A 1M9SA 2XK0A 4ZGEB 4NR6A 2LX9A 2Y90A 3VYGA 5GAN3 5FDZA 1BIAA 2JMAA 2NLUA 3DAIA 4CUPA 2J06A 2LJ1A 3OYYA 4E47A 2VWFA 1Q7YR 3ER0A 2HL5C 3DWYA 5DFCA 3QZ9B 5IHIA 2VUBA 5I21A 1VQ6T 1FYNA 3HHTB 4Z02A 3MB3A 3F70A 4RTYA 1QKWA 5D3RA 1WJSA 4C8QF 3OBYA 2DO3A 4BW3A 3C4SA 3CXCP 1OZ3A 4X1VA 4EMKB 1KIKA 3V8LA 4A4GA 5GAOr 1Q86U 4M75E 3IU6A 4A9OA 2ROTA 3CPWS 2COYA 4IIOA 5FE1A 5I80A 4NQMA 4TT4A 1KC8R 1I1JA 3O34A 5CKDA 5CUAA 2DTIA 2XDPA 4FSSA 5E9VA 3REBB 4JZ4A 4PKLA 2CGHA 4N4GA 1K4US 2O9VA 3M58A 5KCOA 4BE1A 5A5NA 4XTXA 2E6NA 3Q2EA 2MWOA 4YAXA 3JB9J 2V1QA 2ESWA 3TSWA 2O9SA 4JJCA 4XTYA 5D3PA 2CZ6B 5E0RA 4N4IA 4LZSA 4N0AC 1K8AC 2R0YA 1SRMA 3FEOA 5K29A 4UYFB 2D6FA 2YEMA 4QNSA 4MEPA 1D3BB 3A8OB 4IUTA 5GMKl 4MZTA 4AI6A 1U06A 2BZ8A 1YITQ 2RJEA 5KTXA 5EWHA 3OMCA 2KROA 2F5KA 1M3BA 4PCEA 3FJ5A 1T0HA 2J6FA 3KBGA 3CXCA 4YATA 1QW1A 4E96A 5CK9A 4PFOA 1WYXA 1RABB 2I2LA 4EIKA 2OI3A 2JN0A 5D7XA 1E6IA 1IGQA 5E73A 4NUDA 4XY8A 3JCMc 3M0QA 2L3RA 5DBMA 2LP5A 2M02A 5KYYA 2DEUA 1WJQA 1ZA2B 4C8QA 3PIPA 2L3QA 2DEQA 3PMTA 5FE2A 1I07A 1UGPB 2KRNA 3VU3C 2XDBA 3LGFA 1J3TA 3GP8A 2A37A 4MR6A 1VQKT 4HXSA 2DJQA 1Y7XA 2P4TA 2R10A 4QEVA 3I56Q 2L3SA 3MEWA 5LJ3h 4OMFB 3GOXA 3JB9F 5DW2A 3JCMQ 4M7DD 2R0VA 5KU3A 1WXTA 5IGKA 3GF5A 5KYXA 5EISA 4C5HA 3JCMf 4N3WA 3MHXA 1E6GA 2IIMA 2YELA 4QYLA 4BW1A 1WXBA 2DVJA 1YJWT 5ENCA 1PRLC 3G0JA 4YH3A 4R55A 5GMKi 3O36A 4UYDA 1ZSGA 5LJ0A 1BI3A 1UFFA 3MKDA 4HBVA 4PJJA 4CL9A 4CC2A 5I7YA 5KYUA 3P5OA 4CUSA 4BI4A 1UEBA 2LTOA 4NR9A 3JCMX 3PT9A 1QQJA 5LJ1A 3ME9A 5D25A 2BIVA 5IHNA 1ZHIA 5LUUA 3RMSA 2DD4A 1VQKA 2DZCA 4C92B 1QCFA 5DFBA 1W70A 1TUCA 2EKHA 1MHNA 2X51A 4TVRA 2DBKA 1FMWA 1U1SA 4C92G 2OTLT 4FW1A 4CFKA 2HBWA 2CZ1B 4LDVA 1M8MA 1F68A 5ETBA 5I7XA 1D0YA 1YJWA 2GCXA 5GANe 2KEAA 3A98A 2FPDA 1C0MA 2G3RA 2W10A 4R56A 3HL8A 4QSUA 2EPDA 3G7ZA 1TTHB 3OYDA 1VIFA 5E9YA 4M78F 2CZ0B 2YUPA 4IUPA 3X20B 2KK4A 5CUGA 5J26A 5EWCA 4D8DA 1GCQA 3BY7A 2HKNA 4EDUA 1WA7A 4YY4A 3CCEQ 5A2QE 5CUDA 3D1DA 1ARKA 1RLQC 3RMQA 4ATOA 5HY6A 4ORZA 4C5IA 3FKMX 2FB7A 1XTDA 1EIFA 5HK0A 5FFVA 7AT1B 5GAMh 5CKEA 5BT3A 1YP5A 4AG1C 2E70A 2BUDA 2LX7A 5EG2A 2QGGA 3M5AA 1PSFA 2OTLA 3VS3A 1WX6A 4GBQA 4OMQA 1QVFP 2KXDA 2DL8A 3CCJT 2LJ0A 5CRMA 5F62A 3E19A 1D09B 4XAXB 5COIA 4EMHA 1BI0A 4J9BA 4F7UG 4KGXB 4JJDA 5FU6B 4OGJA 1WFWA 2F2WA 2EQIA 2ZPBB 1UTIA 1G3SA 4AKGA 1VYTA 2E12A 5ENFA 3QIIA 2NUPA 2A0FB 4J3IA 2V8JA 2D0NA 3ASKA 2FZKB 4FYXB 2G4AA 5DLZA 5GANg 3UA6A 4XU1A 2JOYA 1YJNQ 2KNBB 5CKHA 5EC7A 1ABOA 2DA9A 2LCCA 1VQ9Q 4OMMA 1OU8A 2MYSA 5E3GA 3NTHA 3C94A 1G3YA 3AADA 3GIBA 4LDWA 2IVWA 5I29A 1LVKA 2RK1A 4KGVB 3A8MB 2WSCE 5FE8A 4PJOE 3SD4A 5I2SA 4ANJA 2SRCA 3CC7A 4PFZA 3AT1B 2EWNA 2JNGA 2LJ3A 5C85A 3UF4A 5C0MA 2C0TA 3O37A 3ZL7C 4J9FA 1R0BG 4CRIA 1W4SA 3CCJA 1LJOA 4C8QD 2LRQA 1X6BA 5E9KA 4PFPA 1RAHB 4M78A 5LJ3f 4OMPA 3V8KA 4XTUA 1Q82U 4E2FB 5L8TA 3CPWP 3M53A 3CC4Q 2YRCA 2CSIA 4YABA 3QBYA 2AZSA 2KE9A 3EFOB 1QVFA 3JCMV 2RNXA 4KH0B 3UDCA 5KE2A 1EZZB 1Q82C 4O7EA 1ZBJA 5FE4A 1G83A 4M7AB 2RO1A 1NPPA 2RJDA 4Z6IA 3O33A 4QKUA 5CUEA 5HCLA 1Q7YC 4M7AG 2JW4A 3MB4A 4PK4A 4OB1B 2DVQA 5A0GA 2GNCA 3I5RA 1Y71A 5DYXA 2Z0WA 5IGLA 1JU5C 4DQ2A 1Q86R 1OULA 2PQWA 1HSQA 2EJNA 3ZFJA 3EGDA 5CUCA 5HENA 3QO3A 1Z9ZA 2GTOA 5HRXA 2YW5A 3LQIA 3VS0A 4XQ3A 3QWYA 2QTXA 5ENEA 2JS2A 1P92A 3E9FA 4KULA 1KC8C 2FYKA 4YC9A 2YLCA 4IOQA 4ZNXA 2HCKA 3C95A 3CPWA 2VGNA 2R58A 1JXMA 1TUDA 2BE9B 1NJIU 1GFCA 3LWHA 3M4GA 2KR3A 1VQ6Q 2HQEA 3QWXX 3UT1A 1PUOA 2XIDA 3FB9A 3RCWA 1NPRA 1YITA 2DFUA 4FT4A 3J7AF 2KT1A 4Z1QA 3U5KA 1AWXA 5E9IA 5GAMf 5GMKh 3HRUA 5GAOp 5L23A 5A5OA 2Y4XA 4BUGA 5LJ5g 3NFCA 4FW2A 2RO0A 3JB9D 1IRXA 5CUBA 2JXBA 4J9DA 5I86A 3HMEA 4OVAA 2CDTA 3UVWA 4B9WA 1KQSP 1BBZA 4BDYA 2LCLA 3MP8A 2NUTB 2PTKA 4C92F 2L85A 1JSPB 2LDMA 4CFLA 2WP2A 4X34A 1JB0E 5CQ3A 3CQTA 2M0YA 2HBPA 4C5EA 1PC0A 4WHUA 2O31A 4QBMA 2EGAA 3I56A 2KQWA 4ZC9A 4JLIA 1Y96A 1NZ9A 1W6XA 3RDVA 2QQSA 1YIJT 1QVGP 5DW1A 3M59A 4AMCA 2RN8A 1TOVA 4JLGA 2WSFE 4M77G 2ATCB 2PUKB 3QZSA 1X69A 3RUXA 4AFQC 4LC2A 2DRKA 4LDUA 3LH0A 5LJ5d 5CU8A 4QQGA 1C6VX 1OX8A 1JRIA 2HL3A 4J7FA 4BI3A 2RNYA 5GAOm 3UW9A 4UIXA 4PNOA 4Q0NA 5TB6A 5KTWA 2EQKA 2ZCFB 4O70A 2C0OA 2DL4A 5FE6A 2L8DA 1M1FA 4M7DC 2DYIA 3EH1A 1I5LA 2JM9A 1OYXA 4F7UF 5FE0A 2ZAEA 4M78D 1N8RU 1VQKQ 1NEGA 5AYFA 2LNHB 4QW2A 1PM3A 3TEEA 2L84A 1YIJA 3HMFA 2DATA 2E5QA 3OYKA 1HXDA 5EM3A 4AKNA 2L2PA 2HAXA 2QXFA 4E7KA 2F5TX 5CS8A 5DY7A 1AD5A 4QSPA 2RMOA 4C92A 4OMOA 5GAN8 2CP7A 1YJWQ 1GFDA 5LKXA 1YNZA 3EHRA 4A9IA 5A82A 3FDRA 2D1XA 2OTJT 2FRYA 4HBWA 5GAN6 1N5ZA 2GFAA 2LQNA 3JRZA 1XNIA 2LNVA 3PNWC 4IR6A 1ZSZA 1SF9A 3QXEB 2B86A 4A9JA 2DBMA 5LL6S 1M2VA 1G5VA 1OX9A 4QEUA 2X3XD 2DIGA 2XD0A 1D1CA 2RHYA 3HMHA 3SVFA 2MPXC 4WIVA 4XK8E 4A4EA 1MGQA 3P1EA 1WXUA 2JM8A 1UUEA 3P8HA 4M7AF 4HT8A 3V7SA 4TZ8A 2F2XA 1TSFA 3QZVA 2DM1A 1B3QA 4F7UA 2OTJA 4O7AA 3FLGA 3L42A 2CT3A 5CQTA 4ZN1A 2FSAA 2CT4A 1M30A 3NPFA 4Y28E 4OGEA 1TU0B 4D6WA 4OF1A 3EGUA 4N4HA 4A9EA 1K9MU 3UA7A 5CPEA 3JVKA 3CMET 1B34A 4GPJA 2KT8A 4RUGA 1VYVA 1O9SA 1ZBXA 3H6ZA 1BIBA 2HSEB 2P0PA 1V76A 4OP0A 4KBMB 2BE7D 1MMAA 2E3HA 3CCLT 1K73U 1K9MC 2RH2A 3DB4A 3O5ZA 2RJFA 3CCUT 2BZYA 1Q82R 3SHWA 3ZYUA 4M75G 4YYNA 2O4XA 4O72A 2JZ2A 5CP5A 4LDYA 2GRCA 4FYYB 1XOVA 2FRWA 5E7DA 4YYIA 3M0RA 1VQLT 9ATCB 2J6KA 2O01E 3I3JA 3OW2S 3LYIA 5CGPA 5IAYA 4C8QC 2R5MA 3CPFA 2RHZA 4QB3A 1TUGB 5KE3A 1PCXA 4HCBA 4J6WA 2XU8A 5DM7R 3EFOA 4Z6HA 4WTOB 3CMEA 2LQ8A 2RQTA 1MV3A 3JCMg 4J9IA 4JDSA 4AT1B 5F36A 3FJPA 1JJ2S 4RTWA 3K2JA 5D3SA 1RL2A 3QJ6A 4AKHA 2DK3A 4M7AA 4YYMA 1NE8A 3M0PA 5EPSA 3A8LB 4YK0A 1K9AA 2LMJA 2E41A 1FMVA 3CCLA 1NLPC 1WJRA 3U5LA 1NYGA 5GAOl 1KHIA 5EA1A 5IIDA 3CCUA 4BACA 2NYSA 2KTBB 2DVVA 5CR2A 4YH4A 1D1BA 2I7KA 1Q86C 4QSSA 1PKTA 1TWBA 3DKMA 4OUFA 5DYUA 4PJLA 3MXFA 1X27A 4M77F 2ED1A 4Z89A 5ENJA 4J9GA 5D6YA 4QR3A 4GLKA 1VQPT 1JQQA 1OQKA 3U5MA 1WI7A 2X4WA 4HXNA 1BKBA 5ENGA 1VQ6A 1NJIR 3VRZA 2R0SA 5D7UA 2MIOA 2KGTA 3WVEB 5CQAA 2JMCA 2L5EA 5E3DA 1GRIA 4C92D 4IIMA 5LKUA 1AVZC 3AQAA 3LQHA 4DBRA 1WNLA 5ECAA 3AHUA 4AFSC 1SHFA 2RI3A 4BD3A 3JCMb 4WHWA 3CCMQ 3JSCA 2LSPB 2AKLA 3GPLA 1K0SA 2RI5A 1RAFB 4HXKA 4JZ3A 2RD1A 2QTVA 4J83A 5LJ5j 4VUBA 1BB9A 4LN2A 5FRMA 2EJ9A 4A9NA 2EQJA 5EP7A 3GNGA 2QI2A 4GY5A 5EQ1A 5ENBA 1I5OB 2QYZA 1SSHA 4NR5A 1AT1B 2KSSA 3OYNA 1VQPA 4NRAA 1M5Q1 3EHQA 3M55A 5I1QA 4BW2A 1GCQC 2ECZA 2I0NA 3M0UA 3PFSA 5A7CA 1ABQA 2DVEA 3A8HB 5LJ3e 3PTAA 5GMKj 4JJBA 5LVRA 4TS8A 3U23A 2AT1B 4XTWA 2EW3A 2NUTA 2BZXA 5I11A 4UIZA 2X9HA 1N9SA 3MEUA 3L2ZA 1E6HA 5H1UA 1LOJA 2PU9B 1GL5A 5CQ6A 5J39A 1BCOA 1I0CA 5FROA 4QR4A 2VC8A 1WDXA 3INZA 2YUQA 1D1AA 4M77A 2F6JA 4MR5A 2FPFA 2RS9B 3D1BA 5G4RA 1KQSS 4LE9A 1KG1A 1LCKA 1X75C 1SEMA 2X4YA 2FVUA 4MDXA 5IBNA 3MPUB 4JS4A 2J7IA 8ATCB 3PIOA 4Q0OA 1AWWA 2ZPIB 4J9HA 4E7ZA 4LXCA 3T9NA 4QSQA 2JTMA 2MAMA 3PVLA 1YBYA 4C0DC 2O2OA 1Y07A 4ZGDB 3HKSA 2HD0A 4J6XA 1ZLMA 4XYAA 5FW9A 5GAOn 1KFZA 3EG9B 1OI1A 5AMEA 5HQ5A 2EGCA 3REAB 1N8RR 1BYMA 1QVGS 1VQ4T 4KRTA 3VS7A 1VQ8T 2YSQA 4X9DA 2CP6A 4PJNA 5KYWA 1N6AA 3Q2FA 1YIJQ 2X35A 2HEQA 1RI9A 5HQ6A 2HSPA 3VS1A 4ZN3A 1SKUB 2FPEA 4O75A 2LCSA 4NYXA 4UITA 4PY6A 5CTLA 3NGPA 3PVQA 5D3TA 4M78C 5GAN5 3JB9I 1SSFA 5KO4A 5CQ5A 3CCST 3DLMA 4OGIA 4NR7A 5E9MA 4IOOA 4O77A 2K5IA 3G4ST 4YY6A 5HFQA 4NS5A 3S6WA 2DF6A 4M7AD 2E7NA 2YDLA 5EGUA 1KQ2A 5GAMe 5CKBA 4O71A 5I83A 2SEMA 3M54A 3UPUA 4M75F 5HRWA 1VQ4A 2HKQB 2MI6A 4O5VA 2JVVA 1VQ8A 5GANh 1V1CA 1UHCA 1BCMA 1MMNA 4JS5A 5IGMA 4PJOB 1UDLA 4QVZA 1AWOA 5D6XA 3JB9H 3ONIA 5CRZA 2JS0A 1PKSA 4PJOG 4ZQLA 2PVOB 3A8GB 4PS5A 3OA6A 4MEQA 1OU9A 3R6NA 1T0JA 3CMAT 1AZEA 2K9GA 5F1LA 2OTJQ 4M7DB 1MMGA 1UHFA 4X9CA 5FU7C 2F2VA 4RCCA 2EBPA 3SDZA 5L96A 2CSQA 1RLPC 2XICA 1CKBA 5EPBA 4B9XA 3OW2P 3HTRA 4BB7A 3QDFA 3JV3A 4FYVB 1T3LA 2D8JA 3U5NA 2DILA 3M56A 5FH8A 3QZ5B 4AFUC 1PHTA 1D0ZA 5DKDA 1U3OA 3V7RA 1K9MR 3CD6T 2QQRA 5GAMg 1VIEA 1YI2T 4J7IA 1CKAA 5CY9A 1Y57A 5I88A 4YADA 3UWNA 1JJ2P 3LJWA 3SWNB 4HXRA 2PUOB 2DKWA 4UYGA 4RTZA 4BHWA 2D82A 1RAAB 5BT5A 1K73R 3ZBDA 2D9TA 2HQXA 1F1BB 5EV9A 2RM4A 3G71T 2EYZA 3CMAA 1Z9QA 4ZTFA 2DETA 3LWIA 3OMGA 1BU1A 5F2PA 4M7DE 5GANd 5AD2A 4XUBA 3META 1VYUA 2L3PA 2NXBA 4J9CA 5KYNA 4M75A 5CQXA 2RF0A 1X01A 1QKXA 4CLBA 1PSEA 4RKUE 3U5OA 3D7SB 3M57A 3QPHA 2OAUA 4NYVA 2VYTA 1H641 4J5YA 4M77D 4RG2A 1WZOA 3OYHA 4BE0A 1ZQ1A 4OGCA 3CD6A 3CMEQ 1YI2A 4MR4A 5DKCA 2YT6A 4QY4A 3CCMT 2DPPB 1IO6A 1ACMB 2EIFA 2VVKA 3OW2A 1YCSB 1A0NB 1M4ZA 4JRQA 6AT1B 4RCBA 3DLLA 3CCLQ 1R8OB 3WVDB 1YJ9Q 4Z8AA 1OEBA 2M1HA 4EMKA 3CCUQ 5CQ4A 4HXMA 3QUIA 4ZTJA 1LNXA 1YHQT 2EGEA 4N4FA 1JJ2A 2AIRB 1KD1U 4A9HA 5J0DA 1GBRA 2CKKA 3PMIA 1GXIE 5F60A 2XG8D 4PKCC 4E7IA 4Y03A 5A0DA 5A83A 5LJ5h 4UC4A 1VQLQ 5EWWA 1BI1A 2DLPA 2KXCA 5DFDA 4CUTA 2XDDA 4YBMA 1NBEB 3OYGA 2OAWA 4IKFA 3P8BB 2DJZA 1YN8A 1NJIC 5GMKe 1C1AA 1VA7A 4KV1A 3CCMA 4Z88A 2MOXA 2DIQA 1H3HA 4PJMA 5JWMA 4QT7A 3RKWA 3ERRA 1FXXA 2GQVA 4UYFA 1H3ZA 1OOTA 2DL5A 2X4XA 1AEYA 1D3BA 4DBHA 2ROLA 4RTTA 3S3MA 1QLYA 4IUUA 2K6DA 4C92C 1YHQA 3QKJA 4NR8A 4FYWB 4AFZC 1VQ5T 5FE3A 3L2VA 4M4ZA 2RHUA 4J6YA 4HCKA 4F17A 5KYYB 3LQJA 3LXJA 2H3JA 4C8QB 4J0RA 3CEYA 1VQPQ 1RUWA 2P4RA 1ZSZC 4UIYA 2RA2A 1VQMT 1M90U 1UGRB 3S3NA 2OSSA 3CBMA 3CCRT 4A4HA 5I89A 3S92A 2KBTA 4C67A 1Q81U 3VKIA 5AD3A 1KQ1A 3H41A 3NMZC 1UECA 2NUZA 1ZS5A 2RPNA 3QJYA 2RQUA 1OPKA 2EVRA 3OS2A 2BKDN 1TG0A 1QWEA 1M3CA 1UJ0A 1KK7A 4II1A 3G6ET 1UJYA 3OYLA 3IU5A 4LD9K 1ZUKA 1E7OA 4RMOA 5FE5A 1AZGB 4IUQA 1VQ5A 2F6NA 2CP0A 4ALHA 4HKEA 2E3KA 1MV0B 4C8QE 2K3XA 4WF2A 1K0XA 4LRGA 4O78A 2FZGB 3URGA 2DL7A 4F04B 1R0CB 5AT1B 2HDAA 1KQSA 1M1KU 1JM4B 4E7JA 5DYAA 4Y91A 2A7YA 3EGXB 3VKGA 3H0IA 2M16A 2YDWA 3ZEHA 2XMFA 2OUOA 4QSXA 3E2UA 2H60A 1QMCA 3X28B 5HJCA 3FC3A 1N8RC 4M75D 4DEYA 5FWCA 3RERA 3DB3A 5DLQE 2R5AA 3OYEA 2JUFA 3X26B 4XU2A 3CCQT 2M51A 2XKOC 3M4YA 3S3OA 2DZ9A 3G6EA 1QVGA 2QQBA 3HP9A 4FM4B 1VQNT 2J6OA 2HQHA 4QYDA 4UIUA 4HBXA 1BI2A 5II2A 2C0IA 5GMKm 3HFNA 4YYGA 4NUEA 3NHNA 4A9LA 3GNFB 3BFMA 3QYHB 1WHMA 4P5NA 4BJXA 5ENIA 1M1GA 4CUQA 3VJPA 3MQMA 3MEVA 1U1TA 3LLRA 3VS5A 2CREA 4HT9A 5LJ5f 1X0JA 2VKNA 1XJWB 1X6GA 1VQ4Q 3H9NA 3NTIA 2YHTA 1VQ8Q 5ETDA 4HXOA 2DKGA 1I4K1 4OB3B 1WHKA 4CC3A 3VKHA 3OS5A 2HNIA 4M7AC 4KUDK 2YUOA 2RFJA 4L59A 5I2MA 3CCQA 3C0CA 4DBQA 4TU6A 1MNDA 4YBSA 1VQNA 4FT2A 1NG2A 4PJOA 3NTKA 2YLBA 3P1CA 3CCSQ 4TQNA 2NUPB 4F14A 5FFWA 4NL2A 1M8VA 2J05A 3M0TA 2DTHA 3G4SQ 3I55T 2BTTA 4WCIA 2CUBA 5AMFA 5GANj 5FWBA 4C0DB 4IR4A 2DE0X 2FO0A 1IB8A 2D8HA 1PWTA 3OYMA 1MUZA 1TS9A 1SPKA 3EG2A 3EG0A 2AKKA 1M27C 1WLPB 4X2IA 5GAN7 2CYZB 4J0SA 3LGLA 3N5BB 3Q1JA 3OB9A 5I40A 5II1A 2LQKA 5F3AA 4J8OA 2COZA 4BE2A 5HKCA 4QEWA 5L99A 2Y4YA 3TLPA 1YJ9T 4QSVA 5LKZA 2DTOA 4M78B 4XU3A 4FLPA 2DL3A 3JCMh 5CQ8A 3A1PA 2DD5A 2KDSA 1YFNA 2ZPHB 5L98A 1UGQB 3VUBA 1KHCA 3PE0A 3CMAQ 1WQWA 5GAN4 3SWNA 3UV4A 1K73C 3I55A 5KCHA 3CBOA 5E74A 1FMKA 2L5QA 5DLOA 1ZKRA 5FE7A 3ULRB 4A54A 2D9EA 3OY9A 2FG0A 3FIFA 5D0CA 4MDWA 3NXBA 1G3TA 4KV4A 2FZCB 4KCXA 1WHHA 2RNAA 3CD6Q 1VQOQ 1X43A 1YI2Q 2M0OA 4TTEA 1WHLA 3OYBA 2XHCA 2KI7A 2PVDB 3OYFA 5L8RE 4LUEA 1W2BS 4RTXA 5G4SA 4M78E 1YJ9A 1W1FA 3EGDB 2E64A 4M77C 5C6SA 5FH6A 1JO8A 3L2QA 3G71Q 1VUBA 3QZTA 4O7BA 2DXTA 2RQWA 2MMPA 4DBFA 2V8KA 2LZ6B 3MO8A 4JRIA 1KD1R 1VQLA 2DXCA 2OX7A 1WIEA 5FU7B 4E6RA 1ZA1B 2VXFA 4JUVA 4HVWA 3P1DA 5ACYA 3BDLA 4J1PA 2K2VA 2EFIA 3E1SA 4ZGJB 2IPOB 3KFVA 3HRTA 5EK9A 3JCMd 3O8VA 5IN1A 4UYEA 1N72A 1CSKA 1SRLA 1OPLA 3O35A 1K8AU 2LVMA 2K5LA 2COWA 2P0KA 2WP1A 2AK5A 4C0ZA 4BY6C 2DRMA 4FIBA 5GAN2 4E7SA 2L89A 5DKHA 2G6FX 3JVJA 5F25A 4ELYC 5CCAA 5IXFA 2GF7A 2DVSA 3KXTA 3G1JA 3OYJA 3CCVT 3J81E 1HK9A 4QVDA 4MENA 4UIWA 4LNPA 4DOVA 4KGZB 1YHQQ 2WACA 1YCYA 1G3WA 4L5GA 4A9MA 5DY9A 5FB1A 2AZVA 5A5RA 4DA4A 2JT4A 2H3EB 3JVLA 5EWVA 1JEGA 2MF2A 3CC2T 2KRMA 4BI8B 2E5KA 3M0SA 5FG4A 4NXJA 5GAOq 5EICA 1M90R 4LYIA 1Y96B 2PZ1A 4PJOD 5C87A 5CKFA 2P0QA 1BK2A 3L2RA 4XTVA 5IT9E 4AG2C 1Q81R 4JRKA 4O7CA 5FE9A 2ZZDA 4UYHA 2X4JA 2ZPFB 4YTLA 4O6JA 2GFUA 1IHWA 2JTEA 1TH7A 2RQVA 2XI9A 5A81A 3CCVA 3VV0A 3P8DA 5D3HA 3U5JA 2QA4T 4QQDA 3RIRA 4QUTA 5D3NA 1KJWA 3UVDA 1WHGA 3MJXA 1VQ5Q 2YRDA 1R77A 4A9FA 2GQIA 5IG6A 2EQUA 3CC2A 2RHIA 1WQ7A 1FWZA 2CUDA 1S72Q 5KH6A 3A5ZB 4HXPA 2CP5A 1B07A 1VQMQ 2E1HA 1M1KR 5TCMA 2E6ZA 3CCRQ 5A5SA 1V29B 1M2OA 1OZ2A 4PL6A 1VQ7T 5LJ3g 2ABLA 5KTUA 2QQAA 2IG0A 3MEAA 4QZSA 3TQ7P 2DXUA 1QVPA 2RNWA 3FRNA 3D7CA 5ENHA 2MK5A 4N0AA 4J9EA 1K1ZA 2CP3A 1DJ7B 1X2KA 3EGXA 1UG1A 4MMLA 4DONA 5A5QA 1I81A 4OMLA 2QA4A 3RKXA 4MZMA 3G6EQ 2ZPGB 1Y0MA 4FL6A 2YUNA 2QEXT 1AOJA 4ELZC 2K7AA 3RR6A 2E65A 5F63A 2GTJA 4IR5A 4A4KA 4TT6A 2WSEE 2F69A 2EKOA 1WUMA 3UVXA 2EYYA 4M75C 3OYCA 1ZSZB 1S1NA 4IURA 3TSZA 3VYHB 2NWMA 1YWOA 1WPYA 1M2VB 4O74A 4NQNA 4YYDA 2EAYA 1UGSB 4NOYA 4HXLA 4FU6A 1H8KA 5J3BA 5LJ3d 1VQ7A 3V8JA 5C4QA 3JVMA 3UATA 4OB0B 4C0GA 5I22A 4IORA 4FSXA 2MWPA 2R57A 3UVYA 4C92E 3QDRB 4QSTA 3CCQQ 3CCSA 4BW4A 4TT2A 4HVUA 2ZGWA 5DYCA 1VQNQ 4EMKC 1UE9A 3H0FA 3G4SA 3CC7T 2QEXA 5H1VA 5LKTA 4F7UB 4OMNA 4ZW1A 2K57A 3MULA 5HRVA 3CBPA 4NRBA 4M7DG 1UGVA 3RNJA 2PVGB 1EX4A 2DERA 5CQ7A 5HQ7A 2PNIA 2N9GA 1HJDA 2P84A 2KYBA 1U8RA 4PCIA 3BDUA 1VQOT 4IUVA 3EFRA 5HM0A 1X6OA 1B34B 4E7LA 1RAIB 1TXQA 4RVRA 1NEBA 3WXMB 5FRNA 5F5ZA 2D0QB 3BE3A 1N9RA 1QCNA 5C89A 2QK0A 1W2BP 3G0LA 5CQYA 2AHJB 3VS4A 2RI7A 1PNJA 3JCMJ 4QVCA 2RB6A 2KVQG 2A08A 2DWWA 4YBTA 2K2MA 3MP6A 2O4XB 4F7UE 4YYJA 8AT1B 2OO1A 3OS1A 3E9GA 3I55Q 1WUGA 3TCJA 1WHJA 4C66A 4K11A 4GLMA 4F16A 4A9KA 5D3LA 2RQRA 2LC4A 3GG3A 3HFOA 2DVRA 5GAMd 4E7HA 1VQOA 1IZ6A 5DLXA 4C0FA 1Q7YU 2B8AA 2H8HA 4TU4A 2QGFB 4JJNK 2HZYA 1WGSA 5CAIA 4IR3A 2GBQA 2QDYB 3IQLA 3LH5A 3QHSA 1RAGB 2YYNA 2V1RA 4XY9A 4MMKA 3L2WA 5EPRA 3I5SA 3G71A 5CFWA 2K4YA 5IHKA 3EH2A 5LJ5e 5D3JA 2CP2A 1YITT 4NL3A 5M9OA 4EPCA 2YXYA 3VS2A 3VS6A 5H1TA 1ZUYA 3SEMA 4CUUA 5JI8A 5CVIA 4PTBA 4Y92A 1W2BA 1KC8U 3SFMA 3OSSC 4TYLA 3TVTA 3HPWA 3H8ZA 1KD1C 4XU0A 2K5FA 1SHGA
chains in the Genus database with same CATH topology
4F3IA 2LT4A 2DAQA 4LYSA 4QC3A 3JCMP 2K3YA 4M7AE 5HLSA 5GANf 2RHXA 4UIVA 3X25B 1N27A 4YYKA 3I56T 5D6WA 3P1FA 4A4FA 3CXCS 5C7NA 4HCCA 4NYWA 4XUAA 2E7OA 2YEKA 5EI4A 4EMGA 4PLIA 3JAME 5FFYA 3OSVA 4A53A 3TREA 1S72T 5FG5A 5IGNA 2RJCA 3L2UA 4C5GA 4C8QG 2QQ9A 5HFRA 4PLLA 5H85A 5CIUA 5EWDA 4Z1SA 3LW5E 2KY9A 2I8NA 1M90C 5L97A 4Q5WA 4NRCA 5KHMA 3J80E 2VGMA 1Q81C 2CZ7B 5FBXA 4M77B 3EFSA 2VV5A 4QSWA 5LJ2A 4NUCA 2MJVB 3MP1A 4O76A 5E9LA 4QUUA 3QSUA 4PJOC 1UB4A 3OYIA 5EU1A 2LT1A 4XTZA 3C12A 4PJOF 3SB2A 1S72A 5D26A 5CO7A 5FU6C 1VQMA 3HSBA 5LVQA 5EVAA 4JRPA 3CCRA 5F1HA 2V8IA 5BT4A 4LD6A 4RG8A 5DX4A 2E10A 4LR6A 1I8FA 3KUFA 4BY6B 3CCET 5A0LA 2YRVA 5LJ3j 3TU4K 2EQMA 1M1KC 2RK2A 5FB0A 4M7DF 4LZ2A 4M77E 3BW1A 3S91A 3X24B 4CI0C 4Z93A 3VUZA 4BDZA 2EJGA 5A5PA 5C8GA 5FH7A 3JCMW 3SWNC 3HRSA 3R6OA 5FG6A 4O7FA 4TZ2A 3M9QA 4KUIA 3RKYA 3L1AA 5CZGA 4QC1A 2C06A 4ALGA 4MR3A 3LX7A 3U5PA 2EJFA 3JB9G 1FX7A 1YJNT 3CCEA 1EQFA 2YQDA 2EYQA 1VQ9T 2ZPEB 4LDFA 4NR4A 2DXBA 4V2SA 3QG1A 1JBMA 5F61A 4HCZA 4OB2B 4HA8A 1O75A 2CS7A 1XQHA 4QQ6A 3OBWA 3UV5A 4YYHA 3OS0A 3MUKA 3PGGA 1IREB 1QP2A 3RESA 3GLXA 5FLXE 4DOWA 3CC4T 2VXEA 5A85A 5HEMA 2FL7A 3OQ5A 4ME7A 4KT0E 3V7CA 4M7DA 4QSRA 2RI2A 5GAMj 4MEOA 1YJNA 1RI0A 3SVGA 5L8UA 1VQ9A 4LYWA 4HBYA 2M9UA 3JCMe 4QR5A 3MCAB 5HELA 3QYGB 2A3LA 4LDXA 5D24A 1QP3A 3SVHA 1QVFS 4MZPA 4M78G 2KMTA 2JTFA 5HK3A 1AHJB 4LZRA 2FHDA 3OYAA 3EAEA 4L6V5 2KAFA 4M75B 4CURA 3CC4A 3UV2A 1M9SA 2XK0A 4ZGEB 4NR6A 2LX9A 2Y90A 3VYGA 5GAN3 5FDZA 1BIAA 2NLUA 3OYYA 3DAIA 4CUPA 4E47A 3ER0A 3DWYA 5DFCA 3QZ9B 2VUBA 5I21A 1VQ6T 3HHTB 4Z02A 3MB3A 3F70A 5D3RA 1WJSA 4C8QF 3OBYA 2DO3A 4BW3A 3C4SA 1OZ3A 4EMKB 3V8LA 4A4GA 5GAOr 1Q86U 4M75E 3IU6A 4A9OA 3CPWS 5FE1A 5I80A 4NQMA 4TT4A 3O34A 5CKDA 5CUAA 2DTIA 2XDPA 5E9VA 4PKLA 2CGHA 4N4GA 3M58A 5KCOA 4BE1A 5A5NA 4XTXA 2E6NA 3Q2EA 2MWOA 4YAXA 3JB9J 4XTYA 5D3PA 2CZ6B 5E0RA 4N4IA 4LZSA 4N0AC 1K8AC 2R0YA 3FEOA 5K29A 4UYFB 2D6FA 2YEMA 4QNSA 4MEPA 1D3BB 3A8OB 4IUTA 5GMKl 4MZTA 2RJEA 5KTXA 5EWHA 3OMCA 2F5KA 4PCEA 3KBGA 3CXCA 4YATA 1QW1A 4E96A 5CK9A 2I2LA 2JN0A 5D7XA 1E6IA 5E73A 4NUDA 4XY8A 3JCMc 2L3RA 5DBMA 1WJQA 4C8QA 3PIPA 2DEQA 3PMTA 5FE2A 1UGPB 3VU3C 2XDBA 3LGFA 3GP8A 1VQKT 4MR6A 4HXSA 1Y7XA 2P4TA 2R10A 4QEVA 3MEWA 5LJ3h 4OMFB 3GOXA 3JB9F 5DW2A 3JCMQ 4M7DD 2R0VA 5KU3A 3GF5A 5IGKA 5EISA 4C5HA 3JCMf 4N3WA 3MHXA 2YELA 4QYLA 4BW1A 1YJWT 5ENCA 3G0JA 4YH3A 4R55A 5GMKi 3O36A 4UYDA 5LJ0A 1BI3A 4HBVA 4CL9A 5I7YA 3P5OA 4CUSA 4BI4A 1UEBA 2LTOA 4NR9A 3JCMX 3PT9A 5LJ1A 3ME9A 5D25A 2BIVA 1ZHIA 5LUUA 3RMSA 2DD4A 1VQKA 2DZCA 4C92B 5DFBA 1MHNA 4TVRA 1U1SA 4C92G 2OTLT 4CFKA 2CZ1B 4LDVA 1F68A 5ETBA 5I7XA 1YJWA 2GCXA 5GANe 2G3RA 4R56A 3HL8A 4QSUA 3G7ZA 3OYDA 1VIFA 5E9YA 4M78F 2CZ0B 4IUPA 3X20B 2KK4A 5CUGA 5J26A 5EWCA 3BY7A 4EDUA 4YY4A 5A2QE 5CUDA 3RMQA 4ATOA 5HY6A 4C5IA 3FKMX 2FB7A 1XTDA 1EIFA 5HK0A 5FFVA 5GAMh 5CKEA 5BT3A 2E70A 2BUDA 5EG2A 3M5AA 1PSFA 2OTLA 3CCJT 5CRMA 5F62A 3E19A 4XAXB 5COIA 4EMHA 1BI0A 4F7UG 5FU6B 4OGJA 2ZPBB 1G3SA 2E12A 5ENFA 3QIIA 4J3IA 2V8JA 3ASKA 2G4AA 5DLZA 5GANg 4XU1A 2JOYA 5CKHA 2LCCA 5E3GA 3NTHA 3C94A 1G3YA 3AADA 3GIBA 4LDWA 2IVWA 5I29A 2RK1A 3A8MB 2WSCE 5FE8A 4PJOE 3SD4A 5I2SA 3CC7A 2EWNA 2JNGA 5C85A 5C0MA 3O37A 3CCJA 4CRIA 1W4SA 1LJOA 4C8QD 2LRQA 5E9KA 4M78A 5LJ3f 3V8KA 4XTUA 1Q82U 5L8TA 3M53A 4YABA 3QBYA 1QVFA 3JCMV 2RNXA 3UDCA 5KE2A 1Q82C 4O7EA 5FE4A 4M7AB 2RO1A 1NPPA 2RJDA 4Z6IA 3O33A 5CUEA 5HCLA 1Q7YC 4M7AG 3MB4A 4OB1B 2DVQA 5A0GA 1Y71A 5DYXA 5IGLA 4DQ2A 2PQWA 3ZFJA 5CUCA 5HENA 3QO3A 5HRXA 2YW5A 3LQIA 4XQ3A 2QTXA 5ENEA 1P92A 3E9FA 4KULA 1KC8C 2FYKA 4YC9A 2YLCA 4IOQA 3C95A 3CPWA 2VGNA 2R58A 1NJIU 3LWHA 3M4GA 2HQEA 3UT1A 2XIDA 3FB9A 3RCWA 1NPRA 1YITA 4FT4A 3J7AF 4Z1QA 3U5KA 5E9IA 5GAMf 5GMKh 3HRUA 5GAOp 5A5OA 2Y4XA 4BUGA 5LJ5g 3NFCA 2RO0A 3JB9D 5CUBA 5I86A 3HMEA 4OVAA 4B9WA 3UVWA 4BDYA 2LCLA 3MP8A 4C92F 2L85A 1JSPB 2LDMA 4CFLA 2WP2A 4X34A 1JB0E 5CQ3A 2HBPA 4C5EA 4WHUA 4QBMA 3I56A 2KQWA 4ZC9A 4JLIA 1Y96A 1NZ9A 2QQSA 1YIJT 5DW1A 3M59A 4JLGA 2WSFE 4M77G 2PUKB 3QZSA 3RUXA 4LC2A 4LDUA 3LH0A 5LJ5d 5CU8A 4QQGA 1JRIA 4J7FA 4BI3A 2RNYA 5GAOm 3UW9A 4UIXA 4PNOA 4Q0NA 5TB6A 5KTWA 2EQKA 2ZCFB 4O70A 5FE6A 2L8DA 1M1FA 4M7DC 1I5LA 1OYXA 4F7UF 5FE0A 4M78D 1N8RU 5AYFA 4QW2A 3TEEA 2L84A 1YIJA 3HMFA 2DATA 2E5QA 3OYKA 1HXDA 5EM3A 4AKNA 2HAXA 2QXFA 4E7KA 2F5TX 5CS8A 5DY7A 4QSPA 4C92A 5GAN8 5LKXA 4A9IA 5A82A 3FDRA 2OTJT 4HBWA 5GAN6 2GFAA 3JRZA 1XNIA 2LNVA 3PNWC 4IR6A 3QXEB 4A9JA 5LL6S 1G5VA 4QEUA 2DIGA 2XD0A 2RHYA 3HMHA 3SVFA 4WIVA 4XK8E 4A4EA 1MGQA 3P1EA 3P8HA 4M7AF 4HT8A 3V7SA 4TZ8A 3QZVA 4F7UA 2OTJA 4O7AA 3FLGA 3L42A 5CQTA 4ZN1A 2FSAA 4Y28E 4OGEA 4D6WA 4OF1A 4N4HA 4A9EA 1K9MU 5CPEA 3JVKA 3CMET 1B34A 4GPJA 1O9SA 1ZBXA 3H6ZA 1BIBA 2P0PA 4OP0A 4KBMB 1K9MC 3CCLT 1K73U 2RH2A 3DB4A 2RJFA 3CCUT 3ZYUA 4M75G 4YYNA 2O4XA 4O72A 2JZ2A 5CP5A 4LDYA 2GRCA 1XOVA 5E7DA 4YYIA 1VQLT 2O01E 3I3JA 3OW2S 3LYIA 5CGPA 5IAYA 4C8QC 2R5MA 3CPFA 2RHZA 4QB3A 5KE3A 4HCBA 4J6WA 2XU8A 5DM7R 4Z6HA 3CMEA 2LQ8A 3JCMg 4JDSA 5F36A 3FJPA 1JJ2S 3K2JA 5D3SA 1RL2A 3QJ6A 2DK3A 4M7AA 4YYMA 1NE8A 5EPSA 3A8LB 4YK0A 2E41A 3CCLA 1WJRA 3U5LA 5GAOl 1KHIA 5EA1A 5IIDA 3CCUA 4BACA 2KTBB 2DVVA 5CR2A 4YH4A 2I7KA 1Q86C 4QSSA 3DKMA 4OUFA 5DYUA 3MXFA 4M77F 5ENJA 5D6YA 4GLKA 4QR3A 1VQPT 3U5MA 2X4WA 4HXNA 1BKBA 5ENGA 1VQ6A 2R0SA 3WVEB 5CQAA 2L5EA 5E3DA 4C92D 5LKUA 3AQAA 3LQHA 1WNLA 3AHUA 2RI3A 4BD3A 3JCMb 4WHWA 3JSCA 2LSPB 3GPLA 2RI5A 4HXKA 2RD1A 4J83A 5LJ5j 4VUBA 5FRMA 2EJ9A 4A9NA 2EQJA 5EP7A 3GNGA 2QI2A 4GY5A 5EQ1A 5ENBA 4NR5A 2KSSA 3OYNA 1VQPA 4NRAA 1M5Q1 3M55A 5I1QA 4BW2A 3PFSA 5A7CA 2DVEA 3A8HB 5LJ3e 3PTAA 5GMKj 5LVRA 4TS8A 4XTWA 4UIZA 1N9SA 3MEUA 3L2ZA 1LOJA 5H1UA 2PU9B 5CQ6A 5J39A 5FROA 4QR4A 2VC8A 3INZA 4M77A 2F6JA 4MR5A 2RS9B 5G4RA 1KQSS 1KG1A 1X75C 2X4YA 2FVUA 4MDXA 5IBNA 4JS4A 3PIOA 4Q0OA 2ZPIB 3T9NA 4QSQA 2JTMA 2MAMA 1YBYA 4C0DC 1Y07A 4ZGDB 3HKSA 2HD0A 4J6XA 5GAOn 4XYAA 1OI1A 5AMEA 5HQ5A 1BYMA 1QVGS 1VQ4T 1VQ8T 4X9DA 1N6AA 3Q2FA 2X35A 5HQ6A 4ZN3A 4O75A 4NYXA 4UITA 4PY6A 5CTLA 5D3TA 4M78C 5GAN5 3JB9I 1SSFA 5KO4A 5CQ5A 3CCST 3DLMA 4OGIA 4NR7A 5E9MA 4IOOA 4O77A 2K5IA 3G4ST 4YY6A 5HFQA 4NS5A 3S6WA 4M7AD 2E7NA 5EGUA 1KQ2A 5GAMe 5CKBA 4O71A 5I83A 3M54A 3UPUA 4M75F 5HRWA 1VQ4A 2MI6A 4O5VA 2JVVA 1VQ8A 5GANh 4PJOB 4JS5A 5IGMA 4QVZA 5D6XA 3JB9H 3ONIA 5CRZA 4PJOG 4ZQLA 2PVOB 3A8GB 4PS5A 3OA6A 4MEQA 3CMAT 5F1LA 4M7DB 4X9CA 5FU7C 4RCCA 3SDZA 5L96A 2XICA 5EPBA 4B9XA 4BB7A 3QZ5B 3U5NA 3M56A 5FH8A 5DKDA 3V7RA 3CD6T 2QQRA 5GAMg 1VIEA 1YI2T 4J7IA 5CY9A 5I88A 4YADA 3UWNA 3LJWA 3SWNB 4HXRA 2PUOB 2DKWA 4UYGA 4BHWA 2D82A 5BT5A 3ZBDA 2D9TA 2HQXA 2RM4A 5EV9A 3G71T 3CMAA 4ZTFA 3LWIA 3OMGA 4M7DE 5F2PA 5GANd 5AD2A 4XUBA 3META 2NXBA 4M75A 5CQXA 1X01A 4CLBA 1PSEA 4RKUE 3U5OA 3M57A 3QPHA 2OAUA 4NYVA 2VYTA 1H641 4J5YA 4M77D 4RG2A 3OYHA 4BE0A 1ZQ1A 4OGCA 3CD6A 1YI2A 4MR4A 5DKCA 4QY4A 3CCMT 2DPPB 2EIFA 3OW2A 1M4ZA 4JRQA 4RCBA 3DLLA 1R8OB 3WVDB 2M1HA 4EMKA 5CQ4A 4HXMA 3QUIA 4ZTJA 1LNXA 1YHQT 4N4FA 1JJ2A 1KD1U 4A9HA 5J0DA 2CKKA 3PMIA 1GXIE 5F60A 2XG8D 4PKCC 4E7IA 4Y03A 5A0DA 5A83A 5LJ5h 4UC4A 5EWWA 1BI1A 5DFDA 4CUTA 2XDDA 4YBMA 3OYGA 4IKFA 3P8BB 2DJZA 1NJIC 5GMKe 4KV1A 3CCMA 2DIQA 5JWMA 3RKWA 1FXXA 2GQVA 4UYFA 1H3ZA 2X4XA 1D3BA 3S3MA 4IUUA 4C92C 1YHQA 3QKJA 4NR8A 1VQ5T 5FE3A 3L2VA 2RHUA 4J6YA 3LQJA 3LXJA 2H3JA 4C8QB 4J0RA 3CEYA 4UIYA 2RA2A 1VQMT 1M90U 1UGRB 3S3NA 2OSSA 3CBMA 3CCRT 4A4HA 5I89A 3S92A 4C67A 1Q81U 3VKIA 5AD3A 1KQ1A 1ZS5A 3QJYA 3OS2A 2BKDN 4II1A 3G6ET 3OYLA 3IU5A 4LD9K 4RMOA 5FE5A 4IUQA 1VQ5A 2F6NA 4ALHA 4HKEA 2E3KA 4C8QE 2K3XA 4WF2A 4LRGA 4O78A 3URGA 1KQSA 1M1KU 1JM4B 4E7JA 5DYAA 4Y91A 2A7YA 2M16A 2YDWA 3ZEHA 2OUOA 4QSXA 2H60A 3X28B 5HJCA 3FC3A 1N8RC 4M75D 3RERA 3DB3A 5DLQE 2R5AA 3OYEA 2JUFA 3X26B 4XU2A 3CCQT 2XKOC 3M4YA 3S3OA 2DZ9A 3G6EA 1QVGA 2QQBA 3HP9A 4FM4B 1VQNT 4QYDA 4UIUA 4HBXA 1BI2A 5II2A 5GMKm 3HFNA 4YYGA 4NUEA 4A9LA 3GNFB 3BFMA 3QYHB 4P5NA 4BJXA 5ENIA 1M1GA 4CUQA 3VJPA 3MQMA 3MEVA 1U1TA 3LLRA 4HT9A 5LJ5f 1X0JA 3NTIA 2YHTA 5ETDA 4HXOA 2DKGA 1I4K1 4OB3B 3OS5A 2HNIA 4M7AC 4KUDK 2RFJA 4L59A 5I2MA 3CCQA 4TU6A 4YBSA 1VQNA 4FT2A 4PJOA 3NTKA 2YLBA 3P1CA 4TQNA 1M8VA 5FFWA 4NL2A 2DTHA 3I55T 5AMFA 5GANj 4C0DB 4IR4A 3OYMA 5GAN7 4X2IA 2CYZB 4J0SA 3LGLA 3N5BB 3Q1JA 3OB9A 5I40A 5II1A 2LQKA 5F3AA 4J8OA 4BE2A 5HKCA 4QEWA 5L99A 2Y4YA 3TLPA 1YJ9T 4QSVA 5LKZA 2DTOA 4M78B 4XU3A 4FLPA 3JCMh 5CQ8A 2DD5A 2KDSA 2ZPHB 5L98A 1UGQB 3VUBA 1KHCA 1WQWA 5GAN4 3SWNA 3UV4A 1K73C 3I55A 5KCHA 3CBOA 5E74A 2L5QA 5DLOA 5FE7A 4A54A 2D9EA 3OY9A 3FIFA 5D0CA 4MDWA 3NXBA 1G3TA 4KV4A 4KCXA 2M0OA 4TTEA 3OYBA 2XHCA 2PVDB 3OYFA 5L8RE 1W2BS 5G4SA 4M78E 1YJ9A 2E64A 4M77C 5C6SA 5FH6A 3L2QA 1VUBA 3QZTA 4O7BA 2DXTA 2MMPA 2V8KA 3MO8A 4JRIA 1VQLA 2DXCA 5FU7B 4JUVA 2VXFA 3P1DA 5ACYA 3BDLA 4J1PA 2K2VA 2EFIA 3E1SA 4ZGJB 3HRTA 5EK9A 3JCMd 3O8VA 5IN1A 4UYEA 1N72A 3O35A 1K8AU 2LVMA 2K5LA 2P0KA 2WP1A 4C0ZA 4BY6C 4FIBA 5GAN2 2L89A 5DKHA 4ELYC 3JVJA 5F25A 5CCAA 2GF7A 2DVSA 3KXTA 3OYJA 3CCVT 3J81E 1HK9A 4QVDA 4MENA 4UIWA 4DOVA 2WACA 1YCYA 1G3WA 4L5GA 4A9MA 5DY9A 5FB1A 5A5RA 4DA4A 3JVLA 5EWVA 2MF2A 3CC2T 4BI8B 5FG4A 4NXJA 5GAOq 5EICA 4LYIA 1Y96B 4PJOD 5C87A 5CKFA 2P0QA 3L2RA 5IT9E 4XTVA 4JRKA 4O7CA 5FE9A 2ZZDA 4UYHA 2X4JA 2ZPFB 4YTLA 4O6JA 2GFUA 1TH7A 2XI9A 5A81A 3CCVA 3VV0A 3P8DA 5D3HA 3U5JA 2QA4T 4QQDA 3RIRA 4QUTA 5D3NA 3UVDA 4A9FA 5IG6A 2EQUA 3CC2A 2RHIA 1WQ7A 1FWZA 5KH6A 3A5ZB 4HXPA 2E1HA 5TCMA 2E6ZA 5A5SA 1V29B 1OZ2A 4PL6A 1VQ7T 5LJ3g 5KTUA 2QQAA 2IG0A 3MEAA 4QZSA 2DXUA 1QVPA 2RNWA 3FRNA 3D7CA 5ENHA 4N0AA 1DJ7B 4MMLA 4DONA 5A5QA 1I81A 2QA4A 3RKXA 4MZMA 2ZPGB 4FL6A 2QEXT 4ELZC 2E65A 5F63A 4IR5A 4A4KA 4TT6A 2WSEE 2F69A 2EKOA 1WUMA 3UVXA 4M75C 3OYCA 4IURA 3VYHB 1WPYA 4O74A 4NQNA 4YYDA 2EAYA 1UGSB 4NOYA 4HXLA 4FU6A 5J3BA 5LJ3d 1VQ7A 3V8JA 5C4QA 3JVMA 4OB0B 4C0GA 4IORA 4FSXA 2MWPA 2R57A 3UVYA 4C92E 3QDRB 4QSTA 3CCSA 4BW4A 4TT2A 2ZGWA 5DYCA 4EMKC 3G4SA 3CC7T 2QEXA 5H1VA 5LKTA 4F7UB 4ZW1A 2K57A 3MULA 5HRVA 3CBPA 4NRBA 4M7DG 2PVGB 5CQ7A 5HQ7A 2N9GA 1U8RA 4PCIA 3BDUA 1VQOT 4IUVA 3EFRA 5HM0A 1X6OA 1B34B 4E7LA 4RVRA 3WXMB 5FRNA 5F5ZA 2D0QB 1N9RA 5C89A 3G0LA 5CQYA 2AHJB 2RI7A 3JCMJ 4QVCA 2RB6A 2KVQG 2DWWA 4YBTA 4F7UE 3MP6A 2O4XB 4YYJA 2OO1A 3OS1A 3E9GA 1WUGA 3TCJA 4C66A 4A9KA 5D3LA 2LC4A 3GG3A 3HFOA 2DVRA 5GAMd 4E7HA 1VQOA 1IZ6A 5DLXA 4C0FA 1Q7YU 2B8AA 4TU4A 4JJNK 1WGSA 5CAIA 4IR3A 2QDYB 3QHSA 2YYNA 3L2WA 4XY9A 4MMKA 3G71A 5EPRA 5CFWA 2K4YA 5LJ5e 5D3JA 1YITT 4NL3A 5M9OA 4EPCA 5H1TA 4CUUA 5JI8A 5CVIA 4PTBA 1W2BA 1KC8U 3SFMA 3OSSC 4TYLA 3HPWA 3H8ZA 1KD1C 4XU0A 2K5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUG A;  4F3I A;  5J26 A;  3MQM A;  5EWC A;  3U5M A;  2X4W A;  4HXN A;  3MEV A;  2DAQ A;  3LLR A;  5ENG A;  4LYS A;  4EDU A;  2R0S A;  4YY4 A;  1X0J A;  5CQA A;  4QC3 A;  2L5E A;  5CUD A;  2K3Y A;  5E3D A;  5HLS A;  3NTI A;  5LKU A;  3AQA A;  3LQH A;  5ETD A;  4HXO A;  4C5I A;  3FKM X;  5FFV A;  5BT3 A;  2RHX A;  4UIV A;  2BUD A;  1N27 A;  4YYK A;  2RI3 A;  4BD3 A;  5D6W A;  3P1F A;  4A4F A;  5C7N A;  4WHW A;  2RFJ A;  4NYW A;  4XUA A;  2LSP B;  4L59 A;  2E7O A;  2YEK A;  5EI4 A;  2RI5 A;  4HXK A;  4TU6 A;  4YBS A;  5CRM A;  5F62 A;  5COI A;  3NTK A;  4PLI A;  3P1C A;  5FRM A;  4TQN A;  4A9N A;  5FFW A;  5FFY A;  2EQJ A;  5EP7 A;  4OGJ A;  4GY5 A;  5EQ1 A;  5AMF A;  5ENF A;  3QII A;  5ENB A;  5FG5 A;  4IR4 A;  5IGN A;  2RJC A;  4J3I A;  3L2U A;  3OYM A;  4C5G A;  3ASK A;  4NR5 A;  3OYN A;  4NRA A;  2G4A A;  5DLZ A;  5I1Q A;  4BW2 A;  5HFR A;  3PFS A;  4PLL A;  5H85 A;  5CIU A;  5A7C A;  5EWD A;  4X2I A;  4Z1S A;  2LCC A;  4J0S A;  3LGL A;  5E3G A;  3NTH A;  5LVR A;  4TS8 A;  3Q1J A;  2I8N A;  3AAD A;  3OB9 A;  4UIZ A;  5L97 A;  5I40 A;  5II1 A;  4NRC A;  5I29 A;  4Q5W A;  3MEU A;  5F3A A;  5KHM A;  5H1U A;  5FE8 A;  4BE2 A;  3SD4 A;  5CQ6 A;  4QEW A;  5L99 A;  5FBX A;  3TLP A;  5J39 A;  4QSW A;  4QSV A;  5LKZ A;  4QR4 A;  5FRO A;  5LJ2 A;  4NUC A;  2MJV B;  4FLP A;  5C85 A;  3MP1 A;  5C0M A;  5CQ8 A;  3O37 A;  4O76 A;  4CRI A;  5E9L A;  4QUU A;  2LRQ A;  2F6J A;  4MR5 A;  2RS9 B;  5E9K A;  5L98 A;  5G4R A;  1KHC A;  3OYI A;  5EU1 A;  3UV4 A;  5L8T A;  2X4Y A;  5KCH A;  5E74 A;  5IBN A;  5D26 A;  4Q0O A;  4YAB A;  3QBY A;  5FE7 A;  5LVQ A;  5EVA A;  2D9E A;  3OY9 A;  4QSQ A;  5D0C A;  2RNX A;  3NXB A;  5F1H A;  5BT4 A;  5KE2 A;  4LD6 A;  4KV4 A;  4O7E A;  5FE4 A;  4KCX A;  4XYA A;  5DX4 A;  4LR6 A;  2RO1 A;  1OI1 A;  2RJD A;  5AME A;  3KUF A;  5HQ5 A;  4Z6I A;  2YRV A;  3O33 A;  2EQM A;  5CUE A;  5HCL A;  2M0O A;  4TTE A;  5FB0 A;  4LZ2 A;  3OYB A;  3Q2F A;  3MB4 A;  2DVQ A;  3S91 A;  3OYF A;  4Z93 A;  2X35 A;  5G4S A;  4BDZ A;  5DYX A;  5A5P A;  5HQ6 A;  5IGL A;  4O75 A;  5C6S A;  4NYX A;  5FH6 A;  3L2Q A;  5C8G A;  4UIT A;  4PY6 A;  5CTL A;  3QZT A;  5FH7 A;  4O7B A;  5D3T A;  2PQW A;  1SSF A;  5KO4 A;  5CQ5 A;  5CUC A;  5HEN A;  3MO8 A;  3DLM A;  4OGI A;  4NR7 A;  5HRX A;  2YW5 A;  3LQI A;  4IOO A;  4O77 A;  5E9M A;  5FG6 A;  4YY6 A;  4O7F A;  5HFQ A;  4TZ2 A;  4NS5 A;  3M9Q A;  3S6W A;  5ENE A;  3P1D A;  5ACY A;  3BDL A;  3E9F A;  4J1P A;  5CZG A;  2E7N A;  4QC1 A;  2EFI A;  5EGU A;  4ALG A;  4YC9 A;  4IOQ A;  4MR3 A;  3LX7 A;  4O71 A;  3U5P A;  5EK9 A;  3O8V A;  5IN1 A;  5I83 A;  4UYE A;  2R58 A;  1N72 A;  1EQF A;  2YQD A;  3O35 A;  5HRW A;  2LVM A;  4LDF A;  2HQE A;  2WP1 A;  2P0K A;  3UT1 A;  4NR4 A;  5F61 A;  4HCZ A;  3RCW A;  5IGM A;  2L89 A;  5DKH A;  3JVJ A;  5F25 A;  4QQ6 A;  4QVZ A;  5D6X A;  3ONI A;  5CRZ A;  2DVS A;  4Z1Q A;  2GF7 A;  3UV5 A;  4ZQL A;  3U5K A;  3OYJ A;  5E9I A;  4PS5 A;  4YYH A;  3OS0 A;  4MEN A;  4UIW A;  3MUK A;  3OA6 A;  4MEQ A;  5A5O A;  2WAC A;  2RO0 A;  4A9M A;  5CUB A;  5FB1 A;  5I86 A;  3HME A;  4OVA A;  5F1L A;  3UVW A;  5A5R A;  4B9W A;  5A85 A;  5HEM A;  3JVL A;  4BDY A;  5EWV A;  3MP8 A;  3OQ5 A;  2L85 A;  1JSP B;  2LDM A;  5L96 A;  2WP2 A;  4CFL A;  4X34 A;  5CQ3 A;  4QSR A;  5EPB A;  5FG4 A;  4B9X A;  4NXJ A;  2RI2 A;  5EIC A;  4MEO A;  1RI0 A;  4C5E A;  4LYI A;  3SVG A;  5L8U A;  4WHU A;  5C87 A;  4LYW A;  3U5N A;  4HBY A;  4QBM A;  5FH8 A;  4QR5 A;  3L2R A;  5DKD A;  5HEL A;  2QQR A;  4O7C A;  4ZC9 A;  5FE9 A;  4UYH A;  5CY9 A;  5I88 A;  4YAD A;  3UWN A;  2QQS A;  2GFU A;  3LJW A;  5D24 A;  5DW1 A;  4HXR A;  2DKW A;  4UYG A;  3SVH A;  4BHW A;  3QZS A;  2D82 A;  5A81 A;  4LC2 A;  3P8D A;  5BT5 A;  5D3H A;  3U5J A;  2JTF A;  2D9T A;  3LH0 A;  5CU8 A;  4LZR A;  2FHD A;  4QQD A;  4QQG A;  4QUT A;  5D3N A;  2HQX A;  3OYA A;  5EV9 A;  3UVD A;  2RNY A;  3EAE A;  3UW9 A;  4ZTF A;  4UIX A;  3OMG A;  5F2P A;  4Q0N A;  5TB6 A;  5KTW A;  4CUR A;  2EQK A;  3UV2 A;  4A9F A;  5AD2 A;  4O70 A;  4XUB A;  5IG6 A;  3MET A;  2NXB A;  2EQU A;  2XK0 A;  5FE6 A;  2RHI A;  2L8D A;  4CLB A;  4NR6 A;  3U5O A;  5KH6 A;  5FDZ A;  4HXP A;  4NYV A;  2NLU A;  3DAI A;  4CUP A;  2VYT A;  5TCM A;  4RG2 A;  3DWY A;  1OYX A;  5DFC A;  5FE0 A;  5A5S A;  3OYH A;  4BE0 A;  1OZ2 A;  4PL6 A;  5KTU A;  4Z02 A;  3MB3 A;  2IG0 A;  4QZS A;  4MR4 A;  3F70 A;  3MEA A;  5DKC A;  4QW2 A;  2RNW A;  4QY4 A;  2L84 A;  3D7C A;  5D3R A;  1WJS A;  5ENH A;  3HMF A;  2DAT A;  4BW3 A;  2E5Q A;  3C4S A;  3OYK A;  1OZ3 A;  5EM3 A;  4AKN A;  4DON A;  5A5Q A;  4A4G A;  4E7K A;  4FL6 A;  5CS8 A;  2M1H A;  3IU6 A;  5DY7 A;  4A9O A;  5CQ4 A;  4HXM A;  4ZTJ A;  4QSP A;  4N4F A;  5FE1 A;  5I80 A;  4NQM A;  4IR5 A;  5F63 A;  4TT4 A;  5LKX A;  4TT6 A;  4A9H A;  3O34 A;  5J0D A;  1WUM A;  5CUA A;  3UVX A;  4A9I A;  2CKK A;  2EKO A;  5A82 A;  5F60 A;  2XDP A;  3PMI A;  4E7I A;  4Y03 A;  3FDR A;  5A83 A;  3OYC A;  4UC4 A;  5E9V A;  5EWW A;  4IUR A;  4HBW A;  4PKL A;  2GFA A;  4O74 A;  4N4G A;  5DFD A;  4NQN A;  1XNI A;  4YYD A;  4IR6 A;  3PNW C;  4CUT A;  4YBM A;  4A9J A;  5KCO A;  4BE1 A;  4HXL A;  5A5N A;  4FU6 A;  3OYG A;  2E6N A;  3Q2E A;  1G5V A;  2MWO A;  4YAX A;  5C4Q A;  4IKF A;  4QEU A;  3JVM A;  5D3P A;  5E0R A;  4N4I A;  2DIG A;  4KV1 A;  4LZS A;  4IOR A;  2R0Y A;  3FEO A;  2DIQ A;  5K29 A;  4UYF B;  2MWP A;  2YEM A;  4QNS A;  3UVY A;  5JWM A;  2R57 A;  4MEP A;  2RHY A;  3HMH A;  4QST A;  3SVF A;  4IUT A;  4UYF A;  4TT2 A;  4BW4 A;  1H3Z A;  2X4X A;  5DYC A;  2RJE A;  3S3M A;  5KTX A;  4WIV A;  4IUU A;  4A4E A;  3P1E A;  5EWH A;  3OMC A;  5H1V A;  5LKT A;  3QKJ A;  4NR8 A;  3P8H A;  2F5K A;  4ZW1 A;  4TZ8 A;  5FE3 A;  3MUL A;  4PCE A;  3L2V A;  5HRV A;  2RHU A;  3QZV A;  4YAT A;  4NRB A;  4E96 A;  4O7A A;  3FLG A;  3LQJ A;  3LXJ A;  3L42 A;  4J0R A;  3CEY A;  5CQT A;  2FSA A;  5D7X A;  1E6I A;  5CQ7 A;  4NUD A;  5E73 A;  2N9G A;  4UIY A;  4XY8 A;  5HQ7 A;  2L3R A;  5DBM A;  4PCI A;  1WJQ A;  4IUV A;  3S3N A;  2OSS A;  5HM0 A;  3PMT A;  5FE2 A;  4A4H A;  4E7L A;  3LGF A;  5I89 A;  3S92 A;  4N4H A;  4A9E A;  4RVR A;  4C67 A;  5CPE A;  3JVK A;  4MR6 A;  4HXS A;  4GPJ A;  5AD3 A;  5FRN A;  5F5Z A;  2R10 A;  4QEV A;  5C89 A;  1ZS5 A;  3G0L A;  3H6Z A;  3MEW A;  3GOX A;  2RI7 A;  3OS2 A;  5DW2 A;  2BKD N;  2R0V A;  5KU3 A;  5IGK A;  5EIS A;  2DWW A;  4YBT A;  4C5H A;  4II1 A;  3MP6 A;  2O4X B;  3DB4 A;  4YYJ A;  3OYL A;  3IU5 A;  2OO1 A;  4N3W A;  2RJF A;  5FE5 A;  4IUQ A;  3OS1 A;  3ZYU A;  2YEL A;  4QYL A;  3E9G A;  4BW1 A;  2F6N A;  4YYN A;  1WUG A;  2O4X A;  4ALH A;  4O72 A;  5ENC A;  2JZ2 A;  2E3K A;  3G0J A;  2GRC A;  5CP5 A;  4YH3 A;  4C66 A;  2K3X A;  3O36 A;  4UYD A;  4LRG A;  4O78 A;  5E7D A;  4YYI A;  5LJ0 A;  4A9K A;  5D3L A;  4HBV A;  3GG3 A;  3I3J A;  4CL9 A;  3LYI A;  2DVR A;  5CGP A;  5I7Y A;  5IAY A;  4E7H A;  3P5O A;  5DLX A;  4CUS A;  2R5M A;  4QB3 A;  2RHZ A;  2LTO A;  4NR9 A;  1JM4 B;  5KE3 A;  4E7J A;  5DYA A;  5LJ1 A;  2B8A A;  3ME9 A;  5D25 A;  2BIV A;  4TU4 A;  2M16 A;  2YDW A;  4Z6H A;  3ZEH A;  5LUU A;  2OUO A;  1WGS A;  4QSX A;  4IR3 A;  2H60 A;  5F36 A;  5HJC A;  3K2J A;  3FC3 A;  5DFB A;  5D3S A;  3QJ6 A;  3DB3 A;  2YYN A;  4YYM A;  1MHN A;  4XY9 A;  3L2W A;  5EPR A;  5EPS A;  2R5A A;  3OYE A;  5CFW A;  4YK0 A;  1WJR A;  3S3O A;  3U5L A;  5D3J A;  4CFK A;  5EA1 A;  5IID A;  5M9O A;  4BAC A;  4QYD A;  4UIU A;  2DVV A;  2KTB B;  5H1T A;  1F68 A;  5ETB A;  5I7X A;  4HBX A;  4YH4 A;  5II2 A;  4CUU A;  5JI8 A;  2I7K A;  4PTB A;  4QSS A;  4YYG A;  4NUE A;  4OUF A;  2G3R A;  4A9L A;  5DYU A;  4QSU A;  4TYL A;  3MXF A;  4BJX A;  3H8Z A;  3OYD A;  5ENI A;  5ENJ A;  5E9Y A;  5D6Y A;  4IUP A;  4QR3 A;  4CUQ A; 
#chains in the Genus database with same CATH topology
 4F3I A;  1D0X A;  2LT4 A;  2DAQ A;  4LYS A;  2DX1 A;  4QC3 A;  3JCM P;  2EYW A;  4ESR A;  2K3Y A;  1K8A R;  4M7A E;  5HLS A;  2QDL A;  1HYO A;  1MMD A;  3VRY A;  1G2B A;  2QAZ A;  1H92 A;  4CC4 B;  5GAN f;  2RHX A;  4UIV A;  3X25 B;  1N27 A;  4YYK A;  3I56 T;  5D6W A;  3P1F A;  4A4F A;  3CXC S;  2E3I A;  5C7N A;  2DNU A;  4HCC A;  4NYW A;  4XUA A;  4D8K A;  2E4H A;  2E7O A;  1HD3 A;  2YEK A;  5EI4 A;  4EMG A;  4LUD A;  1X2Q A;  2W0Z A;  4RTV A;  2CH4 A;  2ED0 A;  1SG5 A;  4PLI A;  1GBQ A;  2KRS A;  2L0A A;  2QAS A;  3JAM E;  5FFY A;  3OSV A;  2MCN A;  4A53 A;  3TRE A;  1S72 T;  2VB6 A;  5FG5 A;  5IGN A;  2RJC A;  3L2U A;  1B7T A;  4C5G A;  4C8Q G;  2A28 A;  2QQ9 A;  5HFR A;  1PG5 B;  4PLL A;  5H85 A;  5CIU A;  5EWD A;  4Z1S A;  4KH1 B;  4AKI A;  3LW5 E;  3GBQ A;  5KYX B;  2KY9 A;  2I8N A;  1M90 C;  5L97 A;  1YWP A;  2FEI A;  4Q5W A;  4NRC A;  1IXD A;  5KHM A;  3J80 E;  2VGM A;  1NM7 A;  2DMO A;  1Q81 C;  5IXB A;  2CZ7 B;  5FBX A;  4M77 B;  3EFS A;  4HVV A;  2VV5 A;  4QSW A;  3CCV Q;  5LJ2 A;  4NUC A;  2MJV B;  2VAS A;  3MP1 A;  4O76 A;  1NLO C;  5E9L A;  4QUU A;  3QSU A;  4B6M A;  2LQW A;  4PJO C;  1UB4 A;  3OYI A;  5EU1 A;  2LT1 A;  4XTZ A;  5KYU B;  1IGU A;  3C12 A;  4PJO F;  3EG3 A;  2DYB A;  5GJV B;  5HCK A;  3SB2 A;  2CH4 W;  1S72 A;  5D26 A;  5CO7 A;  1PD0 A;  5FU6 C;  1VQM A;  3HSB A;  5LVQ A;  1M3A A;  3CC2 Q;  5EVA A;  1EFN A;  2A36 A;  2V26 A;  4JRP A;  3CCR A;  5F1H A;  2V8I A;  5BT4 A;  4LD6 A;  4RG8 A;  5DX4 A;  2E10 A;  4LR6 A;  1I8F A;  5KYW B;  3KUF A;  1G8X A;  1QWF A;  2YWW A;  4BY6 B;  5A0L A;  3CCE T;  2YRV A;  5LJ3 j;  2K3B A;  3TU4 K;  2EQM A;  2EYX A;  1M1K C;  2RK2 A;  3EG9 A;  5FB0 A;  4M7D F;  4JPB W;  3H0H A;  4LZ2 A;  4M77 E;  3BW1 A;  3S91 A;  3X24 B;  4CI0 C;  4Z93 A;  1VOM A;  3I9Q A;  3VUZ A;  1ZUU A;  4BDZ A;  2EJG A;  1K76 A;  5A5P A;  2QA4 Q;  2K79 A;  5C8G A;  5FH7 A;  4HXJ A;  5GJW B;  4CC7 A;  3JCM W;  3SWN C;  3HRS A;  2GGR A;  3R6O A;  5FG6 A;  4O7F A;  1MNE A;  4TZ2 A;  3M9Q A;  4KUI A;  3RKY A;  3L1A A;  5CZG A;  1T3S A;  4QC1 A;  1ZX6 A;  2OJ2 A;  2C06 A;  5IH2 A;  1RAD B;  4ALG A;  4FCY A;  2KYM A;  4MR3 A;  3LX7 A;  3U5P A;  2EJF A;  3JB9 G;  3RBB B;  2QG9 B;  1U5S A;  1FX7 A;  1YJN T;  3CCE A;  1EQF A;  4R0K A;  2YQD A;  2HMA A;  1VQ7 Q;  2EYQ A;  1VQ9 T;  2ZPE B;  4LDF A;  4NR4 A;  2DXB A;  4V2S A;  3QG1 A;  1JBM A;  5F61 A;  4HCZ A;  4OB2 B;  4HA8 A;  1O75 A;  1QCO A;  2CS7 A;  1XQH A;  4QQ6 A;  1PRM C;  3OBW A;  3UV5 A;  1OV3 A;  4YYH A;  1GCP A;  3OS0 A;  3I35 A;  3MUK A;  2QEX Q;  3PGG A;  1IRE B;  1QP2 A;  1RAC B;  3RES A;  2OTL Q;  3GLX A;  1AWJ A;  5FLX E;  4DOW A;  3CC4 T;  2VXE A;  5A85 A;  5HEM A;  2FL7 A;  3OQ5 A;  1KSW A;  4ME7 A;  1NYF A;  4KT0 E;  1IHV A;  3V7C A;  4M7D A;  2F1L A;  1JXO A;  4QSR A;  2RI2 A;  5GAM j;  4MEO A;  1YJN A;  1RI0 A;  2X3W D;  3SVG A;  5L8U A;  1LPL A;  1PD1 A;  1VQ9 A;  4LYW A;  4HBY A;  2M9U A;  3JCM e;  4QR5 A;  3MCA B;  5HEL A;  3QYG B;  2A3L A;  2ENM A;  4LDX A;  5D24 A;  1QP3 A;  1RAE B;  3SVH A;  4A63 B;  2O88 A;  4RTU A;  1QVF S;  4MZP A;  4M78 G;  2KMT A;  2JTF A;  5HK3 A;  3CC7 Q;  1AHJ B;  4LZR A;  1Q95 G;  2FHD A;  3OYA A;  3EAE A;  3EG1 A;  2JJ9 A;  4L6V 5;  2KAF A;  3CCJ Q;  4M75 B;  4DEX A;  4CUR A;  3THK A;  3CC4 A;  3UV2 A;  1M9S A;  2XK0 A;  4ZGE B;  4NR6 A;  2LX9 A;  2Y90 A;  3VYG A;  5GAN 3;  5FDZ A;  1BIA A;  2JMA A;  2NLU A;  3DAI A;  4CUP A;  2J06 A;  2LJ1 A;  3OYY A;  4E47 A;  2VWF A;  1Q7Y R;  3ER0 A;  2HL5 C;  3DWY A;  5DFC A;  3QZ9 B;  5IHI A;  2VUB A;  5I21 A;  1VQ6 T;  1FYN A;  3HHT B;  4Z02 A;  3MB3 A;  3F70 A;  4RTY A;  1QKW A;  5D3R A;  1WJS A;  4C8Q F;  3OBY A;  2DO3 A;  4BW3 A;  3C4S A;  3CXC P;  1OZ3 A;  4X1V A;  4EMK B;  1KIK A;  3V8L A;  4A4G A;  5GAO r;  1Q86 U;  4M75 E;  3IU6 A;  4A9O A;  2ROT A;  3CPW S;  2COY A;  4IIO A;  5FE1 A;  5I80 A;  4NQM A;  4TT4 A;  1KC8 R;  1I1J A;  3O34 A;  5CKD A;  5CUA A;  2DTI A;  2XDP A;  4FSS A;  5E9V A;  3REB B;  4JZ4 A;  4PKL A;  2CGH A;  4N4G A;  1K4U S;  2O9V A;  3M58 A;  5KCO A;  4BE1 A;  5A5N A;  4XTX A;  2E6N A;  3Q2E A;  2MWO A;  4YAX A;  3JB9 J;  2V1Q A;  2ESW A;  3TSW A;  2O9S A;  4JJC A;  4XTY A;  5D3P A;  2CZ6 B;  5E0R A;  4N4I A;  4LZS A;  4N0A C;  1K8A C;  2R0Y A;  1SRM A;  3FEO A;  5K29 A;  4UYF B;  2D6F A;  2YEM A;  4QNS A;  4MEP A;  1D3B B;  3A8O B;  4IUT A;  5GMK l;  4MZT A;  4AI6 A;  1U06 A;  2BZ8 A;  1YIT Q;  2RJE A;  5KTX A;  5EWH A;  3OMC A;  2KRO A;  2F5K A;  1M3B A;  4PCE A;  3FJ5 A;  1T0H A;  2J6F A;  3KBG A;  3CXC A;  4YAT A;  1QW1 A;  4E96 A;  5CK9 A;  4PFO A;  1WYX A;  1RAB B;  2I2L A;  4EIK A;  2OI3 A;  2JN0 A;  5D7X A;  1E6I A;  1IGQ A;  5E73 A;  4NUD A;  4XY8 A;  3JCM c;  3M0Q A;  2L3R A;  5DBM A;  2LP5 A;  2M02 A;  5KYY A;  2DEU A;  1WJQ A;  1ZA2 B;  4C8Q A;  3PIP A;  2L3Q A;  2DEQ A;  3PMT A;  5FE2 A;  1I07 A;  1UGP B;  2KRN A;  3VU3 C;  2XDB A;  3LGF A;  1J3T A;  3GP8 A;  2A37 A;  4MR6 A;  1VQK T;  4HXS A;  2DJQ A;  1Y7X A;  2P4T A;  2R10 A;  4QEV A;  3I56 Q;  2L3S A;  3MEW A;  5LJ3 h;  4OMF B;  3GOX A;  3JB9 F;  5DW2 A;  3JCM Q;  4M7D D;  2R0V A;  5KU3 A;  1WXT A;  5IGK A;  3GF5 A;  5KYX A;  5EIS A;  4C5H A;  3JCM f;  4N3W A;  3MHX A;  1E6G A;  2IIM A;  2YEL A;  4QYL A;  4BW1 A;  1WXB A;  2DVJ A;  1YJW T;  5ENC A;  1PRL C;  3G0J A;  4YH3 A;  4R55 A;  5GMK i;  3O36 A;  4UYD A;  1ZSG A;  5LJ0 A;  1BI3 A;  1UFF A;  3MKD A;  4HBV A;  4PJJ A;  4CL9 A;  4CC2 A;  5I7Y A;  5KYU A;  3P5O A;  4CUS A;  4BI4 A;  1UEB A;  2LTO A;  4NR9 A;  3JCM X;  3PT9 A;  1QQJ A;  5LJ1 A;  3ME9 A;  5D25 A;  2BIV A;  5IHN A;  1ZHI A;  5LUU A;  3RMS A;  2DD4 A;  1VQK A;  2DZC A;  4C92 B;  1QCF A;  5DFB A;  1W70 A;  1TUC A;  2EKH A;  1MHN A;  2X51 A;  4TVR A;  2DBK A;  1FMW A;  1U1S A;  4C92 G;  2OTL T;  4FW1 A;  4CFK A;  2HBW A;  2CZ1 B;  4LDV A;  1M8M A;  1F68 A;  5ETB A;  5I7X A;  1D0Y A;  1YJW A;  2GCX A;  5GAN e;  2KEA A;  3A98 A;  2FPD A;  1C0M A;  2G3R A;  2W10 A;  4R56 A;  3HL8 A;  4QSU A;  2EPD A;  3G7Z A;  1TTH B;  3OYD A;  1VIF A;  5E9Y A;  4M78 F;  2CZ0 B;  2YUP A;  4IUP A;  3X20 B;  2KK4 A;  5CUG A;  5J26 A;  5EWC A;  4D8D A;  1GCQ A;  3BY7 A;  2HKN A;  4EDU A;  1WA7 A;  4YY4 A;  3CCE Q;  5A2Q E;  5CUD A;  3D1D A;  1ARK A;  1RLQ C;  3RMQ A;  4ATO A;  5HY6 A;  4ORZ A;  4C5I A;  3FKM X;  2FB7 A;  1XTD A;  1EIF A;  5HK0 A;  5FFV A;  7AT1 B;  5GAM h;  5CKE A;  5BT3 A;  1YP5 A;  4AG1 C;  2E70 A;  2BUD A;  2LX7 A;  5EG2 A;  2QGG A;  3M5A A;  1PSF A;  2OTL A;  3VS3 A;  1WX6 A;  4GBQ A;  4OMQ A;  1QVF P;  2KXD A;  2DL8 A;  3CCJ T;  2LJ0 A;  5CRM A;  5F62 A;  3E19 A;  1D09 B;  4XAX B;  5COI A;  4EMH A;  1BI0 A;  4J9B A;  4F7U G;  4KGX B;  4JJD A;  5FU6 B;  4OGJ A;  1WFW A;  2F2W A;  2EQI A;  2ZPB B;  1UTI A;  1G3S A;  4AKG A;  1VYT A;  2E12 A;  5ENF A;  3QII A;  2NUP A;  2A0F B;  4J3I A;  2V8J A;  2D0N A;  3ASK A;  2FZK B;  4FYX B;  2G4A A;  5DLZ A;  5GAN g;  3UA6 A;  4XU1 A;  2JOY A;  1YJN Q;  2KNB B;  5CKH A;  5EC7 A;  1ABO A;  2DA9 A;  2LCC A;  1VQ9 Q;  4OMM A;  1OU8 A;  2MYS A;  5E3G A;  3NTH A;  3C94 A;  1G3Y A;  3AAD A;  3GIB A;  4LDW A;  2IVW A;  5I29 A;  1LVK A;  2RK1 A;  4KGV B;  3A8M B;  2WSC E;  5FE8 A;  4PJO E;  3SD4 A;  5I2S A;  4ANJ A;  2SRC A;  3CC7 A;  4PFZ A;  3AT1 B;  2EWN A;  2JNG A;  2LJ3 A;  5C85 A;  3UF4 A;  5C0M A;  2C0T A;  3O37 A;  3ZL7 C;  4J9F A;  1R0B G;  4CRI A;  1W4S A;  3CCJ A;  1LJO A;  4C8Q D;  2LRQ A;  1X6B A;  5E9K A;  4PFP A;  1RAH B;  4M78 A;  5LJ3 f;  4OMP A;  3V8K A;  4XTU A;  1Q82 U;  4E2F B;  5L8T A;  3CPW P;  3M53 A;  3CC4 Q;  2YRC A;  2CSI A;  4YAB A;  3QBY A;  2AZS A;  2KE9 A;  3EFO B;  1QVF A;  3JCM V;  2RNX A;  4KH0 B;  3UDC A;  5KE2 A;  1EZZ B;  1Q82 C;  4O7E A;  1ZBJ A;  5FE4 A;  1G83 A;  4M7A B;  2RO1 A;  1NPP A;  2RJD A;  4Z6I A;  3O33 A;  4QKU A;  5CUE A;  5HCL A;  1Q7Y C;  4M7A G;  2JW4 A;  3MB4 A;  4PK4 A;  4OB1 B;  2DVQ A;  5A0G A;  2GNC A;  3I5R A;  1Y71 A;  5DYX A;  2Z0W A;  5IGL A;  1JU5 C;  4DQ2 A;  1Q86 R;  1OUL A;  2PQW A;  1HSQ A;  2EJN A;  3ZFJ A;  3EGD A;  5CUC A;  5HEN A;  3QO3 A;  1Z9Z A;  2GTO A;  5HRX A;  2YW5 A;  3LQI A;  3VS0 A;  4XQ3 A;  3QWY A;  2QTX A;  5ENE A;  2JS2 A;  1P92 A;  3E9F A;  4KUL A;  1KC8 C;  2FYK A;  4YC9 A;  2YLC A;  4IOQ A;  4ZNX A;  2HCK A;  3C95 A;  3CPW A;  2VGN A;  2R58 A;  1JXM A;  1TUD A;  2BE9 B;  1NJI U;  1GFC A;  3LWH A;  3M4G A;  2KR3 A;  1VQ6 Q;  2HQE A;  3QWX X;  3UT1 A;  1PUO A;  2XID A;  3FB9 A;  3RCW A;  1NPR A;  1YIT A;  2DFU A;  4FT4 A;  3J7A F;  2KT1 A;  4Z1Q A;  3U5K A;  1AWX A;  5E9I A;  5GAM f;  5GMK h;  3HRU A;  5GAO p;  5L23 A;  5A5O A;  2Y4X A;  4BUG A;  5LJ5 g;  3NFC A;  4FW2 A;  2RO0 A;  3JB9 D;  1IRX A;  5CUB A;  2JXB A;  4J9D A;  5I86 A;  3HME A;  4OVA A;  2CDT A;  3UVW A;  4B9W A;  1KQS P;  1BBZ A;  4BDY A;  2LCL A;  3MP8 A;  2NUT B;  2PTK A;  4C92 F;  2L85 A;  1JSP B;  2LDM A;  4CFL A;  2WP2 A;  4X34 A;  1JB0 E;  5CQ3 A;  3CQT A;  2M0Y A;  2HBP A;  4C5E A;  1PC0 A;  4WHU A;  2O31 A;  4QBM A;  2EGA A;  3I56 A;  2KQW A;  4ZC9 A;  4JLI A;  1Y96 A;  1NZ9 A;  1W6X A;  3RDV A;  2QQS A;  1YIJ T;  1QVG P;  5DW1 A;  3M59 A;  4AMC A;  2RN8 A;  1TOV A;  4JLG A;  2WSF E;  4M77 G;  2ATC B;  2PUK B;  3QZS A;  1X69 A;  3RUX A;  4AFQ C;  4LC2 A;  2DRK A;  4LDU A;  3LH0 A;  5LJ5 d;  5CU8 A;  4QQG A;  1C6V X;  1OX8 A;  1JRI A;  2HL3 A;  4J7F A;  4BI3 A;  2RNY A;  5GAO m;  3UW9 A;  4UIX A;  4PNO A;  4Q0N A;  5TB6 A;  5KTW A;  2EQK A;  2ZCF B;  4O70 A;  2C0O A;  2DL4 A;  5FE6 A;  2L8D A;  1M1F A;  4M7D C;  2DYI A;  3EH1 A;  1I5L A;  2JM9 A;  1OYX A;  4F7U F;  5FE0 A;  2ZAE A;  4M78 D;  1N8R U;  1VQK Q;  1NEG A;  5AYF A;  2LNH B;  4QW2 A;  1PM3 A;  3TEE A;  2L84 A;  1YIJ A;  3HMF A;  2DAT A;  2E5Q A;  3OYK A;  1HXD A;  5EM3 A;  4AKN A;  2L2P A;  2HAX A;  2QXF A;  4E7K A;  2F5T X;  5CS8 A;  5DY7 A;  1AD5 A;  4QSP A;  2RMO A;  4C92 A;  4OMO A;  5GAN 8;  2CP7 A;  1YJW Q;  1GFD A;  5LKX A;  1YNZ A;  3EHR A;  4A9I A;  5A82 A;  3FDR A;  2D1X A;  2OTJ T;  2FRY A;  4HBW A;  5GAN 6;  1N5Z A;  2GFA A;  2LQN A;  3JRZ A;  1XNI A;  2LNV A;  3PNW C;  4IR6 A;  1ZSZ A;  1SF9 A;  3QXE B;  2B86 A;  4A9J A;  2DBM A;  5LL6 S;  1M2V A;  1G5V A;  1OX9 A;  4QEU A;  2X3X D;  2DIG A;  2XD0 A;  1D1C A;  2RHY A;  3HMH A;  3SVF A;  2MPX C;  4WIV A;  4XK8 E;  4A4E A;  1MGQ A;  3P1E A;  1WXU A;  2JM8 A;  1UUE A;  3P8H A;  4M7A F;  4HT8 A;  3V7S A;  4TZ8 A;  2F2X A;  1TSF A;  3QZV A;  2DM1 A;  1B3Q A;  4F7U A;  2OTJ A;  4O7A A;  3FLG A;  3L42 A;  2CT3 A;  5CQT A;  4ZN1 A;  2FSA A;  2CT4 A;  1M30 A;  3NPF A;  4Y28 E;  4OGE A;  1TU0 B;  4D6W A;  4OF1 A;  3EGU A;  4N4H A;  4A9E A;  1K9M U;  3UA7 A;  5CPE A;  3JVK A;  3CME T;  1B34 A;  4GPJ A;  2KT8 A;  4RUG A;  1VYV A;  1O9S A;  1ZBX A;  3H6Z A;  1BIB A;  2HSE B;  2P0P A;  1V76 A;  4OP0 A;  4KBM B;  2BE7 D;  1MMA A;  2E3H A;  3CCL T;  1K73 U;  1K9M C;  2RH2 A;  3DB4 A;  3O5Z A;  2RJF A;  3CCU T;  2BZY A;  1Q82 R;  3SHW A;  3ZYU A;  4M75 G;  4YYN A;  2O4X A;  4O72 A;  2JZ2 A;  5CP5 A;  4LDY A;  2GRC A;  4FYY B;  1XOV A;  2FRW A;  5E7D A;  4YYI A;  3M0R A;  1VQL T;  9ATC B;  2J6K A;  2O01 E;  3I3J A;  3OW2 S;  3LYI A;  5CGP A;  5IAY A;  4C8Q C;  2R5M A;  3CPF A;  2RHZ A;  4QB3 A;  1TUG B;  5KE3 A;  1PCX A;  4HCB A;  4J6W A;  2XU8 A;  5DM7 R;  3EFO A;  4Z6H A;  4WTO B;  3CME A;  2LQ8 A;  2RQT A;  1MV3 A;  3JCM g;  4J9I A;  4JDS A;  4AT1 B;  5F36 A;  3FJP A;  1JJ2 S;  4RTW A;  3K2J A;  5D3S A;  1RL2 A;  3QJ6 A;  4AKH A;  2DK3 A;  4M7A A;  4YYM A;  1NE8 A;  3M0P A;  5EPS A;  3A8L B;  4YK0 A;  1K9A A;  2LMJ A;  2E41 A;  1FMV A;  3CCL A;  1NLP C;  1WJR A;  3U5L A;  1NYG A;  5GAO l;  1KHI A;  5EA1 A;  5IID A;  3CCU A;  4BAC A;  2NYS A;  2KTB B;  2DVV A;  5CR2 A;  4YH4 A;  1D1B A;  2I7K A;  1Q86 C;  4QSS A;  1PKT A;  1TWB A;  3DKM A;  4OUF A;  5DYU A;  4PJL A;  3MXF A;  1X27 A;  4M77 F;  2ED1 A;  4Z89 A;  5ENJ A;  4J9G A;  5D6Y A;  4QR3 A;  4GLK A;  1VQP T;  1JQQ A;  1OQK A;  3U5M A;  1WI7 A;  2X4W A;  4HXN A;  1BKB A;  5ENG A;  1VQ6 A;  1NJI R;  3VRZ A;  2R0S A;  5D7U A;  2MIO A;  2KGT A;  3WVE B;  5CQA A;  2JMC A;  2L5E A;  5E3D A;  1GRI A;  4C92 D;  4IIM A;  5LKU A;  1AVZ C;  3AQA A;  3LQH A;  4DBR A;  1WNL A;  5ECA A;  3AHU A;  4AFS C;  1SHF A;  2RI3 A;  4BD3 A;  3JCM b;  4WHW A;  3CCM Q;  3JSC A;  2LSP B;  2AKL A;  3GPL A;  1K0S A;  2RI5 A;  1RAF B;  4HXK A;  4JZ3 A;  2RD1 A;  2QTV A;  4J83 A;  5LJ5 j;  4VUB A;  1BB9 A;  4LN2 A;  5FRM A;  2EJ9 A;  4A9N A;  2EQJ A;  5EP7 A;  3GNG A;  2QI2 A;  4GY5 A;  5EQ1 A;  5ENB A;  1I5O B;  2QYZ A;  1SSH A;  4NR5 A;  1AT1 B;  2KSS A;  3OYN A;  1VQP A;  4NRA A;  1M5Q 1;  3EHQ A;  3M55 A;  5I1Q A;  4BW2 A;  1GCQ C;  2ECZ A;  2I0N A;  3M0U A;  3PFS A;  5A7C A;  1ABQ A;  2DVE A;  3A8H B;  5LJ3 e;  3PTA A;  5GMK j;  4JJB A;  5LVR A;  4TS8 A;  3U23 A;  2AT1 B;  4XTW A;  2EW3 A;  2NUT A;  2BZX A;  5I11 A;  4UIZ A;  2X9H A;  1N9S A;  3MEU A;  3L2Z A;  1E6H A;  5H1U A;  1LOJ A;  2PU9 B;  1GL5 A;  5CQ6 A;  5J39 A;  1BCO A;  1I0C A;  5FRO A;  4QR4 A;  2VC8 A;  1WDX A;  3INZ A;  2YUQ A;  1D1A A;  4M77 A;  2F6J A;  4MR5 A;  2FPF A;  2RS9 B;  3D1B A;  5G4R A;  1KQS S;  4LE9 A;  1KG1 A;  1LCK A;  1X75 C;  1SEM A;  2X4Y A;  2FVU A;  4MDX A;  5IBN A;  3MPU B;  4JS4 A;  2J7I A;  8ATC B;  3PIO A;  4Q0O A;  1AWW A;  2ZPI B;  4J9H A;  4E7Z A;  4LXC A;  3T9N A;  4QSQ A;  2JTM A;  2MAM A;  3PVL A;  1YBY A;  4C0D C;  2O2O A;  1Y07 A;  4ZGD B;  3HKS A;  2HD0 A;  4J6X A;  1ZLM A;  4XYA A;  5FW9 A;  5GAO n;  1KFZ A;  3EG9 B;  1OI1 A;  5AME A;  5HQ5 A;  2EGC A;  3REA B;  1N8R R;  1BYM A;  1QVG S;  1VQ4 T;  4KRT A;  3VS7 A;  1VQ8 T;  2YSQ A;  4X9D A;  2CP6 A;  4PJN A;  5KYW A;  1N6A A;  3Q2F A;  1YIJ Q;  2X35 A;  2HEQ A;  1RI9 A;  5HQ6 A;  2HSP A;  3VS1 A;  4ZN3 A;  1SKU B;  2FPE A;  4O75 A;  2LCS A;  4NYX A;  4UIT A;  4PY6 A;  5CTL A;  3NGP A;  3PVQ A;  5D3T A;  4M78 C;  5GAN 5;  3JB9 I;  1SSF A;  5KO4 A;  5CQ5 A;  3CCS T;  3DLM A;  4OGI A;  4NR7 A;  5E9M A;  4IOO A;  4O77 A;  2K5I A;  3G4S T;  4YY6 A;  5HFQ A;  4NS5 A;  3S6W A;  2DF6 A;  4M7A D;  2E7N A;  2YDL A;  5EGU A;  1KQ2 A;  5GAM e;  5CKB A;  4O71 A;  5I83 A;  2SEM A;  3M54 A;  3UPU A;  4M75 F;  5HRW A;  1VQ4 A;  2HKQ B;  2MI6 A;  4O5V A;  2JVV A;  1VQ8 A;  5GAN h;  1V1C A;  1UHC A;  1BCM A;  1MMN A;  4JS5 A;  5IGM A;  4PJO B;  1UDL A;  4QVZ A;  1AWO A;  5D6X A;  3JB9 H;  3ONI A;  5CRZ A;  2JS0 A;  1PKS A;  4PJO G;  4ZQL A;  2PVO B;  3A8G B;  4PS5 A;  3OA6 A;  4MEQ A;  1OU9 A;  3R6N A;  1T0J A;  3CMA T;  1AZE A;  2K9G A;  5F1L A;  2OTJ Q;  4M7D B;  1MMG A;  1UHF A;  4X9C A;  5FU7 C;  2F2V A;  4RCC A;  2EBP A;  3SDZ A;  5L96 A;  2CSQ A;  1RLP C;  2XIC A;  1CKB A;  5EPB A;  4B9X A;  3OW2 P;  3HTR A;  4BB7 A;  3QDF A;  3JV3 A;  4FYV B;  1T3L A;  2D8J A;  3U5N A;  2DIL A;  3M56 A;  5FH8 A;  3QZ5 B;  4AFU C;  1PHT A;  1D0Z A;  5DKD A;  1U3O A;  3V7R A;  1K9M R;  3CD6 T;  2QQR A;  5GAM g;  1VIE A;  1YI2 T;  4J7I A;  1CKA A;  5CY9 A;  1Y57 A;  5I88 A;  4YAD A;  3UWN A;  1JJ2 P;  3LJW A;  3SWN B;  4HXR A;  2PUO B;  2DKW A;  4UYG A;  4RTZ A;  4BHW A;  2D82 A;  1RAA B;  5BT5 A;  1K73 R;  3ZBD A;  2D9T A;  2HQX A;  1F1B B;  5EV9 A;  2RM4 A;  3G71 T;  2EYZ A;  3CMA A;  1Z9Q A;  4ZTF A;  2DET A;  3LWI A;  3OMG A;  1BU1 A;  5F2P A;  4M7D E;  5GAN d;  5AD2 A;  4XUB A;  3MET A;  1VYU A;  2L3P A;  2NXB A;  4J9C A;  5KYN A;  4M75 A;  5CQX A;  2RF0 A;  1X01 A;  1QKX A;  4CLB A;  1PSE A;  4RKU E;  3U5O A;  3D7S B;  3M57 A;  3QPH A;  2OAU A;  4NYV A;  2VYT A;  1H64 1;  4J5Y A;  4M77 D;  4RG2 A;  1WZO A;  3OYH A;  4BE0 A;  1ZQ1 A;  4OGC A;  3CD6 A;  3CME Q;  1YI2 A;  4MR4 A;  5DKC A;  2YT6 A;  4QY4 A;  3CCM T;  2DPP B;  1IO6 A;  1ACM B;  2EIF A;  2VVK A;  3OW2 A;  1YCS B;  1A0N B;  1M4Z A;  4JRQ A;  6AT1 B;  4RCB A;  3DLL A;  3CCL Q;  1R8O B;  3WVD B;  1YJ9 Q;  4Z8A A;  1OEB A;  2M1H A;  4EMK A;  3CCU Q;  5CQ4 A;  4HXM A;  3QUI A;  4ZTJ A;  1LNX A;  1YHQ T;  2EGE A;  4N4F A;  1JJ2 A;  2AIR B;  1KD1 U;  4A9H A;  5J0D A;  1GBR A;  2CKK A;  3PMI A;  1GXI E;  5F60 A;  2XG8 D;  4PKC C;  4E7I A;  4Y03 A;  5A0D A;  5A83 A;  5LJ5 h;  4UC4 A;  1VQL Q;  5EWW A;  1BI1 A;  2DLP A;  2KXC A;  5DFD A;  4CUT A;  2XDD A;  4YBM A;  1NBE B;  3OYG A;  2OAW A;  4IKF A;  3P8B B;  2DJZ A;  1YN8 A;  1NJI C;  5GMK e;  1C1A A;  1VA7 A;  4KV1 A;  3CCM A;  4Z88 A;  2MOX A;  2DIQ A;  1H3H A;  4PJM A;  5JWM A;  4QT7 A;  3RKW A;  3ERR A;  1FXX A;  2GQV A;  4UYF A;  1H3Z A;  1OOT A;  2DL5 A;  2X4X A;  1AEY A;  1D3B A;  4DBH A;  2ROL A;  4RTT A;  3S3M A;  1QLY A;  4IUU A;  2K6D A;  4C92 C;  1YHQ A;  3QKJ A;  4NR8 A;  4FYW B;  4AFZ C;  1VQ5 T;  5FE3 A;  3L2V A;  4M4Z A;  2RHU A;  4J6Y A;  4HCK A;  4F17 A;  5KYY B;  3LQJ A;  3LXJ A;  2H3J A;  4C8Q B;  4J0R A;  3CEY A;  1VQP Q;  1RUW A;  2P4R A;  1ZSZ C;  4UIY A;  2RA2 A;  1VQM T;  1M90 U;  1UGR B;  3S3N A;  2OSS A;  3CBM A;  3CCR T;  4A4H A;  5I89 A;  3S92 A;  2KBT A;  4C67 A;  1Q81 U;  3VKI A;  5AD3 A;  1KQ1 A;  3H41 A;  3NMZ C;  1UEC A;  2NUZ A;  1ZS5 A;  2RPN A;  3QJY A;  2RQU A;  1OPK A;  2EVR A;  3OS2 A;  2BKD N;  1TG0 A;  1QWE A;  1M3C A;  1UJ0 A;  1KK7 A;  4II1 A;  3G6E T;  1UJY A;  3OYL A;  3IU5 A;  4LD9 K;  1ZUK A;  1E7O A;  4RMO A;  5FE5 A;  1AZG B;  4IUQ A;  1VQ5 A;  2F6N A;  2CP0 A;  4ALH A;  4HKE A;  2E3K A;  1MV0 B;  4C8Q E;  2K3X A;  4WF2 A;  1K0X A;  4LRG A;  4O78 A;  2FZG B;  3URG A;  2DL7 A;  4F04 B;  1R0C B;  5AT1 B;  2HDA A;  1KQS A;  1M1K U;  1JM4 B;  4E7J A;  5DYA A;  4Y91 A;  2A7Y A;  3EGX B;  3VKG A;  3H0I A;  2M16 A;  2YDW A;  3ZEH A;  2XMF A;  2OUO A;  4QSX A;  3E2U A;  2H60 A;  1QMC A;  3X28 B;  5HJC A;  3FC3 A;  1N8R C;  4M75 D;  4DEY A;  5FWC A;  3RER A;  3DB3 A;  5DLQ E;  2R5A A;  3OYE A;  2JUF A;  3X26 B;  4XU2 A;  3CCQ T;  2M51 A;  2XKO C;  3M4Y A;  3S3O A;  2DZ9 A;  3G6E A;  1QVG A;  2QQB A;  3HP9 A;  4FM4 B;  1VQN T;  2J6O A;  2HQH A;  4QYD A;  4UIU A;  4HBX A;  1BI2 A;  5II2 A;  2C0I A;  5GMK m;  3HFN A;  4YYG A;  4NUE A;  3NHN A;  4A9L A;  3GNF B;  3BFM A;  3QYH B;  1WHM A;  4P5N A;  4BJX A;  5ENI A;  1M1G A;  4CUQ A;  3VJP A;  3MQM A;  3MEV A;  1U1T A;  3LLR A;  3VS5 A;  2CRE A;  4HT9 A;  5LJ5 f;  1X0J A;  2VKN A;  1XJW B;  1X6G A;  1VQ4 Q;  3H9N A;  3NTI A;  2YHT A;  1VQ8 Q;  5ETD A;  4HXO A;  2DKG A;  1I4K 1;  4OB3 B;  1WHK A;  4CC3 A;  3VKH A;  3OS5 A;  2HNI A;  4M7A C;  4KUD K;  2YUO A;  2RFJ A;  4L59 A;  5I2M A;  3CCQ A;  3C0C A;  4DBQ A;  4TU6 A;  1MND A;  4YBS A;  1VQN A;  4FT2 A;  1NG2 A;  4PJO A;  3NTK A;  2YLB A;  3P1C A;  3CCS Q;  4TQN A;  2NUP B;  4F14 A;  5FFW A;  4NL2 A;  1M8V A;  2J05 A;  3M0T A;  2DTH A;  3G4S Q;  3I55 T;  2BTT A;  4WCI A;  2CUB A;  5AMF A;  5GAN j;  5FWB A;  4C0D B;  4IR4 A;  2DE0 X;  2FO0 A;  1IB8 A;  2D8H A;  1PWT A;  3OYM A;  1MUZ A;  1TS9 A;  1SPK A;  3EG2 A;  3EG0 A;  2AKK A;  1M27 C;  1WLP B;  4X2I A;  5GAN 7;  2CYZ B;  4J0S A;  3LGL A;  3N5B B;  3Q1J A;  3OB9 A;  5I40 A;  5II1 A;  2LQK A;  5F3A A;  4J8O A;  2COZ A;  4BE2 A;  5HKC A;  4QEW A;  5L99 A;  2Y4Y A;  3TLP A;  1YJ9 T;  4QSV A;  5LKZ A;  2DTO A;  4M78 B;  4XU3 A;  4FLP A;  2DL3 A;  3JCM h;  5CQ8 A;  3A1P A;  2DD5 A;  2KDS A;  1YFN A;  2ZPH B;  5L98 A;  1UGQ B;  3VUB A;  1KHC A;  3PE0 A;  3CMA Q;  1WQW A;  5GAN 4;  3SWN A;  3UV4 A;  1K73 C;  3I55 A;  5KCH A;  3CBO A;  5E74 A;  1FMK A;  2L5Q A;  5DLO A;  1ZKR A;  5FE7 A;  3ULR B;  4A54 A;  2D9E A;  3OY9 A;  2FG0 A;  3FIF A;  5D0C A;  4MDW A;  3NXB A;  1G3T A;  4KV4 A;  2FZC B;  4KCX A;  1WHH A;  2RNA A;  3CD6 Q;  1VQO Q;  1X43 A;  1YI2 Q;  2M0O A;  4TTE A;  1WHL A;  3OYB A;  2XHC A;  2KI7 A;  2PVD B;  3OYF A;  5L8R E;  4LUE A;  1W2B S;  4RTX A;  5G4S A;  4M78 E;  1YJ9 A;  1W1F A;  3EGD B;  2E64 A;  4M77 C;  5C6S A;  5FH6 A;  1JO8 A;  3L2Q A;  3G71 Q;  1VUB A;  3QZT A;  4O7B A;  2DXT A;  2RQW A;  2MMP A;  4DBF A;  2V8K A;  2LZ6 B;  3MO8 A;  4JRI A;  1KD1 R;  1VQL A;  2DXC A;  2OX7 A;  1WIE A;  5FU7 B;  4E6R A;  1ZA1 B;  2VXF A;  4JUV A;  4HVW A;  3P1D A;  5ACY A;  3BDL A;  4J1P A;  2K2V A;  2EFI A;  3E1S A;  4ZGJ B;  2IPO B;  3KFV A;  3HRT A;  5EK9 A;  3JCM d;  3O8V A;  5IN1 A;  4UYE A;  1N72 A;  1CSK A;  1SRL A;  1OPL A;  3O35 A;  1K8A U;  2LVM A;  2K5L A;  2COW A;  2P0K A;  2WP1 A;  2AK5 A;  4C0Z A;  4BY6 C;  2DRM A;  4FIB A;  5GAN 2;  4E7S A;  2L89 A;  5DKH A;  2G6F X;  3JVJ A;  5F25 A;  4ELY C;  5CCA A;  5IXF A;  2GF7 A;  2DVS A;  3KXT A;  3G1J A;  3OYJ A;  3CCV T;  3J81 E;  1HK9 A;  4QVD A;  4MEN A;  4UIW A;  4LNP A;  4DOV A;  4KGZ B;  1YHQ Q;  2WAC A;  1YCY A;  1G3W A;  4L5G A;  4A9M A;  5DY9 A;  5FB1 A;  2AZV A;  5A5R A;  4DA4 A;  2JT4 A;  2H3E B;  3JVL A;  5EWV A;  1JEG A;  2MF2 A;  3CC2 T;  2KRM A;  4BI8 B;  2E5K A;  3M0S A;  5FG4 A;  4NXJ A;  5GAO q;  5EIC A;  1M90 R;  4LYI A;  1Y96 B;  2PZ1 A;  4PJO D;  5C87 A;  5CKF A;  2P0Q A;  1BK2 A;  3L2R A;  4XTV A;  5IT9 E;  4AG2 C;  1Q81 R;  4JRK A;  4O7C A;  5FE9 A;  2ZZD A;  4UYH A;  2X4J A;  2ZPF B;  4YTL A;  4O6J A;  2GFU A;  1IHW A;  2JTE A;  1TH7 A;  2RQV A;  2XI9 A;  5A81 A;  3CCV A;  3VV0 A;  3P8D A;  5D3H A;  3U5J A;  2QA4 T;  4QQD A;  3RIR A;  4QUT A;  5D3N A;  1KJW A;  3UVD A;  1WHG A;  3MJX A;  1VQ5 Q;  2YRD A;  1R77 A;  4A9F A;  2GQI A;  5IG6 A;  2EQU A;  3CC2 A;  2RHI A;  1WQ7 A;  1FWZ A;  2CUD A;  1S72 Q;  5KH6 A;  3A5Z B;  4HXP A;  2CP5 A;  1B07 A;  1VQM Q;  2E1H A;  1M1K R;  5TCM A;  2E6Z A;  3CCR Q;  5A5S A;  1V29 B;  1M2O A;  1OZ2 A;  4PL6 A;  1VQ7 T;  5LJ3 g;  2ABL A;  5KTU A;  2QQA A;  2IG0 A;  3MEA A;  4QZS A;  3TQ7 P;  2DXU A;  1QVP A;  2RNW A;  3FRN A;  3D7C A;  5ENH A;  2MK5 A;  4N0A A;  4J9E A;  1K1Z A;  2CP3 A;  1DJ7 B;  1X2K A;  3EGX A;  1UG1 A;  4MML A;  4DON A;  5A5Q A;  1I81 A;  4OML A;  2QA4 A;  3RKX A;  4MZM A;  3G6E Q;  2ZPG B;  1Y0M A;  4FL6 A;  2YUN A;  2QEX T;  1AOJ A;  4ELZ C;  2K7A A;  3RR6 A;  2E65 A;  5F63 A;  2GTJ A;  4IR5 A;  4A4K A;  4TT6 A;  2WSE E;  2F69 A;  2EKO A;  1WUM A;  3UVX A;  2EYY A;  4M75 C;  3OYC A;  1ZSZ B;  1S1N A;  4IUR A;  3TSZ A;  3VYH B;  2NWM A;  1YWO A;  1WPY A;  1M2V B;  4O74 A;  4NQN A;  4YYD A;  2EAY A;  1UGS B;  4NOY A;  4HXL A;  4FU6 A;  1H8K A;  5J3B A;  5LJ3 d;  1VQ7 A;  3V8J A;  5C4Q A;  3JVM A;  3UAT A;  4OB0 B;  4C0G A;  5I22 A;  4IOR A;  4FSX A;  2MWP A;  2R57 A;  3UVY A;  4C92 E;  3QDR B;  4QST A;  3CCQ Q;  3CCS A;  4BW4 A;  4TT2 A;  4HVU A;  2ZGW A;  5DYC A;  1VQN Q;  4EMK C;  1UE9 A;  3H0F A;  3G4S A;  3CC7 T;  2QEX A;  5H1V A;  5LKT A;  4F7U B;  4OMN A;  4ZW1 A;  2K57 A;  3MUL A;  5HRV A;  3CBP A;  4NRB A;  4M7D G;  1UGV A;  3RNJ A;  2PVG B;  1EX4 A;  2DER A;  5CQ7 A;  5HQ7 A;  2PNI A;  2N9G A;  1HJD A;  2P84 A;  2KYB A;  1U8R A;  4PCI A;  3BDU A;  1VQO T;  4IUV A;  3EFR A;  5HM0 A;  1X6O A;  1B34 B;  4E7L A;  1RAI B;  1TXQ A;  4RVR A;  1NEB A;  3WXM B;  5FRN A;  5F5Z A;  2D0Q B;  3BE3 A;  1N9R A;  1QCN A;  5C89 A;  2QK0 A;  1W2B P;  3G0L A;  5CQY A;  2AHJ B;  3VS4 A;  2RI7 A;  1PNJ A;  3JCM J;  4QVC A;  2RB6 A;  2KVQ G;  2A08 A;  2DWW A;  4YBT A;  2K2M A;  3MP6 A;  2O4X B;  4F7U E;  4YYJ A;  8AT1 B;  2OO1 A;  3OS1 A;  3E9G A;  3I55 Q;  1WUG A;  3TCJ A;  1WHJ A;  4C66 A;  4K11 A;  4GLM A;  4F16 A;  4A9K A;  5D3L A;  2RQR A;  2LC4 A;  3GG3 A;  3HFO A;  2DVR A;  5GAM d;  4E7H A;  1VQO A;  1IZ6 A;  5DLX A;  4C0F A;  1Q7Y U;  2B8A A;  2H8H A;  4TU4 A;  2QGF B;  4JJN K;  2HZY A;  1WGS A;  5CAI A;  4IR3 A;  2GBQ A;  2QDY B;  3IQL A;  3LH5 A;  3QHS A;  1RAG B;  2YYN A;  2V1R A;  4XY9 A;  4MMK A;  3L2W A;  5EPR A;  3I5S A;  3G71 A;  5CFW A;  2K4Y A;  5IHK A;  3EH2 A;  5LJ5 e;  5D3J A;  2CP2 A;  1YIT T;  4NL3 A;  5M9O A;  4EPC A;  2YXY A;  3VS2 A;  3VS6 A;  5H1T A;  1ZUY A;  3SEM A;  4CUU A;  5JI8 A;  5CVI A;  4PTB A;  4Y92 A;  1W2B A;  1KC8 U;  3SFM A;  3OSS C;  4TYL A;  3TVT A;  3HPW A;  3H8Z A;  1KD1 C;  4XU0 A;  2K5F A;  1SHG A; 
#chains in the Genus database with same CATH homology
 4F3I A;  2LT4 A;  2DAQ A;  4LYS A;  4QC3 A;  3JCM P;  2K3Y A;  4M7A E;  5HLS A;  5GAN f;  2RHX A;  4UIV A;  3X25 B;  1N27 A;  4YYK A;  3I56 T;  5D6W A;  3P1F A;  4A4F A;  3CXC S;  5C7N A;  4HCC A;  4NYW A;  4XUA A;  2E7O A;  2YEK A;  5EI4 A;  4EMG A;  4PLI A;  3JAM E;  5FFY A;  3OSV A;  4A53 A;  3TRE A;  1S72 T;  5FG5 A;  5IGN A;  2RJC A;  3L2U A;  4C5G A;  4C8Q G;  2QQ9 A;  5HFR A;  4PLL A;  5H85 A;  5CIU A;  5EWD A;  4Z1S A;  3LW5 E;  2KY9 A;  2I8N A;  1M90 C;  5L97 A;  4Q5W A;  4NRC A;  5KHM A;  3J80 E;  2VGM A;  1Q81 C;  2CZ7 B;  5FBX A;  4M77 B;  3EFS A;  2VV5 A;  4QSW A;  5LJ2 A;  4NUC A;  2MJV B;  3MP1 A;  4O76 A;  5E9L A;  4QUU A;  3QSU A;  4PJO C;  1UB4 A;  3OYI A;  5EU1 A;  2LT1 A;  4XTZ A;  3C12 A;  4PJO F;  3SB2 A;  1S72 A;  5D26 A;  5CO7 A;  5FU6 C;  1VQM A;  3HSB A;  5LVQ A;  5EVA A;  4JRP A;  3CCR A;  5F1H A;  2V8I A;  5BT4 A;  4LD6 A;  4RG8 A;  5DX4 A;  2E10 A;  4LR6 A;  1I8F A;  3KUF A;  4BY6 B;  3CCE T;  5A0L A;  2YRV A;  5LJ3 j;  3TU4 K;  2EQM A;  1M1K C;  2RK2 A;  5FB0 A;  4M7D F;  4LZ2 A;  4M77 E;  3BW1 A;  3S91 A;  3X24 B;  4CI0 C;  4Z93 A;  3VUZ A;  4BDZ A;  2EJG A;  5A5P A;  5C8G A;  5FH7 A;  3JCM W;  3SWN C;  3HRS A;  3R6O A;  5FG6 A;  4O7F A;  4TZ2 A;  3M9Q A;  4KUI A;  3RKY A;  3L1A A;  5CZG A;  4QC1 A;  2C06 A;  4ALG A;  4MR3 A;  3LX7 A;  3U5P A;  2EJF A;  3JB9 G;  1FX7 A;  1YJN T;  3CCE A;  1EQF A;  2YQD A;  2EYQ A;  1VQ9 T;  2ZPE B;  4LDF A;  4NR4 A;  2DXB A;  4V2S A;  3QG1 A;  1JBM A;  5F61 A;  4HCZ A;  4OB2 B;  4HA8 A;  1O75 A;  2CS7 A;  1XQH A;  4QQ6 A;  3OBW A;  3UV5 A;  4YYH A;  3OS0 A;  3MUK A;  3PGG A;  1IRE B;  1QP2 A;  3RES A;  3GLX A;  5FLX E;  4DOW A;  3CC4 T;  2VXE A;  5A85 A;  5HEM A;  2FL7 A;  3OQ5 A;  4ME7 A;  4KT0 E;  3V7C A;  4M7D A;  4QSR A;  2RI2 A;  5GAM j;  4MEO A;  1YJN A;  1RI0 A;  3SVG A;  5L8U A;  1VQ9 A;  4LYW A;  4HBY A;  2M9U A;  3JCM e;  4QR5 A;  3MCA B;  5HEL A;  3QYG B;  2A3L A;  4LDX A;  5D24 A;  1QP3 A;  3SVH A;  1QVF S;  4MZP A;  4M78 G;  2KMT A;  2JTF A;  5HK3 A;  1AHJ B;  4LZR A;  2FHD A;  3OYA A;  3EAE A;  4L6V 5;  2KAF A;  4M75 B;  4CUR A;  3CC4 A;  3UV2 A;  1M9S A;  2XK0 A;  4ZGE B;  4NR6 A;  2LX9 A;  2Y90 A;  3VYG A;  5GAN 3;  5FDZ A;  1BIA A;  2NLU A;  3OYY A;  3DAI A;  4CUP A;  4E47 A;  3ER0 A;  3DWY A;  5DFC A;  3QZ9 B;  2VUB A;  5I21 A;  1VQ6 T;  3HHT B;  4Z02 A;  3MB3 A;  3F70 A;  5D3R A;  1WJS A;  4C8Q F;  3OBY A;  2DO3 A;  4BW3 A;  3C4S A;  1OZ3 A;  4EMK B;  3V8L A;  4A4G A;  5GAO r;  1Q86 U;  4M75 E;  3IU6 A;  4A9O A;  3CPW S;  5FE1 A;  5I80 A;  4NQM A;  4TT4 A;  3O34 A;  5CKD A;  5CUA A;  2DTI A;  2XDP A;  5E9V A;  4PKL A;  2CGH A;  4N4G A;  3M58 A;  5KCO A;  4BE1 A;  5A5N A;  4XTX A;  2E6N A;  3Q2E A;  2MWO A;  4YAX A;  3JB9 J;  4XTY A;  5D3P A;  2CZ6 B;  5E0R A;  4N4I A;  4LZS A;  4N0A C;  1K8A C;  2R0Y A;  3FEO A;  5K29 A;  4UYF B;  2D6F A;  2YEM A;  4QNS A;  4MEP A;  1D3B B;  3A8O B;  4IUT A;  5GMK l;  4MZT A;  2RJE A;  5KTX A;  5EWH A;  3OMC A;  2F5K A;  4PCE A;  3KBG A;  3CXC A;  4YAT A;  1QW1 A;  4E96 A;  5CK9 A;  2I2L A;  2JN0 A;  5D7X A;  1E6I A;  5E73 A;  4NUD A;  4XY8 A;  3JCM c;  2L3R A;  5DBM A;  1WJQ A;  4C8Q A;  3PIP A;  2DEQ A;  3PMT A;  5FE2 A;  1UGP B;  3VU3 C;  2XDB A;  3LGF A;  3GP8 A;  1VQK T;  4MR6 A;  4HXS A;  1Y7X A;  2P4T A;  2R10 A;  4QEV A;  3MEW A;  5LJ3 h;  4OMF B;  3GOX A;  3JB9 F;  5DW2 A;  3JCM Q;  4M7D D;  2R0V A;  5KU3 A;  3GF5 A;  5IGK A;  5EIS A;  4C5H A;  3JCM f;  4N3W A;  3MHX A;  2YEL A;  4QYL A;  4BW1 A;  1YJW T;  5ENC A;  3G0J A;  4YH3 A;  4R55 A;  5GMK i;  3O36 A;  4UYD A;  5LJ0 A;  1BI3 A;  4HBV A;  4CL9 A;  5I7Y A;  3P5O A;  4CUS A;  4BI4 A;  1UEB A;  2LTO A;  4NR9 A;  3JCM X;  3PT9 A;  5LJ1 A;  3ME9 A;  5D25 A;  2BIV A;  1ZHI A;  5LUU A;  3RMS A;  2DD4 A;  1VQK A;  2DZC A;  4C92 B;  5DFB A;  1MHN A;  4TVR A;  1U1S A;  4C92 G;  2OTL T;  4CFK A;  2CZ1 B;  4LDV A;  1F68 A;  5ETB A;  5I7X A;  1YJW A;  2GCX A;  5GAN e;  2G3R A;  4R56 A;  3HL8 A;  4QSU A;  3G7Z A;  3OYD A;  1VIF A;  5E9Y A;  4M78 F;  2CZ0 B;  4IUP A;  3X20 B;  2KK4 A;  5CUG A;  5J26 A;  5EWC A;  3BY7 A;  4EDU A;  4YY4 A;  5A2Q E;  5CUD A;  3RMQ A;  4ATO A;  5HY6 A;  4C5I A;  3FKM X;  2FB7 A;  1XTD A;  1EIF A;  5HK0 A;  5FFV A;  5GAM h;  5CKE A;  5BT3 A;  2E70 A;  2BUD A;  5EG2 A;  3M5A A;  1PSF A;  2OTL A;  3CCJ T;  5CRM A;  5F62 A;  3E19 A;  4XAX B;  5COI A;  4EMH A;  1BI0 A;  4F7U G;  5FU6 B;  4OGJ A;  2ZPB B;  1G3S A;  2E12 A;  5ENF A;  3QII A;  4J3I A;  2V8J A;  3ASK A;  2G4A A;  5DLZ A;  5GAN g;  4XU1 A;  2JOY A;  5CKH A;  2LCC A;  5E3G A;  3NTH A;  3C94 A;  1G3Y A;  3AAD A;  3GIB A;  4LDW A;  2IVW A;  5I29 A;  2RK1 A;  3A8M B;  2WSC E;  5FE8 A;  4PJO E;  3SD4 A;  5I2S A;  3CC7 A;  2EWN A;  2JNG A;  5C85 A;  5C0M A;  3O37 A;  3CCJ A;  4CRI A;  1W4S A;  1LJO A;  4C8Q D;  2LRQ A;  5E9K A;  4M78 A;  5LJ3 f;  3V8K A;  4XTU A;  1Q82 U;  5L8T A;  3M53 A;  4YAB A;  3QBY A;  1QVF A;  3JCM V;  2RNX A;  3UDC A;  5KE2 A;  1Q82 C;  4O7E A;  5FE4 A;  4M7A B;  2RO1 A;  1NPP A;  2RJD A;  4Z6I A;  3O33 A;  5CUE A;  5HCL A;  1Q7Y C;  4M7A G;  3MB4 A;  4OB1 B;  2DVQ A;  5A0G A;  1Y71 A;  5DYX A;  5IGL A;  4DQ2 A;  2PQW A;  3ZFJ A;  5CUC A;  5HEN A;  3QO3 A;  5HRX A;  2YW5 A;  3LQI A;  4XQ3 A;  2QTX A;  5ENE A;  1P92 A;  3E9F A;  4KUL A;  1KC8 C;  2FYK A;  4YC9 A;  2YLC A;  4IOQ A;  3C95 A;  3CPW A;  2VGN A;  2R58 A;  1NJI U;  3LWH A;  3M4G A;  2HQE A;  3UT1 A;  2XID A;  3FB9 A;  3RCW A;  1NPR A;  1YIT A;  4FT4 A;  3J7A F;  4Z1Q A;  3U5K A;  5E9I A;  5GAM f;  5GMK h;  3HRU A;  5GAO p;  5A5O A;  2Y4X A;  4BUG A;  5LJ5 g;  3NFC A;  2RO0 A;  3JB9 D;  5CUB A;  5I86 A;  3HME A;  4OVA A;  4B9W A;  3UVW A;  4BDY A;  2LCL A;  3MP8 A;  4C92 F;  2L85 A;  1JSP B;  2LDM A;  4CFL A;  2WP2 A;  4X34 A;  1JB0 E;  5CQ3 A;  2HBP A;  4C5E A;  4WHU A;  4QBM A;  3I56 A;  2KQW A;  4ZC9 A;  4JLI A;  1Y96 A;  1NZ9 A;  2QQS A;  1YIJ T;  5DW1 A;  3M59 A;  4JLG A;  2WSF E;  4M77 G;  2PUK B;  3QZS A;  3RUX A;  4LC2 A;  4LDU A;  3LH0 A;  5LJ5 d;  5CU8 A;  4QQG A;  1JRI A;  4J7F A;  4BI3 A;  2RNY A;  5GAO m;  3UW9 A;  4UIX A;  4PNO A;  4Q0N A;  5TB6 A;  5KTW A;  2EQK A;  2ZCF B;  4O70 A;  5FE6 A;  2L8D A;  1M1F A;  4M7D C;  1I5L A;  1OYX A;  4F7U F;  5FE0 A;  4M78 D;  1N8R U;  5AYF A;  4QW2 A;  3TEE A;  2L84 A;  1YIJ A;  3HMF A;  2DAT A;  2E5Q A;  3OYK A;  1HXD A;  5EM3 A;  4AKN A;  2HAX A;  2QXF A;  4E7K A;  2F5T X;  5CS8 A;  5DY7 A;  4QSP A;  4C92 A;  5GAN 8;  5LKX A;  4A9I A;  5A82 A;  3FDR A;  2OTJ T;  4HBW A;  5GAN 6;  2GFA A;  3JRZ A;  1XNI A;  2LNV A;  3PNW C;  4IR6 A;  3QXE B;  4A9J A;  5LL6 S;  1G5V A;  4QEU A;  2DIG A;  2XD0 A;  2RHY A;  3HMH A;  3SVF A;  4WIV A;  4XK8 E;  4A4E A;  1MGQ A;  3P1E A;  3P8H A;  4M7A F;  4HT8 A;  3V7S A;  4TZ8 A;  3QZV A;  4F7U A;  2OTJ A;  4O7A A;  3FLG A;  3L42 A;  5CQT A;  4ZN1 A;  2FSA A;  4Y28 E;  4OGE A;  4D6W A;  4OF1 A;  4N4H A;  4A9E A;  1K9M U;  5CPE A;  3JVK A;  3CME T;  1B34 A;  4GPJ A;  1O9S A;  1ZBX A;  3H6Z A;  1BIB A;  2P0P A;  4OP0 A;  4KBM B;  1K9M C;  3CCL T;  1K73 U;  2RH2 A;  3DB4 A;  2RJF A;  3CCU T;  3ZYU A;  4M75 G;  4YYN A;  2O4X A;  4O72 A;  2JZ2 A;  5CP5 A;  4LDY A;  2GRC A;  1XOV A;  5E7D A;  4YYI A;  1VQL T;  2O01 E;  3I3J A;  3OW2 S;  3LYI A;  5CGP A;  5IAY A;  4C8Q C;  2R5M A;  3CPF A;  2RHZ A;  4QB3 A;  5KE3 A;  4HCB A;  4J6W A;  2XU8 A;  5DM7 R;  4Z6H A;  3CME A;  2LQ8 A;  3JCM g;  4JDS A;  5F36 A;  3FJP A;  1JJ2 S;  3K2J A;  5D3S A;  1RL2 A;  3QJ6 A;  2DK3 A;  4M7A A;  4YYM A;  1NE8 A;  5EPS A;  3A8L B;  4YK0 A;  2E41 A;  3CCL A;  1WJR A;  3U5L A;  5GAO l;  1KHI A;  5EA1 A;  5IID A;  3CCU A;  4BAC A;  2KTB B;  2DVV A;  5CR2 A;  4YH4 A;  2I7K A;  1Q86 C;  4QSS A;  3DKM A;  4OUF A;  5DYU A;  3MXF A;  4M77 F;  5ENJ A;  5D6Y A;  4GLK A;  4QR3 A;  1VQP T;  3U5M A;  2X4W A;  4HXN A;  1BKB A;  5ENG A;  1VQ6 A;  2R0S A;  3WVE B;  5CQA A;  2L5E A;  5E3D A;  4C92 D;  5LKU A;  3AQA A;  3LQH A;  1WNL A;  3AHU A;  2RI3 A;  4BD3 A;  3JCM b;  4WHW A;  3JSC A;  2LSP B;  3GPL A;  2RI5 A;  4HXK A;  2RD1 A;  4J83 A;  5LJ5 j;  4VUB A;  5FRM A;  2EJ9 A;  4A9N A;  2EQJ A;  5EP7 A;  3GNG A;  2QI2 A;  4GY5 A;  5EQ1 A;  5ENB A;  4NR5 A;  2KSS A;  3OYN A;  1VQP A;  4NRA A;  1M5Q 1;  3M55 A;  5I1Q A;  4BW2 A;  3PFS A;  5A7C A;  2DVE A;  3A8H B;  5LJ3 e;  3PTA A;  5GMK j;  5LVR A;  4TS8 A;  4XTW A;  4UIZ A;  1N9S A;  3MEU A;  3L2Z A;  1LOJ A;  5H1U A;  2PU9 B;  5CQ6 A;  5J39 A;  5FRO A;  4QR4 A;  2VC8 A;  3INZ A;  4M77 A;  2F6J A;  4MR5 A;  2RS9 B;  5G4R A;  1KQS S;  1KG1 A;  1X75 C;  2X4Y A;  2FVU A;  4MDX A;  5IBN A;  4JS4 A;  3PIO A;  4Q0O A;  2ZPI B;  3T9N A;  4QSQ A;  2JTM A;  2MAM A;  1YBY A;  4C0D C;  1Y07 A;  4ZGD B;  3HKS A;  2HD0 A;  4J6X A;  5GAO n;  4XYA A;  1OI1 A;  5AME A;  5HQ5 A;  1BYM A;  1QVG S;  1VQ4 T;  1VQ8 T;  4X9D A;  1N6A A;  3Q2F A;  2X35 A;  5HQ6 A;  4ZN3 A;  4O75 A;  4NYX A;  4UIT A;  4PY6 A;  5CTL A;  5D3T A;  4M78 C;  5GAN 5;  3JB9 I;  1SSF A;  5KO4 A;  5CQ5 A;  3CCS T;  3DLM A;  4OGI A;  4NR7 A;  5E9M A;  4IOO A;  4O77 A;  2K5I A;  3G4S T;  4YY6 A;  5HFQ A;  4NS5 A;  3S6W A;  4M7A D;  2E7N A;  5EGU A;  1KQ2 A;  5GAM e;  5CKB A;  4O71 A;  5I83 A;  3M54 A;  3UPU A;  4M75 F;  5HRW A;  1VQ4 A;  2MI6 A;  4O5V A;  2JVV A;  1VQ8 A;  5GAN h;  4PJO B;  4JS5 A;  5IGM A;  4QVZ A;  5D6X A;  3JB9 H;  3ONI A;  5CRZ A;  4PJO G;  4ZQL A;  2PVO B;  3A8G B;  4PS5 A;  3OA6 A;  4MEQ A;  3CMA T;  5F1L A;  4M7D B;  4X9C A;  5FU7 C;  4RCC A;  3SDZ A;  5L96 A;  2XIC A;  5EPB A;  4B9X A;  4BB7 A;  3QZ5 B;  3U5N A;  3M56 A;  5FH8 A;  5DKD A;  3V7R A;  3CD6 T;  2QQR A;  5GAM g;  1VIE A;  1YI2 T;  4J7I A;  5CY9 A;  5I88 A;  4YAD A;  3UWN A;  3LJW A;  3SWN B;  4HXR A;  2PUO B;  2DKW A;  4UYG A;  4BHW A;  2D82 A;  5BT5 A;  3ZBD A;  2D9T A;  2HQX A;  2RM4 A;  5EV9 A;  3G71 T;  3CMA A;  4ZTF A;  3LWI A;  3OMG A;  4M7D E;  5F2P A;  5GAN d;  5AD2 A;  4XUB A;  3MET A;  2NXB A;  4M75 A;  5CQX A;  1X01 A;  4CLB A;  1PSE A;  4RKU E;  3U5O A;  3M57 A;  3QPH A;  2OAU A;  4NYV A;  2VYT A;  1H64 1;  4J5Y A;  4M77 D;  4RG2 A;  3OYH A;  4BE0 A;  1ZQ1 A;  4OGC A;  3CD6 A;  1YI2 A;  4MR4 A;  5DKC A;  4QY4 A;  3CCM T;  2DPP B;  2EIF A;  3OW2 A;  1M4Z A;  4JRQ A;  4RCB A;  3DLL A;  1R8O B;  3WVD B;  2M1H A;  4EMK A;  5CQ4 A;  4HXM A;  3QUI A;  4ZTJ A;  1LNX A;  1YHQ T;  4N4F A;  1JJ2 A;  1KD1 U;  4A9H A;  5J0D A;  2CKK A;  3PMI A;  1GXI E;  5F60 A;  2XG8 D;  4PKC C;  4E7I A;  4Y03 A;  5A0D A;  5A83 A;  5LJ5 h;  4UC4 A;  5EWW A;  1BI1 A;  5DFD A;  4CUT A;  2XDD A;  4YBM A;  3OYG A;  4IKF A;  3P8B B;  2DJZ A;  1NJI C;  5GMK e;  4KV1 A;  3CCM A;  2DIQ A;  5JWM A;  3RKW A;  1FXX A;  2GQV A;  4UYF A;  1H3Z A;  2X4X A;  1D3B A;  3S3M A;  4IUU A;  4C92 C;  1YHQ A;  3QKJ A;  4NR8 A;  1VQ5 T;  5FE3 A;  3L2V A;  2RHU A;  4J6Y A;  3LQJ A;  3LXJ A;  2H3J A;  4C8Q B;  4J0R A;  3CEY A;  4UIY A;  2RA2 A;  1VQM T;  1M90 U;  1UGR B;  3S3N A;  2OSS A;  3CBM A;  3CCR T;  4A4H A;  5I89 A;  3S92 A;  4C67 A;  1Q81 U;  3VKI A;  5AD3 A;  1KQ1 A;  1ZS5 A;  3QJY A;  3OS2 A;  2BKD N;  4II1 A;  3G6E T;  3OYL A;  3IU5 A;  4LD9 K;  4RMO A;  5FE5 A;  4IUQ A;  1VQ5 A;  2F6N A;  4ALH A;  4HKE A;  2E3K A;  4C8Q E;  2K3X A;  4WF2 A;  4LRG A;  4O78 A;  3URG A;  1KQS A;  1M1K U;  1JM4 B;  4E7J A;  5DYA A;  4Y91 A;  2A7Y A;  2M16 A;  2YDW A;  3ZEH A;  2OUO A;  4QSX A;  2H60 A;  3X28 B;  5HJC A;  3FC3 A;  1N8R C;  4M75 D;  3RER A;  3DB3 A;  5DLQ E;  2R5A A;  3OYE A;  2JUF A;  3X26 B;  4XU2 A;  3CCQ T;  2XKO C;  3M4Y A;  3S3O A;  2DZ9 A;  3G6E A;  1QVG A;  2QQB A;  3HP9 A;  4FM4 B;  1VQN T;  4QYD A;  4UIU A;  4HBX A;  1BI2 A;  5II2 A;  5GMK m;  3HFN A;  4YYG A;  4NUE A;  4A9L A;  3GNF B;  3BFM A;  3QYH B;  4P5N A;  4BJX A;  5ENI A;  1M1G A;  4CUQ A;  3VJP A;  3MQM A;  3MEV A;  1U1T A;  3LLR A;  4HT9 A;  5LJ5 f;  1X0J A;  3NTI A;  2YHT A;  5ETD A;  4HXO A;  2DKG A;  1I4K 1;  4OB3 B;  3OS5 A;  2HNI A;  4M7A C;  4KUD K;  2RFJ A;  4L59 A;  5I2M A;  3CCQ A;  4TU6 A;  4YBS A;  1VQN A;  4FT2 A;  4PJO A;  3NTK A;  2YLB A;  3P1C A;  4TQN A;  1M8V A;  5FFW A;  4NL2 A;  2DTH A;  3I55 T;  5AMF A;  5GAN j;  4C0D B;  4IR4 A;  3OYM A;  5GAN 7;  4X2I A;  2CYZ B;  4J0S A;  3LGL A;  3N5B B;  3Q1J A;  3OB9 A;  5I40 A;  5II1 A;  2LQK A;  5F3A A;  4J8O A;  4BE2 A;  5HKC A;  4QEW A;  5L99 A;  2Y4Y A;  3TLP A;  1YJ9 T;  4QSV A;  5LKZ A;  2DTO A;  4M78 B;  4XU3 A;  4FLP A;  3JCM h;  5CQ8 A;  2DD5 A;  2KDS A;  2ZPH B;  5L98 A;  1UGQ B;  3VUB A;  1KHC A;  1WQW A;  5GAN 4;  3SWN A;  3UV4 A;  1K73 C;  3I55 A;  5KCH A;  3CBO A;  5E74 A;  2L5Q A;  5DLO A;  5FE7 A;  4A54 A;  2D9E A;  3OY9 A;  3FIF A;  5D0C A;  4MDW A;  3NXB A;  1G3T A;  4KV4 A;  4KCX A;  2M0O A;  4TTE A;  3OYB A;  2XHC A;  2PVD B;  3OYF A;  5L8R E;  1W2B S;  5G4S A;  4M78 E;  1YJ9 A;  2E64 A;  4M77 C;  5C6S A;  5FH6 A;  3L2Q A;  1VUB A;  3QZT A;  4O7B A;  2DXT A;  2MMP A;  2V8K A;  3MO8 A;  4JRI A;  1VQL A;  2DXC A;  5FU7 B;  4JUV A;  2VXF A;  3P1D A;  5ACY A;  3BDL A;  4J1P A;  2K2V A;  2EFI A;  3E1S A;  4ZGJ B;  3HRT A;  5EK9 A;  3JCM d;  3O8V A;  5IN1 A;  4UYE A;  1N72 A;  3O35 A;  1K8A U;  2LVM A;  2K5L A;  2P0K A;  2WP1 A;  4C0Z A;  4BY6 C;  4FIB A;  5GAN 2;  2L89 A;  5DKH A;  4ELY C;  3JVJ A;  5F25 A;  5CCA A;  2GF7 A;  2DVS A;  3KXT A;  3OYJ A;  3CCV T;  3J81 E;  1HK9 A;  4QVD A;  4MEN A;  4UIW A;  4DOV A;  2WAC A;  1YCY A;  1G3W A;  4L5G A;  4A9M A;  5DY9 A;  5FB1 A;  5A5R A;  4DA4 A;  3JVL A;  5EWV A;  2MF2 A;  3CC2 T;  4BI8 B;  5FG4 A;  4NXJ A;  5GAO q;  5EIC A;  4LYI A;  1Y96 B;  4PJO D;  5C87 A;  5CKF A;  2P0Q A;  3L2R A;  5IT9 E;  4XTV A;  4JRK A;  4O7C A;  5FE9 A;  2ZZD A;  4UYH A;  2X4J A;  2ZPF B;  4YTL A;  4O6J A;  2GFU A;  1TH7 A;  2XI9 A;  5A81 A;  3CCV A;  3VV0 A;  3P8D A;  5D3H A;  3U5J A;  2QA4 T;  4QQD A;  3RIR A;  4QUT A;  5D3N A;  3UVD A;  4A9F A;  5IG6 A;  2EQU A;  3CC2 A;  2RHI A;  1WQ7 A;  1FWZ A;  5KH6 A;  3A5Z B;  4HXP A;  2E1H A;  5TCM A;  2E6Z A;  5A5S A;  1V29 B;  1OZ2 A;  4PL6 A;  1VQ7 T;  5LJ3 g;  5KTU A;  2QQA A;  2IG0 A;  3MEA A;  4QZS A;  2DXU A;  1QVP A;  2RNW A;  3FRN A;  3D7C A;  5ENH A;  4N0A A;  1DJ7 B;  4MML A;  4DON A;  5A5Q A;  1I81 A;  2QA4 A;  3RKX A;  4MZM A;  2ZPG B;  4FL6 A;  2QEX T;  4ELZ C;  2E65 A;  5F63 A;  4IR5 A;  4A4K A;  4TT6 A;  2WSE E;  2F69 A;  2EKO A;  1WUM A;  3UVX A;  4M75 C;  3OYC A;  4IUR A;  3VYH B;  1WPY A;  4O74 A;  4NQN A;  4YYD A;  2EAY A;  1UGS B;  4NOY A;  4HXL A;  4FU6 A;  5J3B A;  5LJ3 d;  1VQ7 A;  3V8J A;  5C4Q A;  3JVM A;  4OB0 B;  4C0G A;  4IOR A;  4FSX A;  2MWP A;  2R57 A;  3UVY A;  4C92 E;  3QDR B;  4QST A;  3CCS A;  4BW4 A;  4TT2 A;  2ZGW A;  5DYC A;  4EMK C;  3G4S A;  3CC7 T;  2QEX A;  5H1V A;  5LKT A;  4F7U B;  4ZW1 A;  2K57 A;  3MUL A;  5HRV A;  3CBP A;  4NRB A;  4M7D G;  2PVG B;  5CQ7 A;  5HQ7 A;  2N9G A;  1U8R A;  4PCI A;  3BDU A;  1VQO T;  4IUV A;  3EFR A;  5HM0 A;  1X6O A;  1B34 B;  4E7L A;  4RVR A;  3WXM B;  5FRN A;  5F5Z A;  2D0Q B;  1N9R A;  5C89 A;  3G0L A;  5CQY A;  2AHJ B;  2RI7 A;  3JCM J;  4QVC A;  2RB6 A;  2KVQ G;  2DWW A;  4YBT A;  4F7U E;  3MP6 A;  2O4X B;  4YYJ A;  2OO1 A;  3OS1 A;  3E9G A;  1WUG A;  3TCJ A;  4C66 A;  4A9K A;  5D3L A;  2LC4 A;  3GG3 A;  3HFO A;  2DVR A;  5GAM d;  4E7H A;  1VQO A;  1IZ6 A;  5DLX A;  4C0F A;  1Q7Y U;  2B8A A;  4TU4 A;  4JJN K;  1WGS A;  5CAI A;  4IR3 A;  2QDY B;  3QHS A;  2YYN A;  3L2W A;  4XY9 A;  4MMK A;  3G71 A;  5EPR A;  5CFW A;  2K4Y A;  5LJ5 e;  5D3J A;  1YIT T;  4NL3 A;  5M9O A;  4EPC A;  5H1T A;  4CUU A;  5JI8 A;  5CVI A;  4PTB A;  1W2B A;  1KC8 U;  3SFM A;  3OSS C;  4TYL A;  3HPW A;  3H8Z A;  1KD1 C;  4XU0 A;  2K5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...