4N4HA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.1k36me3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
188
Chain Sequence
QEMGTYLRFIVSRMKERAIDLVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
total genus 66
structure length 188
sequence length 209
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4hA02
3E9GA 2EQKA 5D25A 2R57A 3MEWA 5EVAA 5HQ7A 3PMIA 4Z6HA 5I40A 5EPSA 2WACA 5KE3A 4NS5A 5F2PA 4A4FA 5CUGA 4CUTA 5C85A 4QB3A 4EDUA 5L8TA 4HXKA 5II2A 3KUFA 1OI1A 4E7JA 5CRMA 2DIQA 4NR7A 3QJ6A 4UIZA 4A9LA 1WJRA 4B9WA 3P1EA 4HXSA 4O7FA 4C66A 4X34A 2EKOA 5EP7A 5CQ5A 5KTUA 5A83A 2X4XA 4O72A 5FH8A 3ZYUA 4YK0A 5HRXA 3OYNA 4Q0OA 5A5QA 4N3WA 4LDFA 4N4IA 4QC3A 4PCEA 5CQAA 2BKDN 3QIIA 2YELA 3S92A 5KU3A 5FROA 2RJFA 5CUDA 4J0RA 4YYMA 3O37A 5CS8A 2RHYA 1XNIA 3U5KA 3OYAA 4UIWA 5KO4A 4Z93A 4TT6A 3JVKA 2GF7A 3L2QA 4ZTJA 4UC4A 3MB4A 3DB3A 5M9OA 4BW1A 2DAQA 2D9TA 2E6NA 5IN1A 5C8GA 3L2UA 4OUFA 4PL6A 5HEMA 3O36A 5J39A 4NR8A 5LJ2A 4N4HA 2G3RA 5KHMA 3C4SA 4O7EA 5CGPA 5A5OA 2GRCA 3DB4A 4OGJA 3L42A 3ZEHA 5II1A 4BDZA 4CL9A 4O74A 5KCOA 3FC3A 4N4FA 3OQ5A 5CQTA 4GPJA 5HCLA 5FE4A 1WUGA 3OYLA 4BE1A 2RI3A 4NR4A 4C5GA 2YRVA 3AQAA 4QUTA 4CFLA 5TCMA 5IGKA 4J0SA 2MWPA 4XYAA 4C5IA 2LCCA 4CRIA 5EI4A 1JM4B 4UIUA 2PQWA 5E74A 2RJCA 5DFCA 5EPRA 4LYIA 5CP5A 2DVVA 5EK9A 3HMHA 3OYMA 4L59A 3P1FA 5EV9A 4YH3A 5LKXA 5HM0A 5DYXA 4QYLA 3P8HA 4NYWA 2WP2A 3NTIA 4TQNA 5DFDA 5L97A 4CUPA 3DLMA 5CQ3A 3MEUA 3O33A 5IGNA 3OY9A 1WGSA 4TT2A 4J1PA 2IG0A 4KCXA 4XUAA 5CTLA 4UITA 2F6NA 2LDMA 4MEPA 4MR6A 2GFUA 5K29A 5EWWA 5KTXA 2X35A 4NQNA 5CUAA 1RI0A 3OYFA 4Q5WA 5FH7A 4MR3A 4TT4A 2HQEA 3FDRA 4BD3A 3UVYA 5C7NA 5D3SA 4YYHA 4BE2A 4HXOA 5ENFA 3K2JA 2YW5A 4UIXA 4II1A 5FFWA 5CUBA 4YABA 3S3MA 5CPEA 4A9IA 3LQHA 5FB0A 2LVMA 2N9GA 5H85A 5D0CA 2L8DA 4FU6A 4NUEA 5F1HA 4E7HA 4ZQLA 3QZSA 2R5AA 2RI7A 3PFSA 5HQ5A 1WUMA 3MB3A 5EQ1A 4BJXA 5BT5A 5FG6A 2YQDA 1ZS5A 4TU4A 3OYDA 5CUCA 5H1UA 5LKZA 3P1CA 2CKKA 3P8DA 2WP1A 2YDWA 3LJWA 5I7YA 1WJSA 2EQJA 4Z02A 5D3TA 3P5OA 3O8VA 5DLXA 4IR6A 5FE1A 2EQMA 2B8AA 3AADA 3MUKA 5LJ0A 2E7OA 3U5MA 4A9JA 2HQXA 4GY5A 3S91A 5D24A 3LYIA 3Q1JA 4QR3A 5E9MA 5I83A 2XK0A 2NXBA 5F1LA 3LGLA 5ETBA 5FE6A 4BW3A 4YYKA 3UWNA 2DVQA 4WIVA 1OZ2A 3OS0A 5G4SA 2D82A 3UV4A 5CQ4A 4LC2A 4BE0A 5IG6A 4YBMA 3JVJA 5JWMA 1JSPB 5EM3A 2RNYA 4KV1A 4QEUA 5DX4A 4Z1QA 3S6WA 4QVZA 4A4HA 3HMEA 3D7CA 5ENCA 3LQIA 2NLUA 4UYFA 3LQJA 5ENHA 5CQ6A 4LR6A 5J0DA 3OYEA 5E3DA 5CU8A 1SSFA 4IUQA 3MXFA 5FE3A 4O71A 4LRGA 4QSWA 5HRWA 1MHNA 3NXBA 4MENA 5D6YA 4PTBA 3OYGA 4YBTA 4KV4A 4QQ6A 5FG5A 2LTOA 2R5MA 4TU6A 4UIYA 5HLSA 3NTHA 3L2RA 4IKFA 2QQSA 5F60A 5FFYA 3MP1A 4A9NA 3U5JA 4E7IA 4HCZA 5LKTA 4B9XA 5KE2A 4XY9A 5F3AA 5L8UA 4BW4A 1G5VA 5C0MA 5A82A 1WJQA 2YYNA 4IOQA 5D3PA 4QYDA 5A5NA 2G4AA 3UVDA 3UV2A 4YYJA 4HXMA 3PMTA 5D3HA 4PS5A 3MQMA 3MEVA 5I7XA 4QSTA 4MEOA 2EFIA 3P1DA 5D6WA 2R58A 3FEOA 2K3XA 5C6SA 4HXLA 4QSQA 1N27A 2L5EA 5D7XA 4ZW1A 2I8NA 4ZC9A 5HJCA 5EWVA 3LH0A 4BDYA 2H60A 2JZ2A 3OYBA 4A9OA 3QZTA 1X0JA 4YYDA 3OS2A 5F61A 4LYSA 3MEAA 4Z6IA 5FDZA 3H8ZA 4Z1SA 5C89A 2RI5A 4YADA 2E7NA 2RNWA 5AMEA 4LD6A 3I3JA 2X4YA 4YYNA 5D3RA 5H1VA 2YEKA 4NYXA 3U5LA 5DLZA 4AKNA 4HBWA 2E5QA 5CQ8A 5ACYA 4LYWA 2RHUA 3FKMX 4WHUA 3OB9A 4QEVA 2L84A 2LSPB 3GG3A 4LZRA 3JVLA 5AD3A 5LUUA 1E6IA 4YC9A 3IU6A 4DONA 5AD2A 5EPBA 3Q2FA 5FE8A 4UYGA 5BT4A 2JTFA 5FRMA 3H6ZA 5ENBA 4CLBA 4XUBA 3LLRA 3O35A 4O77A 5E0RA 3LXJA 4YAXA 3OYJA 4UYHA 5E9IA 3OA6A 4YATA 4O70A 3JVMA 5E9KA 4A9KA 2RFJA 3LGFA 4OVAA 5EWDA 2BUDA 5E73A 4A4EA 4QEWA 3UW9A 4Q0NA 3DWYA 1N72A 5DKHA 5E7DA 5L99A 3M9QA 3NTKA 3OYIA 5FRNA 4YBSA 1KHCA 5ENIA 4IOOA 5KH6A 3OYKA 4QR5A 3FLGA 5COIA 4A4GA 4FLPA 4QUUA 5CY9A 1OZ3A 5D3LA 5TB6A 3ASKA 2MWOA 4NR5A 4QQGA 4LZ2A 4O7BA 4HBXA 4WHWA 4C5HA 3SVGA 4IR3A 4YH4A 4HBYA 5E9LA 4TZ8A 5FB1A 5HFQA 5HELA 1H3ZA 3META 3U5NA 4O7CA 4QY4A 5DYUA 2D9EA 2XDPA 5HENA 4ALHA 2L85A 5KTWA 3UT1A 4O75A 4YYIA 5E9YA 2OO1A 5A85A 3EAEA 5CZGA 4A9HA 4CFKA 5EWHA 3S3NA 4C5EA 3U5OA 4FL6A 5IAYA 5CUEA 4NXJA 5LVRA 4UYFB 2OUOA 3OMGA 4MEQA 4CUSA 5A5PA 3G0LA 4QSXA 5CQ7A 4BHWA 4O78A 5A5RA 4TYLA 5HFRA 5FE9A 4IUVA 3IU5A 5ENEA 2FHDA 4HBVA 2M0OA 2K3YA 4QBMA 3S3OA 5G4RA 2BIVA 5CRZA 5CFWA 5EISA 3MP8A 2RO1A 5FG4A 2I7KA 5I80A 5EGUA 2RS9B 2F6JA 5C4QA 5HQ6A 3CEYA 3QBYA 2E3KA 5D26A 4A9EA 3L2WA 5I88A 3OS1A 4BACA 5DBMA 5H1TA 5I29A 2R0SA 4ALGA 5C87A 4F3IA 5CIUA 3SD4A 4NRAA 5FH6A 4C67A 4PLLA 3OYCA 2RHZA 3UV5A 4CURA 4IUPA 4BW2A 5AMFA 5E3GA 2YEMA 5FE0A 4CUUA 4UYEA 5DW2A 4YYGA 5D3JA 4ZTFA 1F68A 4YY4A 4NRCA 5L98A 3SVFA 3QZVA 3PNWC 4Y03A 5FE7A 4PKLA 5DY7A 5DYCA 4X2IA 2OSSA 5F63A 5EA1A 4QSRA 5FFVA 5EU1A 5I1QA 2RJDA 5F36A 2O4XB 4HXNA 5A5SA 2O4XA 5BT3A 4HXRA 5LJ1A 1EQFA 2DATA 4LZSA 3SVHA 4MR5A 2RJEA 2RNXA 3MO8A 5LKUA 3OYHA 5DW1A 5HRVA 5LVQA 5FBXA 2M16A 5E9VA 3LX7A 3MP6A 4QNSA 4IR4A 4QC1A 5L96A 3E9FA 4A9MA 4E7KA 3U5PA 4HXPA 2RHXA 3QKJA 3G0JA 2RO0A 3DAIA 4OGIA 4IUUA 3ONIA 4QSUA 5A81A 4NYVA 4O76A 4PY6A 4IUTA 5D3NA 4NQMA 4TTEA 5FE2A 2R0VA 4QSSA 5KCHA 3Q2EA 4QZSA 4TS8A 4A9FA 5I86A 4QSVA 2P0KA 5IBNA 2DWWA 3UVWA 4YY6A 5DKDA 4QW2A 5DKCA 2R10A 4QSPA 3RCWA 5A7CA 2VYTA 2QQRA 4IORA 5EWCA 4PLIA 2DVSA 3UVXA 5IGMA 2FSAA 5F25A 2R0YA 3O34A 5I89A 4UIVA 5ENJA 2KTBB 2DKWA 4NUCA 4PCIA 5F5ZA 2DVRA 5DYAA 4RG2A 5D6XA 5JI8A 2F5KA 4NR9A 2LRQA 2RHIA 4IR5A 4CUQA 4RVRA 4XY8A 4IURA 3F70A 3L2VA 5F62A 5IIDA 2L3RA 5J26A 4E96A 2EQUA 3GOXA 5ENGA 2GFAA 2X4WA 2L89A 4NRBA 3MULA 4TZ2A 1OYXA 5EICA 3ME9A 5FE5A 3OMCA 4QQDA 4O7AA 5DFBA 4N4GA 5ETDA 5IGLA 4E7LA 4J3IA 2RI2A 4QR4A 3BDLA 4MR4A 4NUDA 2DIGA 2MJVB 4NR6A 2M1HA 3TLPA 3HMFA 4UYDA
chains in the Genus database with same CATH superfamily
1X75C 4ZNXA 1VQ6T 4LXCA 4A63B 4Z89A 5D25A 1NE8A 2DL8A 2KY9A 3ERRA 5EVAA 1R77A 4XAXB 1NPPA 4Z6HA 2QG9B 2DL7A 2EWNA 2HKNA 5EPSA 3I9QA 3MPUB 4NS5A 4J9EA 5KE3A 1YWOA 5CUGA 1NYFA 2NWMA 1D1AA 5C85A 1B07A 4QB3A 4BY6B 2LMJA 4EDUA 4M7DD 5GAMe 4HXKA 3CCUA 5GANj 2F2WA 2M51A 3KUFA 4NR7A 4M78C 3JB9G 3QJ6A 1VIFA 1Y7XA 2ESWA 2C0OA 2XMFA 2EKOA 5EP7A 5CQ5A 1WIEA 5A83A 2V1QA 2GQIA 3ZYUA 2XG8D 3EHQA 5GAN5 2CT4A 3MJXA 3A8OB 4BB7A 3NHNA 4PJOB 4PJOA 4C92B 4C92A 3OYNA 5A5QA 4N3WA 4LDFA 4N4IA 5CQAA 4PCEA 3G71T 2YELA 5IHIA 5CUDA 1W2BA 2GGRA 5FU7C 2RHYA 3U5KA 4Z93A 4TT6A 2VGNA 3G6EA 1H8KA 3R6NA 5IN1A 4LN2A 1BI2A 4NR8A 5J39A 5KHMA 2XDBA 1ZA2B 5LJ5e 5II1A 4BDZA 3E2UA 1UFFA 2NYSA 2QA4A 5I22A 5FE4A 1WUGA 4OB3B 1M3AA 1S1NA 5GAN3 2JM9A 2YRVA 5A0DA 3I56Q 2OTJT 2EYWA 2MWPA 4M7DF 4CRIA 3QWYA 1NM7A 5HY6A 3QDRB 3QZ5B 1OEBA 4AKHA 3EH1A 4KULA 4J9BA 1M2OA 2DERA 2FRWA 3CPFA 1NJIC 2ZAEA 1ZQ1A 5CKHA 3DLMA 4JJCA 2V8KA 1PUOA 3OY9A 1VQKA 2QAZA 4OGEA 3VS2A 2VUBA 2HZYA 4F04B 2LCSA 2LDMA 5AYFA 2DK3A 2CZ0B 2Y4XA 2DRKA 5K29A 2YLBA 1VQLQ 5GAMd 1U5SA 1RI0A 4Q5WA 2VXFA 4TT4A 3LWIA 3AHUA 1SRMA 3UVYA 1VYTA 3D7SB 1UDLA 1WHKA 4BE2A 3GP8A 2YW5A 5CUBA 3TCJA 1VQ4T 4YABA 2JT4A 1TUDA 1UE9A 2EBPA 2JVVA 3M5AA 5CPEA 4A9IA 2JUFA 1M30A 4A53A 3DKMA 1EIFA 1YIJQ 2DNUA 3WVEB 5FB0A 1IGQA 5H85A 4BY6C 5D0CA 1VQ5A 3QDFA 4FU6A 4ZQLA 2RNAA 5CVIA 1AT1B 3TU4K 3MB3A 3SDZA 2YQDA 1QP3A 4FW2A 5LKZA 4RTTA 3P8DA 4AG2C 2WP1A 3LJWA 5D3TA 3P5OA 4IR6A 5CQYA 5LJ5d 3A5ZB 1Q82R 2EJNA 5LJ0A 1LCKA 2HQXA 3S91A 3I35A 4C92C 1I07A 1UTIA 3LYIA 4J6YA 3Q1JA 4JUVA 4OMLA 5F1LA 3LGLA 5ETBA 1VUBA 2KAFA 4YYKA 1Y57A 3ZBDA 5FU6B 2RK2A 1JJ2S 1YNZA 1EZZB 2E41A 3A8MB 5CQ4A 1ZHIA 4BE0A 1QCFA 3FIFA 1QW1A 1WQ7A 1JSPB 2RNYA 4KV1A 2EVRA 5DX4A 1YITT 1YJNQ 4M78D 1AZGB 3D7CA 2ROTA 5ENCA 2NLUA 2PVOB 1KC8U 4KBMB 4LDYA 1UHFA 3LQJA 2D8HA 5HK3A 4LDXA 4LR6A 3FRNA 2H8HA 5E3DA 1VQNT 4OF1A 4QSWA 1R8OB 3UA6A 2YSQA 5D6YA 1QVGA 4PTBA 3CC4A 3CCLT 3FJ5A 1NBEB 2X3WD 2LTOA 4TU6A 2AK5A 3L2RA 4HA8A 5FFYA 2IVWA 3SB2A 3G4SQ 2XDDA 4B9XA 4AT1B 1FMKA 5C0MA 1YI2Q 4YYJA 3JCMd 1WXUA 5I7XA 1C1AA 2BZXA 3QPHA 4XTZA 4HT8A 1KSWA 3HTRA 1BCMA 2K3XA 1PRMC 4HXLA 2NUTB 2NUTA 3CCEQ 2H60A 5GAOm 1NEBA 5L8RE 3QZTA 4YYDA 5LJ3e 1OX9A 3MEAA 1QVFA 5FDZA 2RI5A 4M77D 1MMAA 1N8RR 2RQTA 2V26A 3OW2P 5H1VA 2HL5C 3CMAT 2L3PA 2ATCB 2BZ8A 2PVDB 3CC2A 3FKMX 4WHUA 2AHJB 3KBGA 3NGPA 1YP5A 1E6GA 1M90R 4M75D 2HSPA 3CCQA 1P92A 5EPBA 3Q2FA 3KXTA 1PD0A 1MMNA 3H6ZA 4M4ZA 4DEXA 4CLBA 4XUBA 1AOJA 2CP2A 3LXJA 2JMCA 3PTAA 3OA6A 2DETA 4YATA 1HJDA 4C8QE 1BKBA 2DYBA 2ZZDA 1M1KR 2EYXA 1FX7A 2JJ9A 4QEWA 4Q0NA 2J06A 3DWYA 3NTKA 5E7DA 3OYIA 1D1CA 4C8QF 1KHCA 4QR5A 1D0ZA 2FPEA 5HKCA 2DXUA 4HBXA 4M7AE 3SVGA 4YH4A 4ZGDB 4HBYA 1FYNA 2QA4T 5FB1A 5HFQA 4M77F 5HELA 2D0NA 3REBB 1I0CA 3META 4J9GA 2XDPA 4MZTA 3JB9D 4E7SA 2L85A 2X9HA 3JCMJ 4O75A 4YYIA 2KEAA 2AZSA 3VU3C 3WXMB 1IRXA 3A8LB 5A85A 1TUCA 4A9HA 2QXFA 3S3NA 4F7UB 4F7UA 5I2SA 2WSEE 1KHIA 2XKOC 3GNGA 3O5ZA 2OUOA 3OMGA 1BU1A 1CKBA 2I0NA 1G3TA 5GMKm 2EGCA 4ANJA 5CKFA 5HFRA 5LJ3d 1S72T 2FHDA 4QBMA 3RNJA 3CCJA 1BI0A 1GCQC 2DA9A 3JCMh 1C0MA 2I7KA 4JS5A 1B3QA 5D7UA 3QBYA 2E3KA 4A9EA 1VQOQ 3L2WA 4OMQA 1YCSB 2R0SA 5C87A 2WSCE 3CD6Q 1VYVA 4HCKA 2OTLQ 1UHCA 2GCXA 3VKIA 3CXCP 5IH2A 2LJ3A 4BUGA 4E2FB 4BW2A 2SRCA 2EJGA 1OU9A 1GBQA 2ECZA 5DW2A 3HRSA 3I55A 3VKHA 3L1AA 4JLIA 3V7RA 3IQLA 3SVFA 2IIMA 1YFNA 3P8BB 5A0GA 2FZCB 4X2IA 2O9VA 5EA1A 1LVKA 5FFVA 3JB9F 2RJDA 2DJZA 5F36A 3E1SA 3X24B 4HXNA 5A5SA 3UPUA 5BT3A 3RKWA 2QDYB 2HSEB 3HPWA 2VWFA 3OYHA 5DW1A 5HRVA 1GBRA 1J3TA 5FBXA 4QVCA 3LX7A 3MP6A 3CCMT 5L96A 4ELZC 1ZUKA 2G6FX 3U5PA 2LC4A 3DAIA 4TVRA 1VQMQ 3NPFA 3OBWA 2DILA 3BDUA 4PY6A 1VIEA 4IUTA 3HRUA 2KRNA 4C0DC 3X28B 4PJMA 1OX8A 4QZSA 1I8FA 5I86A 4WCIA 2LQ8A 2DWWA 5DKDA 2PU9B 4QSPA 3JAME 1NJIR 1SG5A 4PLIA 1V76A 1Q82U 2DZ9A 2R0YA 3J80E 3CMET 4ESRA 5ENJA 5DYAA 4RG2A 2SEMA 4CC3A 2F5KA 3QO3A 4IR5A 1VQ7Q 4HCBA 1D0XA 3F70A 3L2VA 1Q81C 4XTYA 4E6RA 5J26A 4E96A 4AFSC 3ME9A 3JRZA 3CCVA 4N4GA 4DOWA 1D09B 2CDTA 2MK5A 5IGLA 3FB9A 1VQ9Q 1WPYA 2BTTA 4NR6A 1QQJA 3HRTA 4M7DC 3E9GA 4R0KA 2EQKA 2R57A 1JO8A 3J81E 2K79A 5I40A 2P4RA 4A4FA 4CUTA 1HSQA 2MF2A 1WYXA 1D0YA 3H9NA 1G8XA 1YJ9Q 3G7ZA 1WDXA 5CRMA 3BFMA 4D6WA 4UIZA 1YHQA 1W4SA 1WJRA 4B9WA 2HNIA 4MZMA 1KJWA 4C66A 2X4XA 2VVKA 4O72A 2K9GA 1VQ8T 2KRMA 4XU1A 1KQSS 1VA7A 3L2ZA 4Q0OA 2D8JA 3QIIA 3S92A 4M78B 4M78A 4J0RA 1G3SA 2DX1A 1GL5A 4UIWA 1IREB 1VQ6Q 2HBPA 2QQBA 5KYWB 3L2QA 5KYWA 3MB4A 3DB3A 2DAQA 3HL8A 2CZ7B 2DMOA 2E6NA 4C0FA 4OUFA 1ZUUA 4JRQA 3M54A 5IXFA 3M0SA 5CGPA 4OGJA 2K6DA 5FU7B 1QWFA 3OQ5A 4GPJA 2A3LA 1PWTA 2RI3A 3X25B 4AI6A 1M90U 3AQAA 4QUTA 4J0SA 1KQ1A 5IT9E 4XYAA 2IPOB 4C5IA 2ZPFB 1JM4B 2DLPA 3CCRT 2RJCA 3D1DA 5E74A 2PUKB 4J8OA 2QEXT 1BI1A 4LYIA 5CP5A 5EK9A 1CSKA 3OYMA 3G71Q 3P1FA 2YRDA 4J6XA 5LKXA 3VS4A 4QYLA 8ATCB 2JTEA 2P84A 1M1KU 2CUDA 2AIRB 2KXDA 5DFDA 1LOJA 4CUPA 5CQ3A 3QWXX 3O33A 1NG2A 2LX9A 2QQ9A 2O9SA 1VOMA 2OAWA 1WGSA 3I56A 3M0RA 1UGRB 5CTLA 2FPDA 5J3BA 4MEPA 2GFUA 5CAIA 4JS4A 5KTXA 4O6JA 4NQNA 5CO7A 4CC2A 3JCMP 5FH7A 2HQEA 4X9CA 1IZ6A 4A4KA 1PD1A 1RADB 2OTJQ 2BE7D 3M56A 4VUBA 2P0QA 3C94A 3I5RA 5ENFA 1YWPA 2JMAA 3K2JA 4M75B 4M75A 3NMZC 4ORZA 1M5Q1 5HCKA 5FWCA 5GAN8 2K57A 2LVMA 1VQLA 1IO6A 2FG0A 2R5AA 2RI7A 3PFSA 1WUMA 5BT5A 1GXIE 3LWHA 5GMKl 1ZS5A 3OYDA 1ACMB 4C0GA 5H1UA 4EPCA 4FSSA 4E47A 2FEIA 5GANf 5I7YA 1WJSA 2RPNA 2EQJA 5FE1A 3AADA 3MUKA 5A0LA 3CPWS 1YIJA 3QYGB 3LH5A 5FE6A 1E7OA 2DVQA 4J9FA 2ZPIB 4HVVA 2LT4A 4LC2A 3GIBA 2DXTA 4NOYA 1VQ4Q 4RCCA 1RAHB 5JWMA 3ZL7C 4QEUA 1WHGA 4LDUA 3HMEA 3ZFJA 3OW2A 2L0AA 1GFCA 4JPBW 3VYHB 1XJWB 5EG2A 2D1XA 2FYKA 4IUQA 1C6VX 4PJOG 4C92G 1AZEA 1MHNA 4LRGA 2AT1B 2MMPA 4MENA 3QZ9B 4KV4A 1PRLC 4DQ2A 2FZKB 5GMKe 5HLSA 4IKFA 3EH2A 3R6OA 3MP1A 4A9NA 3U5JA 4E7IA 4AMCA 1JRIA 1YJNA 4RTUA 5L8UA 1SSHA 2ED0A 4BW4A 2M0YA 1UECA 2COZA 5A82A 1WJQA 2YYNA 5GAMg 4IOQA 2A7YA 4QYDA 5A5NA 3H0FA 1T3SA 3RR6A 4C8QC 3RESA 2YT6A 4PS5A 4MEOA 3UF4A 5D6WA 3MHXA 4RTWA 2R58A 4F7UE 1YITQ 3GPLA 3GLXA 3KFVA 2RK1A 2QTVA 5D7XA 2GQVA 4M77C 1NJIU 3JV3A 2HD0A 1G2BA 2M9UA 3BW1A 4LDWA 1MMDA 2JZ2A 3G4SA 1RLQC 4A9OA 1MV0B 2K5IA 1VQNQ 1IB8A 1YI2A 3VJPA 2XI9A 3H8ZA 4Z1SA 5C89A 3CCLQ 2CP3A 2RNWA 2DZCA 4LD6A 3I3JA 2DO3A 2X4YA 3CC7A 1W2BS 2YEKA 4M75C 3U5LA 5DLZA 4J7IA 2E5QA 5ACYA 2HMAA 2YRCA 5CKBA 2RHUA 3CCEA 1YN8A 2Y4YA 3HFOA 3GG3A 4LZRA 1G3YA 3JVLA 1NEGA 1ZA1B 4RG8A 2HDAA 1E6IA 4YC9A 3IU6A 1Q7YC 1JBMA 1IHWA 1K73C 4UYGA 2DXCA 4EMKC 2COYA 2J6KA 1GCPA 2JNGA 4JZ4A 5FRMA 2ED1A 4YAXA 3OYJA 3V7CA 2DPPB 1NLOC 2WSFE 3QJYA 5E9KA 3FJPA 5E73A 2F5TX 1A0NB 2HAXA 4A4EA 3UW9A 4AKGA 1RAFB 1KQ2A 5DKHA 1N72A 2EIFA 2F2XA 1TXQA 3CXCA 5CR2A 1NYGA 2L5QA 3EFOB 3UDCA 2K5FA 3EFOA 3CMAQ 4A4GA 4KH1B 1M3BA 1RAEB 2KQWA 2RQWA 4RTZA 4QT7A 4JRKA 4NR5A 2W10A 4IR3A 4R55A 3CBOA 2JOYA 4DA4A 3PT9A 4FYXB 1Q81R 1H3ZA 2DE0X 4O7CA 3CBMA 2AKLA 3M0QA 3HP9A 1YJWT 3JCMg 2DBMA 5E9YA 3V8LA 4OB2B 3EAEA 4J6WA 3MCAB 3M0TA 4CUSA 1HK9A 2E3HA 4O78A 5A5RA 2JW4A 4HBVA 2KYMA 2M0OA 3EG0A 3S3OA 1Y0MA 1AEYA 1BBZA 2BIVA 1V1CA 2YWWA 5EISA 1RAAB 2A0FB 2XHCA 5I80A 5EGUA 5C4QA 3JCMb 3CEYA 1QLYA 1WLPB 1WNLA 2E5KA 2XIDA 4J9HA 1UG1A 5H1TA 4JZ3A 1IXDA 4ALGA 1D1BA 2RHZA 3UV5A 4CURA 1T0JA 3CCST 1U3OA 4BI4A 4GLMA 4RKUE 3X26B 2YEMA 5FE0A 1GCQA 2EAYA 4UYEA 1Y71A 1PKTA 4GBQA 1F68A 4YY4A 3PNWC 2LQKA 3NFCA 4BI3A 4PKLA 1X2KA 5DY7A 2AKKA 1UGVA 2YLCA 4C8QD 1VQOA 2JS2A 3PVLA 1S72Q 2MAMA 2CSIA 3CD6A 1EQFA 5GAMh 1SRLA 2OTLA 4LZSA 4KGVB 5LKUA 2EYYA 3M57A 5LVQA 2COWA 2PTKA 3JB9H 5DY9A 1YCYA 2OAUA 4IR4A 4XQ3A 5IHKA 1AHJB 2O01E 4KGZB 4M7AD 1TSFA 2EPDA 4HXPA 3QKJA 2QGGA 2RO0A 3CCUT 1HYOA 1QVGS 3EG1A 4IUUA 3ONIA 2J05A 3QHSA 5A81A 2OJ2A 4NYVA 3RMSA 1SHGA 5D3NA 4NQMA 2ZPEB 4TTEA 5KYNA 4QSSA 5KCHA 4A9FA 1QWEA 2YHTA 1ZSGA 3UVWA 4QW2A 1K0SA 5A7CA 2VYTA 2QQRA 4J9IA 2JN0A 1Q95G 5EWCA 1SF9A 3X20B 3AT1B 5LJ5h 2K3BA 2F1LA 2DKWA 4PCIA 5F5ZA 4C0DB 1VQMA 4XTWA 1JXOA 3QG1A 5D6XA 3G6ET 5JI8A 5LJ3g 6AT1B 4RVRA 4HXJA 2DM1A 3ER0A 2CZ6B 3I5SA 2L3RA 1X2QA 5ENGA 2X4WA 3JCMc 3GOXA 3CCMQ 3D1BA 7AT1B 4PK4A 1QKXA 4QQDA 1QVFS 1JXMA 1OU8A 4QR4A 5GAMj 4J5YA 1XTDA 3TLPA 3HMFA 2CSQA 4M7AF 3MEWA 4Z88A 1VQ7A 5CK9A 4B6MA 3INZA 1M1FA 2WACA 1RUWA 1BIBA 2MOXA 4J9DA 2M02A 2DTHA 3CMEQ 5II2A 3C95A 4E7JA 4O5VA 4KRTA 4E7ZA 1VQ9A 4M7DB 2JXBA 1H641 4A9LA 4M7DA 4OMMA 4F7UG 1EX4A 4HXSA 4O7FA 2ENMA 5I11A 1JJ2P 2DF6A 4X34A 1VQKT 4PFOA 4N0AC 5FH8A 3TSWA 3CC7T 1T3LA 1M8VA 3RIRA 2A37A 1KFZA 5GANe 2BKDN 5LJ5j 2HCKA 2FPFA 2EGAA 1WHLA 2NUPB 4HKEA 4JJDA 2W0ZA 2NUPA 3HFNA 1ZSZC 3JSCA 2VKNA 1YJ9A 2GBQA 3JVKA 1NPRA 3JB9I 4ZTJA 3L2UA 5HEMA 1I5OB 1UUEA 2G3RA 4N4HA 3DB4A 3C4SA 3L42A 4O7EA 5A5OA 1WXTA 1PNJA 4CL9A 2Y90A 4OP0A 1VQ5T 4XTXA 5HCLA 2YDLA 3OYLA 1OOTA 1T0HA 3SWNC 4NR4A 4C5GA 2DVEA 4CFLA 1VQ6A 5TCMA 2DJQA 1VQ8Q 3LW5E 3U23A 4PJOE 4C92E 5DFCA 1OV3A 2DVVA 1AWXA 3HMHA 2ZGWA 4LDVA 4L59A 4YH3A 1KIKA 5HM0A 3M53A 4PJOF 4C92F 4NYWA 1TUGB 9ATCB 2J6FA 2A08A 4ZN1A 4RCBA 3EG3A 5L97A 2OX7A 1XQHA 4TT2A 4J1PA 2IG0A 5KYUB 3HHTB 4XUAA 5KYUA 4UITA 2F6NA 1N9RA 1VQPQ 1ZKRA 3PIOA 5EWWA 3EG2A 1X01A 1WHMA 3G71A 4XTVA 1RI9A 3OYFA 3HKSA 3FDRA 3JCMW 1Q81U 1XOVA 4HT9A 2CH4A 5C7NA 3MKDA 3CC4T 5D3SA 1KD1C 2MIOA 3CCRQ 2QEXQ 4V2SA 3S3MA 1BI3A 2DRMA 4FT4A 5GANd 5GAOr 2V8JA 4EIKA 1Y96B 3ULRB 4OB0B 1Y96A 2L8DA 1VYUA 1Q7YR 5F1HA 1K73R 5HQ5A 4BJXA 5FG6A 2RH2A 5LJ3h 5CUCA 3P1CA 2CKKA 2OTJA 3J7AF 2YDWA 3O8VA 1HD3A 4FCYA 1PKSA 1R0CB 2B8AA 4GY5A 4A9JA 4YTLA 3BE3A 2A28A 4IIOA 3E19A 5I83A 2VV5A 4BW3A 2DYIA 2EQIA 5G4SA 2EKHA 2D82A 4JJBA 4AKIA 3UV4A 1ZUYA 1IGUA 4KUDK 2EGEA 5IG6A 3JVJA 5EM3A 4Z1QA 3S6WA 4F16A 3JCMV 4A4HA 3LQIA 3CC2T 4UYFA 2DL3A 1M2VB 5ENHA 1M2VA 5CQ6A 2QGFB 2KMTA 2RB6A 5J0DA 2ABLA 2FRYA 5GAOl 4RMOA 3CCQT 5FE3A 3V7SA 1E6HA 5HRWA 4D8KA 1OPLA 4QQ6A 3SHWA 2ZPGB 4Z8AA 4M78G 4EMHA 5FG5A 2R5MA 1B34B 2ROLA 1B34A 4UIYA 1U8RA 4ME7A 3OSVA 4CC7A 4HCZA 2EJFA 5KE2A 1BIAA 4XY9A 5F3AA 1TTHB 2XICA 4FW1A 4WTOB 5IXBA 4X1VA 1G5VA 1K8AC 2LQNA 3SFMA 1UGSB 1Q86C 4PJJA 2ZPBB 3UVDA 3PMTA 5D3HA 5LJ3j 2DTOA 3C12A 1ZLMA 2EFIA 2E12A 2CREA 4LUDA 5GJWB 5C6SA 2L5EA 2CUBA 4ZW1A 5HJCA 5EWVA 3VS7A 4KGXB 4BDYA 2X51A 5I21A 3OYBA 1OQKA 4C8QB 4C8QA 2AZVA 2DTIA 3GF5A 1X6BA 1VQ7T 2DEUA 4LD9K 5AMEA 4DBRA 4YYNA 5D3RA 1QCOA 1TWBA 4JRPA 2CP0A 2DEQA 4NYXA 4M77B 4M77A 4AKNA 4HBWA 3JCMX 4ATOA 4PNOA 5GANh 2L84A 2LSPB 1MMGA 5AD3A 2CP7A 4M77G 3CCJT 3PGGA 1VQNA 2EYQA 5AD2A 3CPWA 3EFRA 4LUEA 2RA2A 5FE8A 3CCLA 5BT4A 2CT3A 2JTFA 3JB9J 2HKQB 4D8DA 5ENBA 3LLRA 1I5LA 4O77A 1M8MA 5E9IA 5KYXB 3JVMA 2PUOB 5KYXA 4FYVB 4A9KA 4M75G 2CP5A 5EWDA 2KRSA 2BUDA 3RERA 2YUNA 3TSZA 3M9QA 2FO0A 5L99A 3I55T 5FLXE 1M3CA 4YBSA 4EMKB 5ENIA 2KNBB 4EMKA 5KH6A 3OYKA 3FLGA 1K9MU 4FLPA 5CY9A 1W70A 2LQWA 3RKYA 2KROA 1FMWA 5TB6A 4BI8B 3QXEB 4QQGA 1K9MC 4LZ2A 4O7BA 4WHWA 2QDLA 4C5HA 3GBQA 4TZ8A 3A8HB 1GFDA 1Z9QA 3U5NA 5IHNA 4QY4A 1EFNA 4ALHA 2LCLA 3VKGA 2L2PA 3UT1A 3VYGA 2OO1A 2V1RA 5CZGA 2P0PA 2RD1A 4CFKA 1K9AA 3CMAA 3U5OA 2CP6A 5IAYA 3TREA 4NXJA 5A5PA 3G0LA 4QSXA 5CQ7A 4BHWA 2LJ1A 4TYLA 5FE9A 2H3JA 4IUVA 2K3YA 2MPXC 1WA7A 1BYMA 5FG4A 2VASA 3M0UA 2RS9B 2F6JA 5D26A 2DBKA 1KQSP 5I88A 3OS1A 5DBMA 2FVUA 3N5BB 2DFUA 5FH6A 4C67A 3OYCA 4XU0A 4ELYC 2H3EB 4IUPA 2C0TA 5AMFA 5HK0A 1YJWQ 5GAN7 2YUOA 2VGMA 2QI2A 3VS6A 4CUUA 4DOVA 4YYGA 1MV3A 5D3JA 3URGA 5L98A 4Y03A 1KG1A 1ZX6A 2RN8A 2OSSA 1BK2A 3CCVT 4QSRA 1JB0E 5I1QA 4XU2A 1UEBA 2CYZB 1U1TA 4M7DE 4F7UF 4MMLA 5ECAA 4M7AC 3SVHA 4MR5A 1I1JA 2RJEA 5GJVB 2LNHB 1PCXA 2GTOA 3EG9B 3OW2S 2M16A 3EG9A 5E9VA 2RQUA 2ZPHB 2KDSA 4OGCA 4QC1A 1BCOA 3E9FA 4A9MA 3M55A 5GAN2 5LJ5g 4JLGA 1PM3A 1CKAA 4QSUA 3RMQA 1YHQT 1Q7YU 3CCSQ 1S72A 2L3QA 1YBYA 1PSEA 1K73U 2R0VA 4TS8A 4QSVA 3OSSC 2P0KA 2GNCA 3THKA 3A1PA 1OULA 3RCWA 2RMOA 1LJOA 1JJ2A 3UVXA 5A2QE 5IGMA 2FSAA 3QYHB 5F25A 3WVDB 3M4YA 3O34A 5I89A 3OBYA 4NUCA 1SHFA 1AVZC 1QKWA 4AFZC 3JCMe 2LRQA 2YUQA 2A36A 4CUQA 1RLPC 4XY8A 2QTXA 2QYZA 4K11A 5IIDA 5CKEA 2EQUA 3PE0A 2GFAA 2JM8A 4NRBA 4AFQC 2OI3A 3OMCA 4O7AA 4KUIA 3CCUQ 5DFBA 3H0HA 5ETDA 2DVJA 1X27A 4E7LA 4J3IA 3G1JA 4C0ZA 1KD1R 1AD5A 2LP5A 2KYBA 2M1HA 4UYDA 1RACB 2K7AA 2LX7A 4F17A 2C06A 5HQ7A 3PMIA 5GAN6 4Y28E 5F2PA 5I2MA 1U06A 4DEYA 1K0XA 2V8IA 3OYYA 3CCMA 1IHVA 3QSUA 4PJOC 5L8TA 1W6XA 1MNDA 1OI1A 3M58A 3CPWP 2DIQA 3G6EQ 1K76A 5CCAA 3P1EA 3QUIA 2RQRA 5KTUA 3I56T 2CZ1B 4YK0A 5HRXA 4R56A 2LT1A 3V8KA 4QVDA 2MCNA 4QC3A 3T9NA 2QA4Q 5KU3A 4FIBA 5FROA 2RJFA 3CXCS 1O75A 3CMEA 4YYMA 3O37A 5CS8A 1AWOA 1XNIA 4MMKA 3OYAA 4PJNA 1KC8C 5KO4A 2BZYA 3VRZA 4L6V5 1WXBA 2GF7A 4XTUA 1UJYA 1W1FA 4UC4A 5M9OA 4N0AA 4BW1A 2D9TA 1SPKA 2VB6A 5C8GA 4PL6A 3O36A 5LJ2A 1JEGA 2GRCA 2DXBA 3ZEHA 5DLOA 1MUZA 4L5GA 5CQXA 4O74A 5KCOA 1R0BG 4N4FA 2X4JA 3FC3A 1ZSZB 1VQLT 5CQTA 1I81A 1ZSZA 3HSBA 2KE9A 4BE1A 1RAIB 1VQKQ 2KBTA 1X6GA 2KVQG 5IGKA 2BE9B 3CC7Q 4ZN3A 1GRIA 2LCCA 5EI4A 3PVQA 3SEMA 2JTMA 4UIUA 2PQWA 1G3WA 5EPRA 4XK8E 4HVWA 1QP2A 4OMNA 1K8AR 4PFPA 1Q86R 2O2OA 4M78E 2MYSA 2E65A 5EV9A 1YIJT 5DYXA 3P8HA 3SWNB 2E10A 2K5LA 2WP2A 3SWNA 3NTIA 2VXEA 4TQNA 4M78F 3MEUA 1RAGB 2KT1A 5IGNA 3C0CA 1VQ8A 4KCXA 2PNIA 1N5ZA 2NUZA 4MDXA 1OPKA 1W2BP 4MR6A 5GMKh 1VQ5Q 1SKUB 3TQ7P 2J6OA 2X35A 2D0QB 5CUAA 3TVTA 4MR3A 4BD3A 2MI6A 2P4TA 5GAOp 1FXXA 2VC8A 4YYHA 4HXOA 1K1ZA 5KYYB 4UIXA 4II1A 4LE9A 5KYYA 2QK0A 5FFWA 5GAMf 4KT0E 1YJNT 3LQHA 1U1SA 2PVGB 1VQPA 2E6ZA 2E4HA 2N9GA 1ARKA 2HL3A 1V29B 4OMPA 2K4YA 4NUEA 4E7HA 3QZSA 3BY7A 1TH7A 2L3SA 4RTXA 4A54A 4MZPA 5EQ1A 4TU4A 1WX6A 5FU6C 3H41A 2C0IA 4M77E 4PKCC 4Z02A 1WFWA 5DLXA 2K2MA 2EQMA 3CCRA 3H0IA 2QEXA 2E7OA 3U5MA 1PSFA 2O31A 2LNVA 5D24A 2DD4A 4QR3A 5E9MA 2Z0WA 3G4ST 2XK0A 2NXBA 5AT1B 2KXCA 3VUZA 1YI2T 3UWNA 4WIVA 1OZ2A 2QASA 3M0PA 3OS0A 3CC4Q 4M75E 3UA7A 5LJ5f 4PJOD 1K9MR 4C92D 4YBMA 3TEEA 4DBFA 4M7DG 3M4GA 4QVZA 3V8JA 1WHHA 4FSXA 5GMKj 4M75F 4Y91A 3A8GB 1N9SA 4AG1C 3CCET 1F1BB 5GAOq 2FL7A 3OYEA 5CU8A 1SSFA 4JRIA 2DL4A 3MXFA 3PIPA 2LZ6B 3CQTA 4O71A 2YUPA 3NXBA 3OYGA 4YBTA 2CGHA 1ABOA 4JJNK 2KK4A 3NTHA 2QQSA 5F60A 3RUXA 5GMKi 5LKTA 3UV2A 5D3PA 2G4AA 4HXMA 1QVPA 1TU0B 2KR3A 3MQMA 3MEVA 4XU3A 2DL5A 4QSTA 1FMVA 5LL6S 3P1DA 3FEOA 2E70A 1K4US 1N27A 4QSQA 5DM7R 1WQWA 4CC4B 2DD5A 3CC2Q 1NLPC 2I8NA 4ZC9A 3UATA 3LH0A 3JCMf 5GANg 4F14A 1PHTA 1X0JA 1G83A 3CCQQ 3OS2A 5F61A 4LYSA 4Z6IA 4YADA 2E7NA 1JQQA 2EW3A 2FZGB 3EGUA 3GNFB 2KI7A 2LJ0A 3VS1A 1JU5C 1SEMA 4FYWB 1KK7A 1QCNA 5CQ8A 3VUBA 2XD0A 4KH0B 4LYWA 3OB9A 4QEVA 4HVUA 1QVGP 2E3IA 1KD1U 5LUUA 3EFSA 4CI0C 4DONA 1AWJA 1PC0A 1X43A 1WHJA 4PJLA 5GAN4 3O35A 4P5NA 5E0RA 1TS9A 4UYHA 4PFZA 2RQVA 3RDVA 4QKUA 4O70A 1KQSA 1Q82C 2RFJA 3LGFA 4OVAA 1MGQA 3VS5A 1M1GA 5FRNA 4IOOA 3VRYA 1M27C 5COIA 4QUUA 1OZ3A 5D3LA 3ASKA 4NL3A 2MWOA 1UGQB 1VQOT 2FB7A 1QVFP 5E9LA 3CD6T 1LPLA 1D3BB 4Y92A 3EGDB 1D3BA 2OTLT 3EGDA 3CCJQ 4EMGA 5DYUA 2D9EA 4RUGA 4DBQA 5HENA 1TOVA 5KTWA 1ZBXA 1B7TA 3CBPA 1X6OA 2D6FA 2F2VA 1I4K1 2EYZA 5EWHA 4C5EA 4FL6A 2KSSA 5CUEA 5LVRA 4UYFB 4OMOA 4MEQA 4WF2A 1N6AA 4J7FA 4MDWA 2CH4W 4RTYA 1X69A 3IU5A 5ENEA 1NZ9A 2ZCFB 3JCMQ 1H3HA 4NL2A 2GTJA 3I55Q 4J83A 5G4RA 5GAOn 1AWWA 4IIMA 5CRZA 5CFWA 3MP8A 2QQAA 1UJ0A 2RO1A 2JS0A 4JDSA 2HEQA 5FW9A 5HQ6A 1VQ4A 4RTVA 5LJ3f 4BACA 1K8AU 5I29A 1Q86U 2EJ9A 4F3IA 3A98A 5CIUA 3SD4A 4NRAA 4PLLA 1VQMT 3DLLA 4HCCA 5E3GA 2F69A 1RL2A 2I2LA 4J9CA 3REAB 3EGXB 3EGXA 2B86A 4ZTFA 4NRCA 4LNPA 3QZVA 1N8RU 5FE7A 1UB4A 5DYCA 5F63A 1TG0A 1VQPT 1KC8R 1WI7A 5EU1A 1N8RC 2O4XB 1FWZA 2O4XA 4HXRA 5LJ1A 2DATA 1Z9ZA 2RNXA 2HQHA 3MO8A 1YJWA 2XU8A 3EHRA 1M90C 1Y07A 2HBWA 4QNSA 4C8QG 2RM4A 1YITA 3VS3A 1RABB 3VV0A 4E7KA 2RHXA 3G0JA 4OGIA 5FWBA 4M7AB 4GLKA 4OMFB 5EC7A 1VQ9T 4M7AA 2KT8A 1M4ZA 2X3XD 4O76A 1PG5B 1HXDA 5FE2A 5L23A 3M59A 1M1KC 3Q2EA 4FM4B 5IBNA 1DJ7B 2J7IA 4YY6A 2YXYA 4ZGJB 5DKCA 4M7AG 2R10A 1LNXA 2PZ1A 3CCVQ 1ZBJA 2O88A 1H92A 4IORA 5DLQE 2DVSA 1ABQA 3VS0A 1WZOA 2KGTA 4ZGEB 2K2VA 4UIVA 2KTBB 1YJ9T 2DVRA 2E1HA 4AFUC 5CKDA 4NR9A 2RHIA 3CCSA 2E64A 2RF0A 4IURA 5F62A 8AT1B 1BB9A 2L89A 2DKGA 3OS5A 1MNEA 3MULA 4TZ2A 1OYXA 5EICA 4X9DA 1QMCA 5FE5A 4OB1B 4FT2A 3RKXA 1YHQQ 4DBHA 2RI2A 3BDLA 4MR4A 4NUDA 2DIGA 3RBBB 2MJVB 1M9SA 2CS7A 1O9SA 4FYYB 1UGPB
chains in the Genus database with same CATH topology
1X75C 1VQ6T 5D25A 1NE8A 2KY9A 5EVAA 4XAXB 1NPPA 4Z6HA 2EWNA 5EPSA 5KE3A 4NS5A 5CUGA 4BY6B 5C85A 4QB3A 4EDUA 4M7DD 5GAMe 4HXKA 3CCUA 5GANj 3KUFA 4NR7A 4M78C 3JB9G 3QJ6A 1VIFA 1Y7XA 2EKOA 5EP7A 5CQ5A 5A83A 3ZYUA 2XG8D 5GAN5 3A8OB 4BB7A 4PJOB 4PJOA 4C92B 4C92A 3OYNA 5A5QA 4N3WA 4LDFA 4N4IA 5CQAA 4PCEA 3G71T 2YELA 5CUDA 1W2BA 5FU7C 2RHYA 3U5KA 4Z93A 4TT6A 2VGNA 3G6EA 5IN1A 1BI2A 4NR8A 5J39A 5KHMA 2XDBA 5LJ5e 5II1A 4BDZA 2QA4A 5FE4A 1WUGA 4OB3B 5GAN3 2YRVA 5A0DA 2OTJT 2MWPA 4M7DF 4CRIA 5HY6A 3QDRB 3QZ5B 4KULA 3CPFA 1NJIC 1ZQ1A 5CKHA 3DLMA 2V8KA 3OY9A 1VQKA 4OGEA 2VUBA 2LDMA 5AYFA 2DK3A 2CZ0B 2Y4XA 2YLBA 5K29A 5GAMd 1RI0A 4Q5WA 2VXFA 4TT4A 3LWIA 3AHUA 3UVYA 4BE2A 3GP8A 2YW5A 5CUBA 3TCJA 1VQ4T 4YABA 2JVVA 3M5AA 5CPEA 4A9IA 2JUFA 4A53A 3DKMA 1EIFA 3WVEB 5FB0A 5H85A 4BY6C 5D0CA 1VQ5A 4FU6A 4ZQLA 5CVIA 3TU4K 3MB3A 3SDZA 2YQDA 1QP3A 5LKZA 3P8DA 2WP1A 3LJWA 5D3TA 3P5OA 4IR6A 5CQYA 5LJ5d 3A5ZB 5LJ0A 2HQXA 3S91A 4C92C 4J6YA 3LYIA 3Q1JA 4JUVA 5F1LA 3LGLA 5ETBA 1VUBA 2KAFA 4YYKA 3ZBDA 5FU6B 2RK2A 1JJ2S 2E41A 3A8MB 5CQ4A 1ZHIA 4BE0A 3FIFA 1QW1A 1WQ7A 1JSPB 2RNYA 4KV1A 5DX4A 1YITT 4M78D 3D7CA 5ENCA 2NLUA 2PVOB 1KC8U 4KBMB 4LDYA 3LQJA 5HK3A 4LDXA 4LR6A 3FRNA 5E3DA 1VQNT 4OF1A 4QSWA 1R8OB 5D6YA 1QVGA 4PTBA 3CC4A 3CCLT 2LTOA 4TU6A 3L2RA 4HA8A 5FFYA 2IVWA 3SB2A 2XDDA 4B9XA 5C0MA 4YYJA 3JCMd 5I7XA 3QPHA 4XTZA 4HT8A 2K3XA 4HXLA 2H60A 5GAOm 5L8RE 3QZTA 4YYDA 5LJ3e 3MEAA 1QVFA 5FDZA 2RI5A 4M77D 5H1VA 3CMAT 2PVDB 3CC2A 3FKMX 4WHUA 2AHJB 3KBGA 4M75D 3CCQA 1P92A 5EPBA 3Q2FA 3KXTA 3H6ZA 4CLBA 4XUBA 3LXJA 3PTAA 3OA6A 4YATA 4C8QE 1BKBA 2ZZDA 1FX7A 4QEWA 4Q0NA 3DWYA 3NTKA 5E7DA 3OYIA 4C8QF 1KHCA 4QR5A 5HKCA 2DXUA 4HBXA 4M7AE 3SVGA 4YH4A 4ZGDB 4HBYA 2QA4T 5FB1A 5HFQA 4M77F 5HELA 3META 2XDPA 4MZTA 3JB9D 2L85A 3JCMJ 4O75A 4YYIA 3VU3C 3WXMB 3A8LB 5A85A 4A9HA 2QXFA 3S3NA 4F7UB 4F7UA 5I2SA 2WSEE 1KHIA 2XKOC 3GNGA 2OUOA 3OMGA 1G3TA 5GMKm 5CKFA 5HFRA 5LJ3d 1S72T 2FHDA 4QBMA 3CCJA 1BI0A 3JCMh 2I7KA 4JS5A 3QBYA 2E3KA 4A9EA 3L2WA 2R0SA 5C87A 2WSCE 2GCXA 3VKIA 4BUGA 4BW2A 2EJGA 5DW2A 3HRSA 3I55A 3L1AA 4JLIA 3V7RA 3SVFA 3P8BB 5A0GA 4X2IA 5EA1A 5FFVA 3JB9F 2RJDA 2DJZA 5F36A 3E1SA 3X24B 4HXNA 5A5SA 3UPUA 5BT3A 3RKWA 2QDYB 3HPWA 3OYHA 5DW1A 5HRVA 5FBXA 4QVCA 3LX7A 3MP6A 3CCMT 5L96A 4ELZC 3U5PA 2LC4A 3DAIA 4TVRA 3OBWA 3BDUA 4PY6A 1VIEA 4IUTA 3HRUA 4C0DC 3X28B 4QZSA 1I8FA 5I86A 2LQ8A 2DWWA 5DKDA 2PU9B 4QSPA 3JAME 4PLIA 1Q82U 2DZ9A 2R0YA 3J80E 3CMET 5ENJA 5DYAA 4RG2A 2F5KA 3QO3A 4IR5A 4HCBA 3F70A 3L2VA 1Q81C 4XTYA 5J26A 4E96A 3ME9A 3JRZA 3CCVA 4N4GA 4DOWA 5IGLA 3FB9A 1WPYA 4NR6A 3HRTA 4M7DC 3E9GA 2EQKA 2R57A 3J81E 5I40A 4A4FA 4CUTA 2MF2A 3G7ZA 5CRMA 3BFMA 4D6WA 4UIZA 1YHQA 1W4SA 1WJRA 4B9WA 2HNIA 4MZMA 4C66A 2X4XA 4O72A 1VQ8T 4XU1A 1KQSS 3L2ZA 4Q0OA 3QIIA 3S92A 4M78B 4M78A 4J0RA 1G3SA 4UIWA 1IREB 2HBPA 2QQBA 3L2QA 3MB4A 3DB3A 2DAQA 3HL8A 2CZ7B 2E6NA 4C0FA 4OUFA 4JRQA 3M54A 5CGPA 4OGJA 5FU7B 3OQ5A 4GPJA 2A3LA 2RI3A 3X25B 1M90U 3AQAA 4QUTA 4J0SA 1KQ1A 5IT9E 4XYAA 4C5IA 2ZPFB 1JM4B 3CCRT 2RJCA 5E74A 2PUKB 4J8OA 2QEXT 1BI1A 4LYIA 5CP5A 5EK9A 3OYMA 3P1FA 4J6XA 5LKXA 4QYLA 1M1KU 5DFDA 1LOJA 4CUPA 5CQ3A 3O33A 2LX9A 2QQ9A 1WGSA 3I56A 1UGRB 5CTLA 5J3BA 4MEPA 2GFUA 5CAIA 4JS4A 5KTXA 4O6JA 4NQNA 5CO7A 3JCMP 5FH7A 2HQEA 4X9CA 1IZ6A 4A4KA 3M56A 4VUBA 2P0QA 3C94A 5ENFA 4M75B 3K2JA 4M75A 1M5Q1 5GAN8 2K57A 2LVMA 1VQLA 2R5AA 2RI7A 3PFSA 1WUMA 5BT5A 1GXIE 3LWHA 5GMKl 1ZS5A 3OYDA 4C0GA 5H1UA 4EPCA 4E47A 5GANf 5I7YA 1WJSA 2EQJA 5FE1A 3AADA 3MUKA 5A0LA 3CPWS 1YIJA 3QYGB 5FE6A 2DVQA 2ZPIB 2LT4A 4LC2A 3GIBA 2DXTA 4NOYA 4RCCA 5JWMA 4QEUA 4LDUA 3HMEA 3ZFJA 3OW2A 3VYHB 5EG2A 2FYKA 4IUQA 4PJOG 4C92G 1MHNA 4LRGA 2MMPA 4MENA 3QZ9B 4KV4A 4DQ2A 5GMKe 5HLSA 4IKFA 3R6OA 3MP1A 4A9NA 3U5JA 4E7IA 1JRIA 1YJNA 5L8UA 4BW4A 5A82A 1WJQA 2YYNA 5GAMg 4IOQA 5A5NA 4QYDA 2A7YA 4C8QC 3RESA 4PS5A 4MEOA 5D6WA 3MHXA 2R58A 4F7UE 3GPLA 3GLXA 2RK1A 5D7XA 2GQVA 4M77C 1NJIU 2HD0A 2M9UA 3BW1A 4LDWA 2JZ2A 3G4SA 4A9OA 2K5IA 1YI2A 3VJPA 2XI9A 3H8ZA 4Z1SA 5C89A 2RNWA 2DZCA 4LD6A 3I3JA 2DO3A 2X4YA 3CC7A 1W2BS 2YEKA 4M75C 3U5LA 5DLZA 4J7IA 2E5QA 5ACYA 5CKBA 2RHUA 3CCEA 2Y4YA 3HFOA 3GG3A 4LZRA 1G3YA 3JVLA 4RG8A 1E6IA 4YC9A 3IU6A 1Q7YC 1JBMA 1K73C 4UYGA 2DXCA 4EMKC 2JNGA 5FRMA 4YAXA 3OYJA 3V7CA 2DPPB 2WSFE 3QJYA 5E9KA 3FJPA 5E73A 2F5TX 2HAXA 4A4EA 3UW9A 1KQ2A 5DKHA 1N72A 2EIFA 3CXCA 5CR2A 2L5QA 3UDCA 2K5FA 4A4GA 2KQWA 4JRKA 4NR5A 4IR3A 4R55A 3CBOA 2JOYA 4DA4A 3PT9A 1H3ZA 4O7CA 3CBMA 3HP9A 1YJWT 3JCMg 5E9YA 3V8LA 4OB2B 3EAEA 4J6WA 3MCAB 4CUSA 1HK9A 4O78A 5A5RA 4HBVA 2M0OA 3S3OA 2BIVA 5EISA 2XHCA 5I80A 5EGUA 5C4QA 3JCMb 3CEYA 1WNLA 2XIDA 5H1TA 4ALGA 2RHZA 3UV5A 4CURA 3CCST 4BI4A 4RKUE 3X26B 2YEMA 5FE0A 2EAYA 4UYEA 1Y71A 1F68A 4YY4A 3PNWC 2LQKA 3NFCA 4BI3A 4PKLA 5DY7A 2YLCA 4C8QD 1VQOA 2MAMA 3CD6A 1EQFA 5GAMh 2OTLA 4LZSA 5LKUA 3M57A 5LVQA 3JB9H 5DY9A 1YCYA 2OAUA 4IR4A 4XQ3A 1AHJB 2O01E 4M7AD 4HXPA 3QKJA 2RO0A 3CCUT 1QVGS 4IUUA 3ONIA 3QHSA 5A81A 4NYVA 3RMSA 5D3NA 4NQMA 2ZPEB 4TTEA 4QSSA 5KCHA 4A9FA 2YHTA 3UVWA 4QW2A 5A7CA 2VYTA 2QQRA 2JN0A 5EWCA 3X20B 5LJ5h 2DKWA 4PCIA 5F5ZA 4C0DB 1VQMA 4XTWA 3QG1A 5D6XA 3G6ET 5JI8A 5LJ3g 4RVRA 3ER0A 2CZ6B 2L3RA 3GOXA 5ENGA 2X4WA 3JCMc 4QQDA 1QVFS 4QR4A 5GAMj 4J5YA 1XTDA 3TLPA 3HMFA 4M7AF 3MEWA 1VQ7A 5CK9A 3INZA 1M1FA 2WACA 1BIBA 2DTHA 5II2A 3C95A 4E7JA 4O5VA 1VQ9A 4M7DB 1H641 4A9LA 4M7DA 4F7UG 4HXSA 4O7FA 4X34A 1VQKT 4N0AC 5FH8A 3CC7T 1M8VA 3RIRA 5GANe 2BKDN 5LJ5j 4HKEA 3HFNA 3JSCA 1YJ9A 3JVKA 1NPRA 3JB9I 4ZTJA 3L2UA 5HEMA 2G3RA 4N4HA 3DB4A 3C4SA 3L42A 4O7EA 5A5OA 4CL9A 2Y90A 4OP0A 1VQ5T 4XTXA 5HCLA 3OYLA 3SWNC 4NR4A 4C5GA 2DVEA 4CFLA 1VQ6A 5TCMA 3LW5E 4PJOE 4C92E 5DFCA 2DVVA 3HMHA 2ZGWA 4LDVA 4L59A 4YH3A 5HM0A 3M53A 4PJOF 4C92F 4NYWA 4ZN1A 4RCBA 5L97A 1XQHA 4TT2A 4J1PA 2IG0A 3HHTB 4XUAA 4UITA 2F6NA 1N9RA 3PIOA 5EWWA 1X01A 3G71A 4XTVA 3OYFA 3HKSA 3FDRA 3JCMW 1Q81U 1XOVA 4HT9A 5C7NA 3CC4T 5D3SA 1KD1C 4V2SA 3S3MA 1BI3A 4FT4A 5GANd 5GAOr 2V8JA 1Y96B 4OB0B 1Y96A 2L8DA 5F1HA 5HQ5A 4BJXA 5FG6A 2RH2A 5LJ3h 5CUCA 3P1CA 2CKKA 2OTJA 3J7AF 2YDWA 3O8VA 2B8AA 4GY5A 4A9JA 4YTLA 3E19A 5I83A 2VV5A 4BW3A 5G4SA 2D82A 3UV4A 4KUDK 5IG6A 3JVJA 5EM3A 4Z1QA 3S6WA 3JCMV 4A4HA 3LQIA 3CC2T 4UYFA 5ENHA 5CQ6A 2KMTA 2RB6A 5J0DA 5GAOl 4RMOA 3CCQT 5FE3A 3V7SA 5HRWA 4QQ6A 2ZPGB 4EMHA 4M78G 5FG5A 2R5MA 1B34B 1B34A 4UIYA 1U8RA 4ME7A 3OSVA 4HCZA 2EJFA 5KE2A 1BIAA 4XY9A 5F3AA 2XICA 1G5VA 1K8AC 3SFMA 1UGSB 1Q86C 2ZPBB 3UVDA 3PMTA 5D3HA 5LJ3j 2DTOA 3C12A 2EFIA 2E12A 5C6SA 2L5EA 4ZW1A 5HJCA 5EWVA 4BDYA 5I21A 3OYBA 4C8QB 4C8QA 2DTIA 3GF5A 1VQ7T 4LD9K 5AMEA 4YYNA 5D3RA 4JRPA 2DEQA 4NYXA 4M77B 4M77A 4AKNA 4HBWA 3JCMX 4ATOA 4PNOA 5GANh 2L84A 2LSPB 5AD3A 4M77G 3CCJT 3PGGA 1VQNA 2EYQA 5AD2A 3CPWA 3EFRA 2RA2A 5FE8A 3CCLA 5BT4A 2JTFA 3JB9J 5ENBA 3LLRA 1I5LA 4O77A 5E9IA 3JVMA 2PUOB 4M75G 4A9KA 5EWDA 2BUDA 3RERA 3M9QA 5L99A 3I55T 5FLXE 4YBSA 4EMKB 5ENIA 4EMKA 5KH6A 3OYKA 3FLGA 1K9MU 4FLPA 5CY9A 3RKYA 5TB6A 4BI8B 3QXEB 4QQGA 1K9MC 4LZ2A 4O7BA 4WHWA 4C5HA 4TZ8A 3A8HB 3U5NA 4QY4A 4ALHA 2LCLA 3VYGA 3UT1A 2OO1A 5CZGA 2P0PA 2RD1A 4CFKA 3CMAA 3U5OA 5IAYA 3TREA 4NXJA 5A5PA 3G0LA 4QSXA 5CQ7A 4BHWA 4TYLA 5FE9A 2H3JA 4IUVA 2K3YA 1BYMA 5FG4A 2RS9B 2F6JA 5D26A 5I88A 3OS1A 5DBMA 2FVUA 3N5BB 5FH6A 4C67A 3OYCA 4XU0A 4ELYC 4IUPA 5AMFA 5HK0A 5GAN7 2VGMA 2QI2A 4CUUA 4DOVA 4YYGA 5D3JA 3URGA 5L98A 4Y03A 1KG1A 3CCVT 2OSSA 4QSRA 1JB0E 5I1QA 4XU2A 1UEBA 2CYZB 1U1TA 4M7DE 4F7UF 4MMLA 4M7AC 3SVHA 4MR5A 2RJEA 3OW2S 2M16A 5E9VA 2ZPHB 2KDSA 4OGCA 4QC1A 3E9FA 4A9MA 3M55A 5GAN2 5LJ5g 4JLGA 4QSUA 3RMQA 1YHQT 1Q7YU 1S72A 1YBYA 1PSEA 1K73U 2R0VA 4TS8A 4QSVA 3OSSC 2P0KA 3RCWA 1LJOA 1JJ2A 3UVXA 5A2QE 5IGMA 2FSAA 3QYHB 5F25A 3WVDB 3M4YA 3O34A 5I89A 3OBYA 4NUCA 3JCMe 2LRQA 4CUQA 4XY8A 2QTXA 5IIDA 5CKEA 2EQUA 2GFAA 4NRBA 3OMCA 4O7AA 4KUIA 5DFBA 5ETDA 4E7LA 4J3IA 4C0ZA 2M1HA 4UYDA 2C06A 5HQ7A 3PMIA 5GAN6 4Y28E 5F2PA 5I2MA 2V8IA 3OYYA 3CCMA 3QSUA 4PJOC 5L8TA 1OI1A 3M58A 2DIQA 5CCAA 3P1EA 3QUIA 5KTUA 3I56T 2CZ1B 4YK0A 5HRXA 4R56A 2LT1A 3V8KA 4QVDA 4QC3A 3T9NA 5KU3A 4FIBA 5FROA 2RJFA 3CXCS 1O75A 3CMEA 4YYMA 3O37A 5CS8A 1XNIA 4MMKA 3OYAA 1KC8C 5KO4A 4L6V5 2GF7A 4XTUA 4UC4A 5M9OA 4N0AA 4BW1A 2D9TA 5C8GA 4PL6A 3O36A 5LJ2A 2GRCA 2DXBA 3ZEHA 5DLOA 4L5GA 5CQXA 4O74A 5KCOA 3FC3A 4N4FA 2X4JA 1VQLT 5CQTA 1I81A 3HSBA 4BE1A 2KVQG 5IGKA 4ZN3A 2LCCA 5EI4A 2JTMA 4UIUA 2PQWA 1G3WA 5EPRA 4XK8E 1QP2A 4M78E 2E65A 5EV9A 1YIJT 5DYXA 3P8HA 3SWNB 2E10A 2K5LA 2WP2A 3SWNA 3NTIA 2VXEA 4TQNA 4M78F 3MEUA 5IGNA 1VQ8A 4KCXA 4MDXA 4MR6A 5GMKh 2X35A 2D0QB 5CUAA 4MR3A 4BD3A 2MI6A 2P4TA 5GAOp 1FXXA 2VC8A 4YYHA 4HXOA 4UIXA 4II1A 5FFWA 5GAMf 4KT0E 1YJNT 3LQHA 1U1SA 2PVGB 1VQPA 2E6ZA 2N9GA 1V29B 2K4YA 4NUEA 4E7HA 3QZSA 3BY7A 1TH7A 4A54A 4MZPA 5EQ1A 4TU4A 5FU6C 4M77E 4PKCC 4Z02A 5DLXA 2EQMA 3CCRA 2QEXA 2E7OA 3U5MA 1PSFA 2LNVA 5D24A 2DD4A 4QR3A 5E9MA 3G4ST 2XK0A 2NXBA 3VUZA 1YI2T 3UWNA 4WIVA 1OZ2A 3OS0A 4M75E 5LJ5f 4PJOD 4C92D 4YBMA 3TEEA 4M7DG 3M4GA 4QVZA 3V8JA 4FSXA 5GMKj 4M75F 4Y91A 3A8GB 1N9SA 3CCET 5GAOq 2FL7A 3OYEA 5CU8A 1SSFA 4JRIA 3MXFA 3PIPA 4O71A 3NXBA 3OYGA 4YBTA 2CGHA 4JJNK 2KK4A 3NTHA 2QQSA 5F60A 3RUXA 5GMKi 5LKTA 3UV2A 5D3PA 2G4AA 4HXMA 1QVPA 3MQMA 3MEVA 4XU3A 4QSTA 5LL6S 3P1DA 3FEOA 2E70A 1N27A 4QSQA 5DM7R 1WQWA 2DD5A 2I8NA 4ZC9A 3LH0A 3JCMf 5GANg 1X0JA 3OS2A 5F61A 4LYSA 4Z6IA 4YADA 2E7NA 3GNFB 5CQ8A 3VUBA 2XD0A 4LYWA 3OB9A 4QEVA 1KD1U 5LUUA 3EFSA 4CI0C 4DONA 5GAN4 3O35A 4P5NA 5E0RA 4UYHA 4O70A 1KQSA 1Q82C 2RFJA 3LGFA 4OVAA 1MGQA 1M1GA 5FRNA 4IOOA 5COIA 4QUUA 1OZ3A 5D3LA 3ASKA 4NL3A 2MWOA 1UGQB 1VQOT 2FB7A 5E9LA 3CD6T 1D3BB 1D3BA 2OTLT 4EMGA 5DYUA 2D9EA 5HENA 5KTWA 1ZBXA 3CBPA 1X6OA 2D6FA 1I4K1 5EWHA 4C5EA 4FL6A 2KSSA 5CUEA 5LVRA 4UYFB 4MEQA 4WF2A 1N6AA 4J7FA 4MDWA 3IU5A 5ENEA 1NZ9A 2ZCFB 3JCMQ 4NL2A 4J83A 5G4RA 5GAOn 5CRZA 5CFWA 3MP8A 2QQAA 2RO1A 4JDSA 5HQ6A 1VQ4A 5LJ3f 4BACA 1K8AU 5I29A 1Q86U 2EJ9A 4F3IA 5CIUA 3SD4A 4NRAA 4PLLA 1VQMT 3DLLA 4HCCA 5E3GA 2F69A 1RL2A 2I2LA 4ZTFA 4NRCA 3QZVA 1N8RU 5FE7A 1UB4A 5DYCA 5F63A 1VQPT 5EU1A 1N8RC 2O4XB 1FWZA 2O4XA 4HXRA 5LJ1A 2DATA 2RNXA 3MO8A 1YJWA 2XU8A 1M90C 1Y07A 4QNSA 4C8QG 2RM4A 1YITA 3VV0A 4E7KA 2RHXA 3G0JA 4OGIA 4M7AB 4GLKA 4OMFB 1VQ9T 4M7AA 1M4ZA 4O76A 1HXDA 5FE2A 3M59A 1M1KC 3Q2EA 4FM4B 5IBNA 1DJ7B 4YY6A 4ZGJB 4M7AG 5DKCA 2R10A 1LNXA 4IORA 5DLQE 2DVSA 4ZGEB 2K2VA 4UIVA 2KTBB 1YJ9T 2DVRA 2E1HA 5CKDA 4NR9A 2RHIA 3CCSA 2E64A 4IURA 5F62A 2L89A 2DKGA 3OS5A 3MULA 4TZ2A 1OYXA 5EICA 4X9DA 5FE5A 4OB1B 4FT2A 3RKXA 2RI2A 3BDLA 4MR4A 4NUDA 2DIGA 2MJVB 1M9SA 2CS7A 1O9SA 1UGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9G A;  2EQK A;  5D25 A;  2R57 A;  3MEW A;  5EVA A;  5HQ7 A;  3PMI A;  4Z6H A;  5I40 A;  5EPS A;  2WAC A;  5KE3 A;  4NS5 A;  5F2P A;  4A4F A;  5CUG A;  4CUT A;  5C85 A;  4QB3 A;  4EDU A;  5L8T A;  4HXK A;  5II2 A;  3KUF A;  1OI1 A;  4E7J A;  5CRM A;  2DIQ A;  4NR7 A;  3QJ6 A;  4UIZ A;  4A9L A;  1WJR A;  4B9W A;  3P1E A;  4HXS A;  4O7F A;  4C66 A;  4X34 A;  2EKO A;  5EP7 A;  5CQ5 A;  5KTU A;  5A83 A;  2X4X A;  4O72 A;  5FH8 A;  3ZYU A;  4YK0 A;  5HRX A;  3OYN A;  4Q0O A;  5A5Q A;  4N3W A;  4LDF A;  4N4I A;  4QC3 A;  4PCE A;  5CQA A;  2BKD N;  3QII A;  2YEL A;  3S92 A;  5KU3 A;  5FRO A;  2RJF A;  5CUD A;  4J0R A;  4YYM A;  3O37 A;  5CS8 A;  2RHY A;  1XNI A;  3U5K A;  3OYA A;  4UIW A;  5KO4 A;  4Z93 A;  4TT6 A;  3JVK A;  2GF7 A;  3L2Q A;  4ZTJ A;  4UC4 A;  3MB4 A;  3DB3 A;  5M9O A;  4BW1 A;  2DAQ A;  2D9T A;  2E6N A;  5IN1 A;  5C8G A;  3L2U A;  4OUF A;  4PL6 A;  5HEM A;  3O36 A;  5J39 A;  4NR8 A;  5LJ2 A;  4N4H A;  2G3R A;  5KHM A;  3C4S A;  4O7E A;  5CGP A;  5A5O A;  2GRC A;  3DB4 A;  4OGJ A;  3L42 A;  3ZEH A;  5II1 A;  4BDZ A;  4CL9 A;  4O74 A;  5KCO A;  3FC3 A;  4N4F A;  3OQ5 A;  5CQT A;  4GPJ A;  5HCL A;  5FE4 A;  1WUG A;  3OYL A;  4BE1 A;  2RI3 A;  4NR4 A;  4C5G A;  2YRV A;  3AQA A;  4QUT A;  4CFL A;  5TCM A;  5IGK A;  4J0S A;  2MWP A;  4XYA A;  4C5I A;  2LCC A;  4CRI A;  5EI4 A;  1JM4 B;  4UIU A;  2PQW A;  5E74 A;  2RJC A;  5DFC A;  5EPR A;  4LYI A;  5CP5 A;  2DVV A;  5EK9 A;  3HMH A;  3OYM A;  4L59 A;  3P1F A;  5EV9 A;  4YH3 A;  5LKX A;  5HM0 A;  5DYX A;  4QYL A;  3P8H A;  4NYW A;  2WP2 A;  3NTI A;  4TQN A;  5DFD A;  5L97 A;  4CUP A;  3DLM A;  5CQ3 A;  3MEU A;  3O33 A;  5IGN A;  3OY9 A;  1WGS A;  4TT2 A;  4J1P A;  2IG0 A;  4KCX A;  4XUA A;  5CTL A;  4UIT A;  2F6N A;  2LDM A;  4MEP A;  4MR6 A;  2GFU A;  5K29 A;  5EWW A;  5KTX A;  2X35 A;  4NQN A;  5CUA A;  1RI0 A;  3OYF A;  4Q5W A;  5FH7 A;  4MR3 A;  4TT4 A;  2HQE A;  3FDR A;  4BD3 A;  3UVY A;  5C7N A;  5D3S A;  4YYH A;  4BE2 A;  4HXO A;  5ENF A;  3K2J A;  2YW5 A;  4UIX A;  4II1 A;  5FFW A;  5CUB A;  4YAB A;  3S3M A;  5CPE A;  4A9I A;  3LQH A;  5FB0 A;  2LVM A;  2N9G A;  5H85 A;  5D0C A;  2L8D A;  4FU6 A;  4NUE A;  5F1H A;  4E7H A;  4ZQL A;  3QZS A;  2R5A A;  2RI7 A;  3PFS A;  5HQ5 A;  1WUM A;  3MB3 A;  5EQ1 A;  4BJX A;  5BT5 A;  5FG6 A;  2YQD A;  1ZS5 A;  4TU4 A;  3OYD A;  5CUC A;  5H1U A;  5LKZ A;  3P1C A;  2CKK A;  3P8D A;  2WP1 A;  2YDW A;  3LJW A;  5I7Y A;  1WJS A;  2EQJ A;  4Z02 A;  5D3T A;  3P5O A;  3O8V A;  5DLX A;  4IR6 A;  5FE1 A;  2EQM A;  2B8A A;  3AAD A;  3MUK A;  5LJ0 A;  2E7O A;  3U5M A;  4A9J A;  2HQX A;  4GY5 A;  3S91 A;  5D24 A;  3LYI A;  3Q1J A;  4QR3 A;  5E9M A;  5I83 A;  2XK0 A;  2NXB A;  5F1L A;  3LGL A;  5ETB A;  5FE6 A;  4BW3 A;  4YYK A;  3UWN A;  2DVQ A;  4WIV A;  1OZ2 A;  3OS0 A;  5G4S A;  2D82 A;  3UV4 A;  5CQ4 A;  4LC2 A;  4BE0 A;  5IG6 A;  4YBM A;  3JVJ A;  5JWM A;  1JSP B;  5EM3 A;  2RNY A;  4KV1 A;  4QEU A;  5DX4 A;  4Z1Q A;  3S6W A;  4QVZ A;  4A4H A;  3HME A;  3D7C A;  5ENC A;  3LQI A;  2NLU A;  4UYF A;  3LQJ A;  5ENH A;  5CQ6 A;  4LR6 A;  5J0D A;  3OYE A;  5E3D A;  5CU8 A;  1SSF A;  4IUQ A;  3MXF A;  5FE3 A;  4O71 A;  4LRG A;  4QSW A;  5HRW A;  1MHN A;  3NXB A;  4MEN A;  5D6Y A;  4PTB A;  3OYG A;  4YBT A;  4KV4 A;  4QQ6 A;  5FG5 A;  2LTO A;  2R5M A;  4TU6 A;  4UIY A;  5HLS A;  3NTH A;  3L2R A;  4IKF A;  2QQS A;  5F60 A;  5FFY A;  3MP1 A;  4A9N A;  3U5J A;  4E7I A;  4HCZ A;  5LKT A;  4B9X A;  5KE2 A;  4XY9 A;  5F3A A;  5L8U A;  4BW4 A;  1G5V A;  5C0M A;  5A82 A;  1WJQ A;  2YYN A;  4IOQ A;  5D3P A;  4QYD A;  5A5N A;  2G4A A;  3UVD A;  3UV2 A;  4YYJ A;  4HXM A;  3PMT A;  5D3H A;  4PS5 A;  3MQM A;  3MEV A;  5I7X A;  4QST A;  4MEO A;  2EFI A;  3P1D A;  5D6W A;  2R58 A;  3FEO A;  2K3X A;  5C6S A;  4HXL A;  4QSQ A;  1N27 A;  2L5E A;  5D7X A;  4ZW1 A;  2I8N A;  4ZC9 A;  5HJC A;  5EWV A;  3LH0 A;  4BDY A;  2H60 A;  2JZ2 A;  3OYB A;  4A9O A;  3QZT A;  1X0J A;  4YYD A;  3OS2 A;  5F61 A;  4LYS A;  3MEA A;  4Z6I A;  5FDZ A;  3H8Z A;  4Z1S A;  5C89 A;  2RI5 A;  4YAD A;  2E7N A;  2RNW A;  5AME A;  4LD6 A;  3I3J A;  2X4Y A;  4YYN A;  5D3R A;  5H1V A;  2YEK A;  4NYX A;  3U5L A;  5DLZ A;  4AKN A;  4HBW A;  2E5Q A;  5CQ8 A;  5ACY A;  4LYW A;  2RHU A;  3FKM X;  4WHU A;  3OB9 A;  4QEV A;  2L84 A;  2LSP B;  3GG3 A;  4LZR A;  3JVL A;  5AD3 A;  5LUU A;  1E6I A;  4YC9 A;  3IU6 A;  4DON A;  5AD2 A;  5EPB A;  3Q2F A;  5FE8 A;  4UYG A;  5BT4 A;  2JTF A;  5FRM A;  3H6Z A;  5ENB A;  4CLB A;  4XUB A;  3LLR A;  3O35 A;  4O77 A;  5E0R A;  3LXJ A;  4YAX A;  3OYJ A;  4UYH A;  5E9I A;  3OA6 A;  4YAT A;  4O70 A;  3JVM A;  5E9K A;  4A9K A;  2RFJ A;  3LGF A;  4OVA A;  5EWD A;  2BUD A;  5E73 A;  4A4E A;  4QEW A;  3UW9 A;  4Q0N A;  3DWY A;  1N72 A;  5DKH A;  5E7D A;  5L99 A;  3M9Q A;  3NTK A;  3OYI A;  5FRN A;  4YBS A;  1KHC A;  5ENI A;  4IOO A;  5KH6 A;  3OYK A;  4QR5 A;  3FLG A;  5COI A;  4A4G A;  4FLP A;  4QUU A;  5CY9 A;  1OZ3 A;  5D3L A;  5TB6 A;  3ASK A;  2MWO A;  4NR5 A;  4QQG A;  4LZ2 A;  4O7B A;  4HBX A;  4WHW A;  4C5H A;  3SVG A;  4IR3 A;  4YH4 A;  4HBY A;  5E9L A;  4TZ8 A;  5FB1 A;  5HFQ A;  5HEL A;  1H3Z A;  3MET A;  3U5N A;  4O7C A;  4QY4 A;  5DYU A;  2D9E A;  2XDP A;  5HEN A;  4ALH A;  2L85 A;  5KTW A;  3UT1 A;  4O75 A;  4YYI A;  5E9Y A;  2OO1 A;  5A85 A;  3EAE A;  5CZG A;  4A9H A;  4CFK A;  5EWH A;  3S3N A;  4C5E A;  3U5O A;  4FL6 A;  5IAY A;  5CUE A;  4NXJ A;  5LVR A;  4UYF B;  2OUO A;  3OMG A;  4MEQ A;  4CUS A;  5A5P A;  3G0L A;  4QSX A;  5CQ7 A;  4BHW A;  4O78 A;  5A5R A;  4TYL A;  5HFR A;  5FE9 A;  4IUV A;  3IU5 A;  5ENE A;  2FHD A;  4HBV A;  2M0O A;  2K3Y A;  4QBM A;  3S3O A;  5G4R A;  2BIV A;  5CRZ A;  5CFW A;  5EIS A;  3MP8 A;  2RO1 A;  5FG4 A;  2I7K A;  5I80 A;  5EGU A;  2RS9 B;  2F6J A;  5C4Q A;  5HQ6 A;  3CEY A;  3QBY A;  2E3K A;  5D26 A;  4A9E A;  3L2W A;  5I88 A;  3OS1 A;  4BAC A;  5DBM A;  5H1T A;  5I29 A;  2R0S A;  4ALG A;  5C87 A;  4F3I A;  5CIU A;  3SD4 A;  4NRA A;  5FH6 A;  4C67 A;  4PLL A;  3OYC A;  2RHZ A;  3UV5 A;  4CUR A;  4IUP A;  4BW2 A;  5AMF A;  5E3G A;  2YEM A;  5FE0 A;  4CUU A;  4UYE A;  5DW2 A;  4YYG A;  5D3J A;  4ZTF A;  1F68 A;  4YY4 A;  4NRC A;  5L98 A;  3SVF A;  3QZV A;  3PNW C;  4Y03 A;  5FE7 A;  4PKL A;  5DY7 A;  5DYC A;  4X2I A;  2OSS A;  5F63 A;  5EA1 A;  4QSR A;  5FFV A;  5EU1 A;  5I1Q A;  2RJD A;  5F36 A;  2O4X B;  4HXN A;  5A5S A;  2O4X A;  5BT3 A;  4HXR A;  5LJ1 A;  1EQF A;  2DAT A;  4LZS A;  3SVH A;  4MR5 A;  2RJE A;  2RNX A;  3MO8 A;  5LKU A;  3OYH A;  5DW1 A;  5HRV A;  5LVQ A;  5FBX A;  2M16 A;  5E9V A;  3LX7 A;  3MP6 A;  4QNS A;  4IR4 A;  4QC1 A;  5L96 A;  3E9F A;  4A9M A;  4E7K A;  3U5P A;  4HXP A;  2RHX A;  3QKJ A;  3G0J A;  2RO0 A;  3DAI A;  4OGI A;  4IUU A;  3ONI A;  4QSU A;  5A81 A;  4NYV A;  4O76 A;  4PY6 A;  4IUT A;  5D3N A;  4NQM A;  4TTE A;  5FE2 A;  2R0V A;  4QSS A;  5KCH A;  3Q2E A;  4QZS A;  4TS8 A;  4A9F A;  5I86 A;  4QSV A;  2P0K A;  5IBN A;  2DWW A;  3UVW A;  4YY6 A;  5DKD A;  4QW2 A;  5DKC A;  2R10 A;  4QSP A;  3RCW A;  5A7C A;  2VYT A;  2QQR A;  4IOR A;  5EWC A;  4PLI A;  2DVS A;  3UVX A;  5IGM A;  2FSA A;  5F25 A;  2R0Y A;  3O34 A;  5I89 A;  4UIV A;  5ENJ A;  2KTB B;  2DKW A;  4NUC A;  4PCI A;  5F5Z A;  2DVR A;  5DYA A;  4RG2 A;  5D6X A;  5JI8 A;  2F5K A;  4NR9 A;  2LRQ A;  2RHI A;  4IR5 A;  4CUQ A;  4RVR A;  4XY8 A;  4IUR A;  3F70 A;  3L2V A;  5F62 A;  5IID A;  2L3R A;  5J26 A;  4E96 A;  2EQU A;  3GOX A;  5ENG A;  2GFA A;  2X4W A;  2L89 A;  4NRB A;  3MUL A;  4TZ2 A;  1OYX A;  5EIC A;  3ME9 A;  5FE5 A;  3OMC A;  4QQD A;  4O7A A;  5DFB A;  4N4G A;  5ETD A;  5IGL A;  4E7L A;  4J3I A;  2RI2 A;  4QR4 A;  3BDL A;  4MR4 A;  4NUD A;  2DIG A;  2MJV B;  4NR6 A;  2M1H A;  3TLP A;  3HMF A;  4UYD A; 
#chains in the Genus database with same CATH topology
 1X75 C;  4ZNX A;  1VQ6 T;  4LXC A;  4A63 B;  4Z89 A;  5D25 A;  1NE8 A;  2DL8 A;  2KY9 A;  3ERR A;  5EVA A;  1R77 A;  4XAX B;  1NPP A;  4Z6H A;  2QG9 B;  2DL7 A;  2EWN A;  2HKN A;  5EPS A;  3I9Q A;  3MPU B;  4NS5 A;  4J9E A;  5KE3 A;  1YWO A;  5CUG A;  1NYF A;  2NWM A;  1D1A A;  5C85 A;  1B07 A;  4QB3 A;  4BY6 B;  2LMJ A;  4EDU A;  4M7D D;  5GAM e;  4HXK A;  3CCU A;  5GAN j;  2F2W A;  2M51 A;  3KUF A;  4NR7 A;  4M78 C;  3JB9 G;  3QJ6 A;  1VIF A;  1Y7X A;  2ESW A;  2C0O A;  2XMF A;  2EKO A;  5EP7 A;  5CQ5 A;  1WIE A;  5A83 A;  2V1Q A;  2GQI A;  3ZYU A;  2XG8 D;  3EHQ A;  5GAN 5;  2CT4 A;  3MJX A;  3A8O B;  4BB7 A;  3NHN A;  4PJO B;  4PJO A;  4C92 B;  4C92 A;  3OYN A;  5A5Q A;  4N3W A;  4LDF A;  4N4I A;  5CQA A;  4PCE A;  3G71 T;  2YEL A;  5IHI A;  5CUD A;  1W2B A;  2GGR A;  5FU7 C;  2RHY A;  3U5K A;  4Z93 A;  4TT6 A;  2VGN A;  3G6E A;  1H8K A;  3R6N A;  5IN1 A;  4LN2 A;  1BI2 A;  4NR8 A;  5J39 A;  5KHM A;  2XDB A;  1ZA2 B;  5LJ5 e;  5II1 A;  4BDZ A;  3E2U A;  1UFF A;  2NYS A;  2QA4 A;  5I22 A;  5FE4 A;  1WUG A;  4OB3 B;  1M3A A;  1S1N A;  5GAN 3;  2JM9 A;  2YRV A;  5A0D A;  3I56 Q;  2OTJ T;  2EYW A;  2MWP A;  4M7D F;  4CRI A;  3QWY A;  1NM7 A;  5HY6 A;  3QDR B;  3QZ5 B;  1OEB A;  4AKH A;  3EH1 A;  4KUL A;  4J9B A;  1M2O A;  2DER A;  2FRW A;  3CPF A;  1NJI C;  2ZAE A;  1ZQ1 A;  5CKH A;  3DLM A;  4JJC A;  2V8K A;  1PUO A;  3OY9 A;  1VQK A;  2QAZ A;  4OGE A;  3VS2 A;  2VUB A;  2HZY A;  4F04 B;  2LCS A;  2LDM A;  5AYF A;  2DK3 A;  2CZ0 B;  2Y4X A;  2DRK A;  5K29 A;  2YLB A;  1VQL Q;  5GAM d;  1U5S A;  1RI0 A;  4Q5W A;  2VXF A;  4TT4 A;  3LWI A;  3AHU A;  1SRM A;  3UVY A;  1VYT A;  3D7S B;  1UDL A;  1WHK A;  4BE2 A;  3GP8 A;  2YW5 A;  5CUB A;  3TCJ A;  1VQ4 T;  4YAB A;  2JT4 A;  1TUD A;  1UE9 A;  2EBP A;  2JVV A;  3M5A A;  5CPE A;  4A9I A;  2JUF A;  1M30 A;  4A53 A;  3DKM A;  1EIF A;  1YIJ Q;  2DNU A;  3WVE B;  5FB0 A;  1IGQ A;  5H85 A;  4BY6 C;  5D0C A;  1VQ5 A;  3QDF A;  4FU6 A;  4ZQL A;  2RNA A;  5CVI A;  1AT1 B;  3TU4 K;  3MB3 A;  3SDZ A;  2YQD A;  1QP3 A;  4FW2 A;  5LKZ A;  4RTT A;  3P8D A;  4AG2 C;  2WP1 A;  3LJW A;  5D3T A;  3P5O A;  4IR6 A;  5CQY A;  5LJ5 d;  3A5Z B;  1Q82 R;  2EJN A;  5LJ0 A;  1LCK A;  2HQX A;  3S91 A;  3I35 A;  4C92 C;  1I07 A;  1UTI A;  3LYI A;  4J6Y A;  3Q1J A;  4JUV A;  4OML A;  5F1L A;  3LGL A;  5ETB A;  1VUB A;  2KAF A;  4YYK A;  1Y57 A;  3ZBD A;  5FU6 B;  2RK2 A;  1JJ2 S;  1YNZ A;  1EZZ B;  2E41 A;  3A8M B;  5CQ4 A;  1ZHI A;  4BE0 A;  1QCF A;  3FIF A;  1QW1 A;  1WQ7 A;  1JSP B;  2RNY A;  4KV1 A;  2EVR A;  5DX4 A;  1YIT T;  1YJN Q;  4M78 D;  1AZG B;  3D7C A;  2ROT A;  5ENC A;  2NLU A;  2PVO B;  1KC8 U;  4KBM B;  4LDY A;  1UHF A;  3LQJ A;  2D8H A;  5HK3 A;  4LDX A;  4LR6 A;  3FRN A;  2H8H A;  5E3D A;  1VQN T;  4OF1 A;  4QSW A;  1R8O B;  3UA6 A;  2YSQ A;  5D6Y A;  1QVG A;  4PTB A;  3CC4 A;  3CCL T;  3FJ5 A;  1NBE B;  2X3W D;  2LTO A;  4TU6 A;  2AK5 A;  3L2R A;  4HA8 A;  5FFY A;  2IVW A;  3SB2 A;  3G4S Q;  2XDD A;  4B9X A;  4AT1 B;  1FMK A;  5C0M A;  1YI2 Q;  4YYJ A;  3JCM d;  1WXU A;  5I7X A;  1C1A A;  2BZX A;  3QPH A;  4XTZ A;  4HT8 A;  1KSW A;  3HTR A;  1BCM A;  2K3X A;  1PRM C;  4HXL A;  2NUT B;  2NUT A;  3CCE Q;  2H60 A;  5GAO m;  1NEB A;  5L8R E;  3QZT A;  4YYD A;  5LJ3 e;  1OX9 A;  3MEA A;  1QVF A;  5FDZ A;  2RI5 A;  4M77 D;  1MMA A;  1N8R R;  2RQT A;  2V26 A;  3OW2 P;  5H1V A;  2HL5 C;  3CMA T;  2L3P A;  2ATC B;  2BZ8 A;  2PVD B;  3CC2 A;  3FKM X;  4WHU A;  2AHJ B;  3KBG A;  3NGP A;  1YP5 A;  1E6G A;  1M90 R;  4M75 D;  2HSP A;  3CCQ A;  1P92 A;  5EPB A;  3Q2F A;  3KXT A;  1PD0 A;  1MMN A;  3H6Z A;  4M4Z A;  4DEX A;  4CLB A;  4XUB A;  1AOJ A;  2CP2 A;  3LXJ A;  2JMC A;  3PTA A;  3OA6 A;  2DET A;  4YAT A;  1HJD A;  4C8Q E;  1BKB A;  2DYB A;  2ZZD A;  1M1K R;  2EYX A;  1FX7 A;  2JJ9 A;  4QEW A;  4Q0N A;  2J06 A;  3DWY A;  3NTK A;  5E7D A;  3OYI A;  1D1C A;  4C8Q F;  1KHC A;  4QR5 A;  1D0Z A;  2FPE A;  5HKC A;  2DXU A;  4HBX A;  4M7A E;  3SVG A;  4YH4 A;  4ZGD B;  4HBY A;  1FYN A;  2QA4 T;  5FB1 A;  5HFQ A;  4M77 F;  5HEL A;  2D0N A;  3REB B;  1I0C A;  3MET A;  4J9G A;  2XDP A;  4MZT A;  3JB9 D;  4E7S A;  2L85 A;  2X9H A;  3JCM J;  4O75 A;  4YYI A;  2KEA A;  2AZS A;  3VU3 C;  3WXM B;  1IRX A;  3A8L B;  5A85 A;  1TUC A;  4A9H A;  2QXF A;  3S3N A;  4F7U B;  4F7U A;  5I2S A;  2WSE E;  1KHI A;  2XKO C;  3GNG A;  3O5Z A;  2OUO A;  3OMG A;  1BU1 A;  1CKB A;  2I0N A;  1G3T A;  5GMK m;  2EGC A;  4ANJ A;  5CKF A;  5HFR A;  5LJ3 d;  1S72 T;  2FHD A;  4QBM A;  3RNJ A;  3CCJ A;  1BI0 A;  1GCQ C;  2DA9 A;  3JCM h;  1C0M A;  2I7K A;  4JS5 A;  1B3Q A;  5D7U A;  3QBY A;  2E3K A;  4A9E A;  1VQO Q;  3L2W A;  4OMQ A;  1YCS B;  2R0S A;  5C87 A;  2WSC E;  3CD6 Q;  1VYV A;  4HCK A;  2OTL Q;  1UHC A;  2GCX A;  3VKI A;  3CXC P;  5IH2 A;  2LJ3 A;  4BUG A;  4E2F B;  4BW2 A;  2SRC A;  2EJG A;  1OU9 A;  1GBQ A;  2ECZ A;  5DW2 A;  3HRS A;  3I55 A;  3VKH A;  3L1A A;  4JLI A;  3V7R A;  3IQL A;  3SVF A;  2IIM A;  1YFN A;  3P8B B;  5A0G A;  2FZC B;  4X2I A;  2O9V A;  5EA1 A;  1LVK A;  5FFV A;  3JB9 F;  2RJD A;  2DJZ A;  5F36 A;  3E1S A;  3X24 B;  4HXN A;  5A5S A;  3UPU A;  5BT3 A;  3RKW A;  2QDY B;  2HSE B;  3HPW A;  2VWF A;  3OYH A;  5DW1 A;  5HRV A;  1GBR A;  1J3T A;  5FBX A;  4QVC A;  3LX7 A;  3MP6 A;  3CCM T;  5L96 A;  4ELZ C;  1ZUK A;  2G6F X;  3U5P A;  2LC4 A;  3DAI A;  4TVR A;  1VQM Q;  3NPF A;  3OBW A;  2DIL A;  3BDU A;  4PY6 A;  1VIE A;  4IUT A;  3HRU A;  2KRN A;  4C0D C;  3X28 B;  4PJM A;  1OX8 A;  4QZS A;  1I8F A;  5I86 A;  4WCI A;  2LQ8 A;  2DWW A;  5DKD A;  2PU9 B;  4QSP A;  3JAM E;  1NJI R;  1SG5 A;  4PLI A;  1V76 A;  1Q82 U;  2DZ9 A;  2R0Y A;  3J80 E;  3CME T;  4ESR A;  5ENJ A;  5DYA A;  4RG2 A;  2SEM A;  4CC3 A;  2F5K A;  3QO3 A;  4IR5 A;  1VQ7 Q;  4HCB A;  1D0X A;  3F70 A;  3L2V A;  1Q81 C;  4XTY A;  4E6R A;  5J26 A;  4E96 A;  4AFS C;  3ME9 A;  3JRZ A;  3CCV A;  4N4G A;  4DOW A;  1D09 B;  2CDT A;  2MK5 A;  5IGL A;  3FB9 A;  1VQ9 Q;  1WPY A;  2BTT A;  4NR6 A;  1QQJ A;  3HRT A;  4M7D C;  3E9G A;  4R0K A;  2EQK A;  2R57 A;  1JO8 A;  3J81 E;  2K79 A;  5I40 A;  2P4R A;  4A4F A;  4CUT A;  1HSQ A;  2MF2 A;  1WYX A;  1D0Y A;  3H9N A;  1G8X A;  1YJ9 Q;  3G7Z A;  1WDX A;  5CRM A;  3BFM A;  4D6W A;  4UIZ A;  1YHQ A;  1W4S A;  1WJR A;  4B9W A;  2HNI A;  4MZM A;  1KJW A;  4C66 A;  2X4X A;  2VVK A;  4O72 A;  2K9G A;  1VQ8 T;  2KRM A;  4XU1 A;  1KQS S;  1VA7 A;  3L2Z A;  4Q0O A;  2D8J A;  3QII A;  3S92 A;  4M78 B;  4M78 A;  4J0R A;  1G3S A;  2DX1 A;  1GL5 A;  4UIW A;  1IRE B;  1VQ6 Q;  2HBP A;  2QQB A;  5KYW B;  3L2Q A;  5KYW A;  3MB4 A;  3DB3 A;  2DAQ A;  3HL8 A;  2CZ7 B;  2DMO A;  2E6N A;  4C0F A;  4OUF A;  1ZUU A;  4JRQ A;  3M54 A;  5IXF A;  3M0S A;  5CGP A;  4OGJ A;  2K6D A;  5FU7 B;  1QWF A;  3OQ5 A;  4GPJ A;  2A3L A;  1PWT A;  2RI3 A;  3X25 B;  4AI6 A;  1M90 U;  3AQA A;  4QUT A;  4J0S A;  1KQ1 A;  5IT9 E;  4XYA A;  2IPO B;  4C5I A;  2ZPF B;  1JM4 B;  2DLP A;  3CCR T;  2RJC A;  3D1D A;  5E74 A;  2PUK B;  4J8O A;  2QEX T;  1BI1 A;  4LYI A;  5CP5 A;  5EK9 A;  1CSK A;  3OYM A;  3G71 Q;  3P1F A;  2YRD A;  4J6X A;  5LKX A;  3VS4 A;  4QYL A;  8ATC B;  2JTE A;  2P84 A;  1M1K U;  2CUD A;  2AIR B;  2KXD A;  5DFD A;  1LOJ A;  4CUP A;  5CQ3 A;  3QWX X;  3O33 A;  1NG2 A;  2LX9 A;  2QQ9 A;  2O9S A;  1VOM A;  2OAW A;  1WGS A;  3I56 A;  3M0R A;  1UGR B;  5CTL A;  2FPD A;  5J3B A;  4MEP A;  2GFU A;  5CAI A;  4JS4 A;  5KTX A;  4O6J A;  4NQN A;  5CO7 A;  4CC2 A;  3JCM P;  5FH7 A;  2HQE A;  4X9C A;  1IZ6 A;  4A4K A;  1PD1 A;  1RAD B;  2OTJ Q;  2BE7 D;  3M56 A;  4VUB A;  2P0Q A;  3C94 A;  3I5R A;  5ENF A;  1YWP A;  2JMA A;  3K2J A;  4M75 B;  4M75 A;  3NMZ C;  4ORZ A;  1M5Q 1;  5HCK A;  5FWC A;  5GAN 8;  2K57 A;  2LVM A;  1VQL A;  1IO6 A;  2FG0 A;  2R5A A;  2RI7 A;  3PFS A;  1WUM A;  5BT5 A;  1GXI E;  3LWH A;  5GMK l;  1ZS5 A;  3OYD A;  1ACM B;  4C0G A;  5H1U A;  4EPC A;  4FSS A;  4E47 A;  2FEI A;  5GAN f;  5I7Y A;  1WJS A;  2RPN A;  2EQJ A;  5FE1 A;  3AAD A;  3MUK A;  5A0L A;  3CPW S;  1YIJ A;  3QYG B;  3LH5 A;  5FE6 A;  1E7O A;  2DVQ A;  4J9F A;  2ZPI B;  4HVV A;  2LT4 A;  4LC2 A;  3GIB A;  2DXT A;  4NOY A;  1VQ4 Q;  4RCC A;  1RAH B;  5JWM A;  3ZL7 C;  4QEU A;  1WHG A;  4LDU A;  3HME A;  3ZFJ A;  3OW2 A;  2L0A A;  1GFC A;  4JPB W;  3VYH B;  1XJW B;  5EG2 A;  2D1X A;  2FYK A;  4IUQ A;  1C6V X;  4PJO G;  4C92 G;  1AZE A;  1MHN A;  4LRG A;  2AT1 B;  2MMP A;  4MEN A;  3QZ9 B;  4KV4 A;  1PRL C;  4DQ2 A;  2FZK B;  5GMK e;  5HLS A;  4IKF A;  3EH2 A;  3R6O A;  3MP1 A;  4A9N A;  3U5J A;  4E7I A;  4AMC A;  1JRI A;  1YJN A;  4RTU A;  5L8U A;  1SSH A;  2ED0 A;  4BW4 A;  2M0Y A;  1UEC A;  2COZ A;  5A82 A;  1WJQ A;  2YYN A;  5GAM g;  4IOQ A;  2A7Y A;  4QYD A;  5A5N A;  3H0F A;  1T3S A;  3RR6 A;  4C8Q C;  3RES A;  2YT6 A;  4PS5 A;  4MEO A;  3UF4 A;  5D6W A;  3MHX A;  4RTW A;  2R58 A;  4F7U E;  1YIT Q;  3GPL A;  3GLX A;  3KFV A;  2RK1 A;  2QTV A;  5D7X A;  2GQV A;  4M77 C;  1NJI U;  3JV3 A;  2HD0 A;  1G2B A;  2M9U A;  3BW1 A;  4LDW A;  1MMD A;  2JZ2 A;  3G4S A;  1RLQ C;  4A9O A;  1MV0 B;  2K5I A;  1VQN Q;  1IB8 A;  1YI2 A;  3VJP A;  2XI9 A;  3H8Z A;  4Z1S A;  5C89 A;  3CCL Q;  2CP3 A;  2RNW A;  2DZC A;  4LD6 A;  3I3J A;  2DO3 A;  2X4Y A;  3CC7 A;  1W2B S;  2YEK A;  4M75 C;  3U5L A;  5DLZ A;  4J7I A;  2E5Q A;  5ACY A;  2HMA A;  2YRC A;  5CKB A;  2RHU A;  3CCE A;  1YN8 A;  2Y4Y A;  3HFO A;  3GG3 A;  4LZR A;  1G3Y A;  3JVL A;  1NEG A;  1ZA1 B;  4RG8 A;  2HDA A;  1E6I A;  4YC9 A;  3IU6 A;  1Q7Y C;  1JBM A;  1IHW A;  1K73 C;  4UYG A;  2DXC A;  4EMK C;  2COY A;  2J6K A;  1GCP A;  2JNG A;  4JZ4 A;  5FRM A;  2ED1 A;  4YAX A;  3OYJ A;  3V7C A;  2DPP B;  1NLO C;  2WSF E;  3QJY A;  5E9K A;  3FJP A;  5E73 A;  2F5T X;  1A0N B;  2HAX A;  4A4E A;  3UW9 A;  4AKG A;  1RAF B;  1KQ2 A;  5DKH A;  1N72 A;  2EIF A;  2F2X A;  1TXQ A;  3CXC A;  5CR2 A;  1NYG A;  2L5Q A;  3EFO B;  3UDC A;  2K5F A;  3EFO A;  3CMA Q;  4A4G A;  4KH1 B;  1M3B A;  1RAE B;  2KQW A;  2RQW A;  4RTZ A;  4QT7 A;  4JRK A;  4NR5 A;  2W10 A;  4IR3 A;  4R55 A;  3CBO A;  2JOY A;  4DA4 A;  3PT9 A;  4FYX B;  1Q81 R;  1H3Z A;  2DE0 X;  4O7C A;  3CBM A;  2AKL A;  3M0Q A;  3HP9 A;  1YJW T;  3JCM g;  2DBM A;  5E9Y A;  3V8L A;  4OB2 B;  3EAE A;  4J6W A;  3MCA B;  3M0T A;  4CUS A;  1HK9 A;  2E3H A;  4O78 A;  5A5R A;  2JW4 A;  4HBV A;  2KYM A;  2M0O A;  3EG0 A;  3S3O A;  1Y0M A;  1AEY A;  1BBZ A;  2BIV A;  1V1C A;  2YWW A;  5EIS A;  1RAA B;  2A0F B;  2XHC A;  5I80 A;  5EGU A;  5C4Q A;  3JCM b;  3CEY A;  1QLY A;  1WLP B;  1WNL A;  2E5K A;  2XID A;  4J9H A;  1UG1 A;  5H1T A;  4JZ3 A;  1IXD A;  4ALG A;  1D1B A;  2RHZ A;  3UV5 A;  4CUR A;  1T0J A;  3CCS T;  1U3O A;  4BI4 A;  4GLM A;  4RKU E;  3X26 B;  2YEM A;  5FE0 A;  1GCQ A;  2EAY A;  4UYE A;  1Y71 A;  1PKT A;  4GBQ A;  1F68 A;  4YY4 A;  3PNW C;  2LQK A;  3NFC A;  4BI3 A;  4PKL A;  1X2K A;  5DY7 A;  2AKK A;  1UGV A;  2YLC A;  4C8Q D;  1VQO A;  2JS2 A;  3PVL A;  1S72 Q;  2MAM A;  2CSI A;  3CD6 A;  1EQF A;  5GAM h;  1SRL A;  2OTL A;  4LZS A;  4KGV B;  5LKU A;  2EYY A;  3M57 A;  5LVQ A;  2COW A;  2PTK A;  3JB9 H;  5DY9 A;  1YCY A;  2OAU A;  4IR4 A;  4XQ3 A;  5IHK A;  1AHJ B;  2O01 E;  4KGZ B;  4M7A D;  1TSF A;  2EPD A;  4HXP A;  3QKJ A;  2QGG A;  2RO0 A;  3CCU T;  1HYO A;  1QVG S;  3EG1 A;  4IUU A;  3ONI A;  2J05 A;  3QHS A;  5A81 A;  2OJ2 A;  4NYV A;  3RMS A;  1SHG A;  5D3N A;  4NQM A;  2ZPE B;  4TTE A;  5KYN A;  4QSS A;  5KCH A;  4A9F A;  1QWE A;  2YHT A;  1ZSG A;  3UVW A;  4QW2 A;  1K0S A;  5A7C A;  2VYT A;  2QQR A;  4J9I A;  2JN0 A;  1Q95 G;  5EWC A;  1SF9 A;  3X20 B;  3AT1 B;  5LJ5 h;  2K3B A;  2F1L A;  2DKW A;  4PCI A;  5F5Z A;  4C0D B;  1VQM A;  4XTW A;  1JXO A;  3QG1 A;  5D6X A;  3G6E T;  5JI8 A;  5LJ3 g;  6AT1 B;  4RVR A;  4HXJ A;  2DM1 A;  3ER0 A;  2CZ6 B;  3I5S A;  2L3R A;  1X2Q A;  5ENG A;  2X4W A;  3JCM c;  3GOX A;  3CCM Q;  3D1B A;  7AT1 B;  4PK4 A;  1QKX A;  4QQD A;  1QVF S;  1JXM A;  1OU8 A;  4QR4 A;  5GAM j;  4J5Y A;  1XTD A;  3TLP A;  3HMF A;  2CSQ A;  4M7A F;  3MEW A;  4Z88 A;  1VQ7 A;  5CK9 A;  4B6M A;  3INZ A;  1M1F A;  2WAC A;  1RUW A;  1BIB A;  2MOX A;  4J9D A;  2M02 A;  2DTH A;  3CME Q;  5II2 A;  3C95 A;  4E7J A;  4O5V A;  4KRT A;  4E7Z A;  1VQ9 A;  4M7D B;  2JXB A;  1H64 1;  4A9L A;  4M7D A;  4OMM A;  4F7U G;  1EX4 A;  4HXS A;  4O7F A;  2ENM A;  5I11 A;  1JJ2 P;  2DF6 A;  4X34 A;  1VQK T;  4PFO A;  4N0A C;  5FH8 A;  3TSW A;  3CC7 T;  1T3L A;  1M8V A;  3RIR A;  2A37 A;  1KFZ A;  5GAN e;  2BKD N;  5LJ5 j;  2HCK A;  2FPF A;  2EGA A;  1WHL A;  2NUP B;  4HKE A;  4JJD A;  2W0Z A;  2NUP A;  3HFN A;  1ZSZ C;  3JSC A;  2VKN A;  1YJ9 A;  2GBQ A;  3JVK A;  1NPR A;  3JB9 I;  4ZTJ A;  3L2U A;  5HEM A;  1I5O B;  1UUE A;  2G3R A;  4N4H A;  3DB4 A;  3C4S A;  3L42 A;  4O7E A;  5A5O A;  1WXT A;  1PNJ A;  4CL9 A;  2Y90 A;  4OP0 A;  1VQ5 T;  4XTX A;  5HCL A;  2YDL A;  3OYL A;  1OOT A;  1T0H A;  3SWN C;  4NR4 A;  4C5G A;  2DVE A;  4CFL A;  1VQ6 A;  5TCM A;  2DJQ A;  1VQ8 Q;  3LW5 E;  3U23 A;  4PJO E;  4C92 E;  5DFC A;  1OV3 A;  2DVV A;  1AWX A;  3HMH A;  2ZGW A;  4LDV A;  4L59 A;  4YH3 A;  1KIK A;  5HM0 A;  3M53 A;  4PJO F;  4C92 F;  4NYW A;  1TUG B;  9ATC B;  2J6F A;  2A08 A;  4ZN1 A;  4RCB A;  3EG3 A;  5L97 A;  2OX7 A;  1XQH A;  4TT2 A;  4J1P A;  2IG0 A;  5KYU B;  3HHT B;  4XUA A;  5KYU A;  4UIT A;  2F6N A;  1N9R A;  1VQP Q;  1ZKR A;  3PIO A;  5EWW A;  3EG2 A;  1X01 A;  1WHM A;  3G71 A;  4XTV A;  1RI9 A;  3OYF A;  3HKS A;  3FDR A;  3JCM W;  1Q81 U;  1XOV A;  4HT9 A;  2CH4 A;  5C7N A;  3MKD A;  3CC4 T;  5D3S A;  1KD1 C;  2MIO A;  3CCR Q;  2QEX Q;  4V2S A;  3S3M A;  1BI3 A;  2DRM A;  4FT4 A;  5GAN d;  5GAO r;  2V8J A;  4EIK A;  1Y96 B;  3ULR B;  4OB0 B;  1Y96 A;  2L8D A;  1VYU A;  1Q7Y R;  5F1H A;  1K73 R;  5HQ5 A;  4BJX A;  5FG6 A;  2RH2 A;  5LJ3 h;  5CUC A;  3P1C A;  2CKK A;  2OTJ A;  3J7A F;  2YDW A;  3O8V A;  1HD3 A;  4FCY A;  1PKS A;  1R0C B;  2B8A A;  4GY5 A;  4A9J A;  4YTL A;  3BE3 A;  2A28 A;  4IIO A;  3E19 A;  5I83 A;  2VV5 A;  4BW3 A;  2DYI A;  2EQI A;  5G4S A;  2EKH A;  2D82 A;  4JJB A;  4AKI A;  3UV4 A;  1ZUY A;  1IGU A;  4KUD K;  2EGE A;  5IG6 A;  3JVJ A;  5EM3 A;  4Z1Q A;  3S6W A;  4F16 A;  3JCM V;  4A4H A;  3LQI A;  3CC2 T;  4UYF A;  2DL3 A;  1M2V B;  5ENH A;  1M2V A;  5CQ6 A;  2QGF B;  2KMT A;  2RB6 A;  5J0D A;  2ABL A;  2FRY A;  5GAO l;  4RMO A;  3CCQ T;  5FE3 A;  3V7S A;  1E6H A;  5HRW A;  4D8K A;  1OPL A;  4QQ6 A;  3SHW A;  2ZPG B;  4Z8A A;  4M78 G;  4EMH A;  5FG5 A;  2R5M A;  1B34 B;  2ROL A;  1B34 A;  4UIY A;  1U8R A;  4ME7 A;  3OSV A;  4CC7 A;  4HCZ A;  2EJF A;  5KE2 A;  1BIA A;  4XY9 A;  5F3A A;  1TTH B;  2XIC A;  4FW1 A;  4WTO B;  5IXB A;  4X1V A;  1G5V A;  1K8A C;  2LQN A;  3SFM A;  1UGS B;  1Q86 C;  4PJJ A;  2ZPB B;  3UVD A;  3PMT A;  5D3H A;  5LJ3 j;  2DTO A;  3C12 A;  1ZLM A;  2EFI A;  2E12 A;  2CRE A;  4LUD A;  5GJW B;  5C6S A;  2L5E A;  2CUB A;  4ZW1 A;  5HJC A;  5EWV A;  3VS7 A;  4KGX B;  4BDY A;  2X51 A;  5I21 A;  3OYB A;  1OQK A;  4C8Q B;  4C8Q A;  2AZV A;  2DTI A;  3GF5 A;  1X6B A;  1VQ7 T;  2DEU A;  4LD9 K;  5AME A;  4DBR A;  4YYN A;  5D3R A;  1QCO A;  1TWB A;  4JRP A;  2CP0 A;  2DEQ A;  4NYX A;  4M77 B;  4M77 A;  4AKN A;  4HBW A;  3JCM X;  4ATO A;  4PNO A;  5GAN h;  2L84 A;  2LSP B;  1MMG A;  5AD3 A;  2CP7 A;  4M77 G;  3CCJ T;  3PGG A;  1VQN A;  2EYQ A;  5AD2 A;  3CPW A;  3EFR A;  4LUE A;  2RA2 A;  5FE8 A;  3CCL A;  5BT4 A;  2CT3 A;  2JTF A;  3JB9 J;  2HKQ B;  4D8D A;  5ENB A;  3LLR A;  1I5L A;  4O77 A;  1M8M A;  5E9I A;  5KYX B;  3JVM A;  2PUO B;  5KYX A;  4FYV B;  4A9K A;  4M75 G;  2CP5 A;  5EWD A;  2KRS A;  2BUD A;  3RER A;  2YUN A;  3TSZ A;  3M9Q A;  2FO0 A;  5L99 A;  3I55 T;  5FLX E;  1M3C A;  4YBS A;  4EMK B;  5ENI A;  2KNB B;  4EMK A;  5KH6 A;  3OYK A;  3FLG A;  1K9M U;  4FLP A;  5CY9 A;  1W70 A;  2LQW A;  3RKY A;  2KRO A;  1FMW A;  5TB6 A;  4BI8 B;  3QXE B;  4QQG A;  1K9M C;  4LZ2 A;  4O7B A;  4WHW A;  2QDL A;  4C5H A;  3GBQ A;  4TZ8 A;  3A8H B;  1GFD A;  1Z9Q A;  3U5N A;  5IHN A;  4QY4 A;  1EFN A;  4ALH A;  2LCL A;  3VKG A;  2L2P A;  3UT1 A;  3VYG A;  2OO1 A;  2V1R A;  5CZG A;  2P0P A;  2RD1 A;  4CFK A;  1K9A A;  3CMA A;  3U5O A;  2CP6 A;  5IAY A;  3TRE A;  4NXJ A;  5A5P A;  3G0L A;  4QSX A;  5CQ7 A;  4BHW A;  2LJ1 A;  4TYL A;  5FE9 A;  2H3J A;  4IUV A;  2K3Y A;  2MPX C;  1WA7 A;  1BYM A;  5FG4 A;  2VAS A;  3M0U A;  2RS9 B;  2F6J A;  5D26 A;  2DBK A;  1KQS P;  5I88 A;  3OS1 A;  5DBM A;  2FVU A;  3N5B B;  2DFU A;  5FH6 A;  4C67 A;  3OYC A;  4XU0 A;  4ELY C;  2H3E B;  4IUP A;  2C0T A;  5AMF A;  5HK0 A;  1YJW Q;  5GAN 7;  2YUO A;  2VGM A;  2QI2 A;  3VS6 A;  4CUU A;  4DOV A;  4YYG A;  1MV3 A;  5D3J A;  3URG A;  5L98 A;  4Y03 A;  1KG1 A;  1ZX6 A;  2RN8 A;  2OSS A;  1BK2 A;  3CCV T;  4QSR A;  1JB0 E;  5I1Q A;  4XU2 A;  1UEB A;  2CYZ B;  1U1T A;  4M7D E;  4F7U F;  4MML A;  5ECA A;  4M7A C;  3SVH A;  4MR5 A;  1I1J A;  2RJE A;  5GJV B;  2LNH B;  1PCX A;  2GTO A;  3EG9 B;  3OW2 S;  2M16 A;  3EG9 A;  5E9V A;  2RQU A;  2ZPH B;  2KDS A;  4OGC A;  4QC1 A;  1BCO A;  3E9F A;  4A9M A;  3M55 A;  5GAN 2;  5LJ5 g;  4JLG A;  1PM3 A;  1CKA A;  4QSU A;  3RMQ A;  1YHQ T;  1Q7Y U;  3CCS Q;  1S72 A;  2L3Q A;  1YBY A;  1PSE A;  1K73 U;  2R0V A;  4TS8 A;  4QSV A;  3OSS C;  2P0K A;  2GNC A;  3THK A;  3A1P A;  1OUL A;  3RCW A;  2RMO A;  1LJO A;  1JJ2 A;  3UVX A;  5A2Q E;  5IGM A;  2FSA A;  3QYH B;  5F25 A;  3WVD B;  3M4Y A;  3O34 A;  5I89 A;  3OBY A;  4NUC A;  1SHF A;  1AVZ C;  1QKW A;  4AFZ C;  3JCM e;  2LRQ A;  2YUQ A;  2A36 A;  4CUQ A;  1RLP C;  4XY8 A;  2QTX A;  2QYZ A;  4K11 A;  5IID A;  5CKE A;  2EQU A;  3PE0 A;  2GFA A;  2JM8 A;  4NRB A;  4AFQ C;  2OI3 A;  3OMC A;  4O7A A;  4KUI A;  3CCU Q;  5DFB A;  3H0H A;  5ETD A;  2DVJ A;  1X27 A;  4E7L A;  4J3I A;  3G1J A;  4C0Z A;  1KD1 R;  1AD5 A;  2LP5 A;  2KYB A;  2M1H A;  4UYD A;  1RAC B;  2K7A A;  2LX7 A;  4F17 A;  2C06 A;  5HQ7 A;  3PMI A;  5GAN 6;  4Y28 E;  5F2P A;  5I2M A;  1U06 A;  4DEY A;  1K0X A;  2V8I A;  3OYY A;  3CCM A;  1IHV A;  3QSU A;  4PJO C;  5L8T A;  1W6X A;  1MND A;  1OI1 A;  3M58 A;  3CPW P;  2DIQ A;  3G6E Q;  1K76 A;  5CCA A;  3P1E A;  3QUI A;  2RQR A;  5KTU A;  3I56 T;  2CZ1 B;  4YK0 A;  5HRX A;  4R56 A;  2LT1 A;  3V8K A;  4QVD A;  2MCN A;  4QC3 A;  3T9N A;  2QA4 Q;  5KU3 A;  4FIB A;  5FRO A;  2RJF A;  3CXC S;  1O75 A;  3CME A;  4YYM A;  3O37 A;  5CS8 A;  1AWO A;  1XNI A;  4MMK A;  3OYA A;  4PJN A;  1KC8 C;  5KO4 A;  2BZY A;  3VRZ A;  4L6V 5;  1WXB A;  2GF7 A;  4XTU A;  1UJY A;  1W1F A;  4UC4 A;  5M9O A;  4N0A A;  4BW1 A;  2D9T A;  1SPK A;  2VB6 A;  5C8G A;  4PL6 A;  3O36 A;  5LJ2 A;  1JEG A;  2GRC A;  2DXB A;  3ZEH A;  5DLO A;  1MUZ A;  4L5G A;  5CQX A;  4O74 A;  5KCO A;  1R0B G;  4N4F A;  2X4J A;  3FC3 A;  1ZSZ B;  1VQL T;  5CQT A;  1I81 A;  1ZSZ A;  3HSB A;  2KE9 A;  4BE1 A;  1RAI B;  1VQK Q;  2KBT A;  1X6G A;  2KVQ G;  5IGK A;  2BE9 B;  3CC7 Q;  4ZN3 A;  1GRI A;  2LCC A;  5EI4 A;  3PVQ A;  3SEM A;  2JTM A;  4UIU A;  2PQW A;  1G3W A;  5EPR A;  4XK8 E;  4HVW A;  1QP2 A;  4OMN A;  1K8A R;  4PFP A;  1Q86 R;  2O2O A;  4M78 E;  2MYS A;  2E65 A;  5EV9 A;  1YIJ T;  5DYX A;  3P8H A;  3SWN B;  2E10 A;  2K5L A;  2WP2 A;  3SWN A;  3NTI A;  2VXE A;  4TQN A;  4M78 F;  3MEU A;  1RAG B;  2KT1 A;  5IGN A;  3C0C A;  1VQ8 A;  4KCX A;  2PNI A;  1N5Z A;  2NUZ A;  4MDX A;  1OPK A;  1W2B P;  4MR6 A;  5GMK h;  1VQ5 Q;  1SKU B;  3TQ7 P;  2J6O A;  2X35 A;  2D0Q B;  5CUA A;  3TVT A;  4MR3 A;  4BD3 A;  2MI6 A;  2P4T A;  5GAO p;  1FXX A;  2VC8 A;  4YYH A;  4HXO A;  1K1Z A;  5KYY B;  4UIX A;  4II1 A;  4LE9 A;  5KYY A;  2QK0 A;  5FFW A;  5GAM f;  4KT0 E;  1YJN T;  3LQH A;  1U1S A;  2PVG B;  1VQP A;  2E6Z A;  2E4H A;  2N9G A;  1ARK A;  2HL3 A;  1V29 B;  4OMP A;  2K4Y A;  4NUE A;  4E7H A;  3QZS A;  3BY7 A;  1TH7 A;  2L3S A;  4RTX A;  4A54 A;  4MZP A;  5EQ1 A;  4TU4 A;  1WX6 A;  5FU6 C;  3H41 A;  2C0I A;  4M77 E;  4PKC C;  4Z02 A;  1WFW A;  5DLX A;  2K2M A;  2EQM A;  3CCR A;  3H0I A;  2QEX A;  2E7O A;  3U5M A;  1PSF A;  2O31 A;  2LNV A;  5D24 A;  2DD4 A;  4QR3 A;  5E9M A;  2Z0W A;  3G4S T;  2XK0 A;  2NXB A;  5AT1 B;  2KXC A;  3VUZ A;  1YI2 T;  3UWN A;  4WIV A;  1OZ2 A;  2QAS A;  3M0P A;  3OS0 A;  3CC4 Q;  4M75 E;  3UA7 A;  5LJ5 f;  4PJO D;  1K9M R;  4C92 D;  4YBM A;  3TEE A;  4DBF A;  4M7D G;  3M4G A;  4QVZ A;  3V8J A;  1WHH A;  4FSX A;  5GMK j;  4M75 F;  4Y91 A;  3A8G B;  1N9S A;  4AG1 C;  3CCE T;  1F1B B;  5GAO q;  2FL7 A;  3OYE A;  5CU8 A;  1SSF A;  4JRI A;  2DL4 A;  3MXF A;  3PIP A;  2LZ6 B;  3CQT A;  4O71 A;  2YUP A;  3NXB A;  3OYG A;  4YBT A;  2CGH A;  1ABO A;  4JJN K;  2KK4 A;  3NTH A;  2QQS A;  5F60 A;  3RUX A;  5GMK i;  5LKT A;  3UV2 A;  5D3P A;  2G4A A;  4HXM A;  1QVP A;  1TU0 B;  2KR3 A;  3MQM A;  3MEV A;  4XU3 A;  2DL5 A;  4QST A;  1FMV A;  5LL6 S;  3P1D A;  3FEO A;  2E70 A;  1K4U S;  1N27 A;  4QSQ A;  5DM7 R;  1WQW A;  4CC4 B;  2DD5 A;  3CC2 Q;  1NLP C;  2I8N A;  4ZC9 A;  3UAT A;  3LH0 A;  3JCM f;  5GAN g;  4F14 A;  1PHT A;  1X0J A;  1G83 A;  3CCQ Q;  3OS2 A;  5F61 A;  4LYS A;  4Z6I A;  4YAD A;  2E7N A;  1JQQ A;  2EW3 A;  2FZG B;  3EGU A;  3GNF B;  2KI7 A;  2LJ0 A;  3VS1 A;  1JU5 C;  1SEM A;  4FYW B;  1KK7 A;  1QCN A;  5CQ8 A;  3VUB A;  2XD0 A;  4KH0 B;  4LYW A;  3OB9 A;  4QEV A;  4HVU A;  1QVG P;  2E3I A;  1KD1 U;  5LUU A;  3EFS A;  4CI0 C;  4DON A;  1AWJ A;  1PC0 A;  1X43 A;  1WHJ A;  4PJL A;  5GAN 4;  3O35 A;  4P5N A;  5E0R A;  1TS9 A;  4UYH A;  4PFZ A;  2RQV A;  3RDV A;  4QKU A;  4O70 A;  1KQS A;  1Q82 C;  2RFJ A;  3LGF A;  4OVA A;  1MGQ A;  3VS5 A;  1M1G A;  5FRN A;  4IOO A;  3VRY A;  1M27 C;  5COI A;  4QUU A;  1OZ3 A;  5D3L A;  3ASK A;  4NL3 A;  2MWO A;  1UGQ B;  1VQO T;  2FB7 A;  1QVF P;  5E9L A;  3CD6 T;  1LPL A;  1D3B B;  4Y92 A;  3EGD B;  1D3B A;  2OTL T;  3EGD A;  3CCJ Q;  4EMG A;  5DYU A;  2D9E A;  4RUG A;  4DBQ A;  5HEN A;  1TOV A;  5KTW A;  1ZBX A;  1B7T A;  3CBP A;  1X6O A;  2D6F A;  2F2V A;  1I4K 1;  2EYZ A;  5EWH A;  4C5E A;  4FL6 A;  2KSS A;  5CUE A;  5LVR A;  4UYF B;  4OMO A;  4MEQ A;  4WF2 A;  1N6A A;  4J7F A;  4MDW A;  2CH4 W;  4RTY A;  1X69 A;  3IU5 A;  5ENE A;  1NZ9 A;  2ZCF B;  3JCM Q;  1H3H A;  4NL2 A;  2GTJ A;  3I55 Q;  4J83 A;  5G4R A;  5GAO n;  1AWW A;  4IIM A;  5CRZ A;  5CFW A;  3MP8 A;  2QQA A;  1UJ0 A;  2RO1 A;  2JS0 A;  4JDS A;  2HEQ A;  5FW9 A;  5HQ6 A;  1VQ4 A;  4RTV A;  5LJ3 f;  4BAC A;  1K8A U;  5I29 A;  1Q86 U;  2EJ9 A;  4F3I A;  3A98 A;  5CIU A;  3SD4 A;  4NRA A;  4PLL A;  1VQM T;  3DLL A;  4HCC A;  5E3G A;  2F69 A;  1RL2 A;  2I2L A;  4J9C A;  3REA B;  3EGX B;  3EGX A;  2B86 A;  4ZTF A;  4NRC A;  4LNP A;  3QZV A;  1N8R U;  5FE7 A;  1UB4 A;  5DYC A;  5F63 A;  1TG0 A;  1VQP T;  1KC8 R;  1WI7 A;  5EU1 A;  1N8R C;  2O4X B;  1FWZ A;  2O4X A;  4HXR A;  5LJ1 A;  2DAT A;  1Z9Z A;  2RNX A;  2HQH A;  3MO8 A;  1YJW A;  2XU8 A;  3EHR A;  1M90 C;  1Y07 A;  2HBW A;  4QNS A;  4C8Q G;  2RM4 A;  1YIT A;  3VS3 A;  1RAB B;  3VV0 A;  4E7K A;  2RHX A;  3G0J A;  4OGI A;  5FWB A;  4M7A B;  4GLK A;  4OMF B;  5EC7 A;  1VQ9 T;  4M7A A;  2KT8 A;  1M4Z A;  2X3X D;  4O76 A;  1PG5 B;  1HXD A;  5FE2 A;  5L23 A;  3M59 A;  1M1K C;  3Q2E A;  4FM4 B;  5IBN A;  1DJ7 B;  2J7I A;  4YY6 A;  2YXY A;  4ZGJ B;  5DKC A;  4M7A G;  2R10 A;  1LNX A;  2PZ1 A;  3CCV Q;  1ZBJ A;  2O88 A;  1H92 A;  4IOR A;  5DLQ E;  2DVS A;  1ABQ A;  3VS0 A;  1WZO A;  2KGT A;  4ZGE B;  2K2V A;  4UIV A;  2KTB B;  1YJ9 T;  2DVR A;  2E1H A;  4AFU C;  5CKD A;  4NR9 A;  2RHI A;  3CCS A;  2E64 A;  2RF0 A;  4IUR A;  5F62 A;  8AT1 B;  1BB9 A;  2L89 A;  2DKG A;  3OS5 A;  1MNE A;  3MUL A;  4TZ2 A;  1OYX A;  5EIC A;  4X9D A;  1QMC A;  5FE5 A;  4OB1 B;  4FT2 A;  3RKX A;  1YHQ Q;  4DBH A;  2RI2 A;  3BDL A;  4MR4 A;  4NUD A;  2DIG A;  3RBB B;  2MJV B;  1M9S A;  2CS7 A;  1O9S A;  4FYY B;  1UGP B; 
#chains in the Genus database with same CATH homology
 1X75 C;  1VQ6 T;  5D25 A;  1NE8 A;  2KY9 A;  5EVA A;  4XAX B;  1NPP A;  4Z6H A;  2EWN A;  5EPS A;  5KE3 A;  4NS5 A;  5CUG A;  4BY6 B;  5C85 A;  4QB3 A;  4EDU A;  4M7D D;  5GAM e;  4HXK A;  3CCU A;  5GAN j;  3KUF A;  4NR7 A;  4M78 C;  3JB9 G;  3QJ6 A;  1VIF A;  1Y7X A;  2EKO A;  5EP7 A;  5CQ5 A;  5A83 A;  3ZYU A;  2XG8 D;  5GAN 5;  3A8O B;  4BB7 A;  4PJO B;  4PJO A;  4C92 B;  4C92 A;  3OYN A;  5A5Q A;  4N3W A;  4LDF A;  4N4I A;  5CQA A;  4PCE A;  3G71 T;  2YEL A;  5CUD A;  1W2B A;  5FU7 C;  2RHY A;  3U5K A;  4Z93 A;  4TT6 A;  2VGN A;  3G6E A;  5IN1 A;  1BI2 A;  4NR8 A;  5J39 A;  5KHM A;  2XDB A;  5LJ5 e;  5II1 A;  4BDZ A;  2QA4 A;  5FE4 A;  1WUG A;  4OB3 B;  5GAN 3;  2YRV A;  5A0D A;  2OTJ T;  2MWP A;  4M7D F;  4CRI A;  5HY6 A;  3QDR B;  3QZ5 B;  4KUL A;  3CPF A;  1NJI C;  1ZQ1 A;  5CKH A;  3DLM A;  2V8K A;  3OY9 A;  1VQK A;  4OGE A;  2VUB A;  2LDM A;  5AYF A;  2DK3 A;  2CZ0 B;  2Y4X A;  2YLB A;  5K29 A;  5GAM d;  1RI0 A;  4Q5W A;  2VXF A;  4TT4 A;  3LWI A;  3AHU A;  3UVY A;  4BE2 A;  3GP8 A;  2YW5 A;  5CUB A;  3TCJ A;  1VQ4 T;  4YAB A;  2JVV A;  3M5A A;  5CPE A;  4A9I A;  2JUF A;  4A53 A;  3DKM A;  1EIF A;  3WVE B;  5FB0 A;  5H85 A;  4BY6 C;  5D0C A;  1VQ5 A;  4FU6 A;  4ZQL A;  5CVI A;  3TU4 K;  3MB3 A;  3SDZ A;  2YQD A;  1QP3 A;  5LKZ A;  3P8D A;  2WP1 A;  3LJW A;  5D3T A;  3P5O A;  4IR6 A;  5CQY A;  5LJ5 d;  3A5Z B;  5LJ0 A;  2HQX A;  3S91 A;  4C92 C;  4J6Y A;  3LYI A;  3Q1J A;  4JUV A;  5F1L A;  3LGL A;  5ETB A;  1VUB A;  2KAF A;  4YYK A;  3ZBD A;  5FU6 B;  2RK2 A;  1JJ2 S;  2E41 A;  3A8M B;  5CQ4 A;  1ZHI A;  4BE0 A;  3FIF A;  1QW1 A;  1WQ7 A;  1JSP B;  2RNY A;  4KV1 A;  5DX4 A;  1YIT T;  4M78 D;  3D7C A;  5ENC A;  2NLU A;  2PVO B;  1KC8 U;  4KBM B;  4LDY A;  3LQJ A;  5HK3 A;  4LDX A;  4LR6 A;  3FRN A;  5E3D A;  1VQN T;  4OF1 A;  4QSW A;  1R8O B;  5D6Y A;  1QVG A;  4PTB A;  3CC4 A;  3CCL T;  2LTO A;  4TU6 A;  3L2R A;  4HA8 A;  5FFY A;  2IVW A;  3SB2 A;  2XDD A;  4B9X A;  5C0M A;  4YYJ A;  3JCM d;  5I7X A;  3QPH A;  4XTZ A;  4HT8 A;  2K3X A;  4HXL A;  2H60 A;  5GAO m;  5L8R E;  3QZT A;  4YYD A;  5LJ3 e;  3MEA A;  1QVF A;  5FDZ A;  2RI5 A;  4M77 D;  5H1V A;  3CMA T;  2PVD B;  3CC2 A;  3FKM X;  4WHU A;  2AHJ B;  3KBG A;  4M75 D;  3CCQ A;  1P92 A;  5EPB A;  3Q2F A;  3KXT A;  3H6Z A;  4CLB A;  4XUB A;  3LXJ A;  3PTA A;  3OA6 A;  4YAT A;  4C8Q E;  1BKB A;  2ZZD A;  1FX7 A;  4QEW A;  4Q0N A;  3DWY A;  3NTK A;  5E7D A;  3OYI A;  4C8Q F;  1KHC A;  4QR5 A;  5HKC A;  2DXU A;  4HBX A;  4M7A E;  3SVG A;  4YH4 A;  4ZGD B;  4HBY A;  2QA4 T;  5FB1 A;  5HFQ A;  4M77 F;  5HEL A;  3MET A;  2XDP A;  4MZT A;  3JB9 D;  2L85 A;  3JCM J;  4O75 A;  4YYI A;  3VU3 C;  3WXM B;  3A8L B;  5A85 A;  4A9H A;  2QXF A;  3S3N A;  4F7U B;  4F7U A;  5I2S A;  2WSE E;  1KHI A;  2XKO C;  3GNG A;  2OUO A;  3OMG A;  1G3T A;  5GMK m;  5CKF A;  5HFR A;  5LJ3 d;  1S72 T;  2FHD A;  4QBM A;  3CCJ A;  1BI0 A;  3JCM h;  2I7K A;  4JS5 A;  3QBY A;  2E3K A;  4A9E A;  3L2W A;  2R0S A;  5C87 A;  2WSC E;  2GCX A;  3VKI A;  4BUG A;  4BW2 A;  2EJG A;  5DW2 A;  3HRS A;  3I55 A;  3L1A A;  4JLI A;  3V7R A;  3SVF A;  3P8B B;  5A0G A;  4X2I A;  5EA1 A;  5FFV A;  3JB9 F;  2RJD A;  2DJZ A;  5F36 A;  3E1S A;  3X24 B;  4HXN A;  5A5S A;  3UPU A;  5BT3 A;  3RKW A;  2QDY B;  3HPW A;  3OYH A;  5DW1 A;  5HRV A;  5FBX A;  4QVC A;  3LX7 A;  3MP6 A;  3CCM T;  5L96 A;  4ELZ C;  3U5P A;  2LC4 A;  3DAI A;  4TVR A;  3OBW A;  3BDU A;  4PY6 A;  1VIE A;  4IUT A;  3HRU A;  4C0D C;  3X28 B;  4QZS A;  1I8F A;  5I86 A;  2LQ8 A;  2DWW A;  5DKD A;  2PU9 B;  4QSP A;  3JAM E;  4PLI A;  1Q82 U;  2DZ9 A;  2R0Y A;  3J80 E;  3CME T;  5ENJ A;  5DYA A;  4RG2 A;  2F5K A;  3QO3 A;  4IR5 A;  4HCB A;  3F70 A;  3L2V A;  1Q81 C;  4XTY A;  5J26 A;  4E96 A;  3ME9 A;  3JRZ A;  3CCV A;  4N4G A;  4DOW A;  5IGL A;  3FB9 A;  1WPY A;  4NR6 A;  3HRT A;  4M7D C;  3E9G A;  2EQK A;  2R57 A;  3J81 E;  5I40 A;  4A4F A;  4CUT A;  2MF2 A;  3G7Z A;  5CRM A;  3BFM A;  4D6W A;  4UIZ A;  1YHQ A;  1W4S A;  1WJR A;  4B9W A;  2HNI A;  4MZM A;  4C66 A;  2X4X A;  4O72 A;  1VQ8 T;  4XU1 A;  1KQS S;  3L2Z A;  4Q0O A;  3QII A;  3S92 A;  4M78 B;  4M78 A;  4J0R A;  1G3S A;  4UIW A;  1IRE B;  2HBP A;  2QQB A;  3L2Q A;  3MB4 A;  3DB3 A;  2DAQ A;  3HL8 A;  2CZ7 B;  2E6N A;  4C0F A;  4OUF A;  4JRQ A;  3M54 A;  5CGP A;  4OGJ A;  5FU7 B;  3OQ5 A;  4GPJ A;  2A3L A;  2RI3 A;  3X25 B;  1M90 U;  3AQA A;  4QUT A;  4J0S A;  1KQ1 A;  5IT9 E;  4XYA A;  4C5I A;  2ZPF B;  1JM4 B;  3CCR T;  2RJC A;  5E74 A;  2PUK B;  4J8O A;  2QEX T;  1BI1 A;  4LYI A;  5CP5 A;  5EK9 A;  3OYM A;  3P1F A;  4J6X A;  5LKX A;  4QYL A;  1M1K U;  5DFD A;  1LOJ A;  4CUP A;  5CQ3 A;  3O33 A;  2LX9 A;  2QQ9 A;  1WGS A;  3I56 A;  1UGR B;  5CTL A;  5J3B A;  4MEP A;  2GFU A;  5CAI A;  4JS4 A;  5KTX A;  4O6J A;  4NQN A;  5CO7 A;  3JCM P;  5FH7 A;  2HQE A;  4X9C A;  1IZ6 A;  4A4K A;  3M56 A;  4VUB A;  2P0Q A;  3C94 A;  5ENF A;  4M75 B;  3K2J A;  4M75 A;  1M5Q 1;  5GAN 8;  2K57 A;  2LVM A;  1VQL A;  2R5A A;  2RI7 A;  3PFS A;  1WUM A;  5BT5 A;  1GXI E;  3LWH A;  5GMK l;  1ZS5 A;  3OYD A;  4C0G A;  5H1U A;  4EPC A;  4E47 A;  5GAN f;  5I7Y A;  1WJS A;  2EQJ A;  5FE1 A;  3AAD A;  3MUK A;  5A0L A;  3CPW S;  1YIJ A;  3QYG B;  5FE6 A;  2DVQ A;  2ZPI B;  2LT4 A;  4LC2 A;  3GIB A;  2DXT A;  4NOY A;  4RCC A;  5JWM A;  4QEU A;  4LDU A;  3HME A;  3ZFJ A;  3OW2 A;  3VYH B;  5EG2 A;  2FYK A;  4IUQ A;  4PJO G;  4C92 G;  1MHN A;  4LRG A;  2MMP A;  4MEN A;  3QZ9 B;  4KV4 A;  4DQ2 A;  5GMK e;  5HLS A;  4IKF A;  3R6O A;  3MP1 A;  4A9N A;  3U5J A;  4E7I A;  1JRI A;  1YJN A;  5L8U A;  4BW4 A;  5A82 A;  1WJQ A;  2YYN A;  5GAM g;  4IOQ A;  5A5N A;  4QYD A;  2A7Y A;  4C8Q C;  3RES A;  4PS5 A;  4MEO A;  5D6W A;  3MHX A;  2R58 A;  4F7U E;  3GPL A;  3GLX A;  2RK1 A;  5D7X A;  2GQV A;  4M77 C;  1NJI U;  2HD0 A;  2M9U A;  3BW1 A;  4LDW A;  2JZ2 A;  3G4S A;  4A9O A;  2K5I A;  1YI2 A;  3VJP A;  2XI9 A;  3H8Z A;  4Z1S A;  5C89 A;  2RNW A;  2DZC A;  4LD6 A;  3I3J A;  2DO3 A;  2X4Y A;  3CC7 A;  1W2B S;  2YEK A;  4M75 C;  3U5L A;  5DLZ A;  4J7I A;  2E5Q A;  5ACY A;  5CKB A;  2RHU A;  3CCE A;  2Y4Y A;  3HFO A;  3GG3 A;  4LZR A;  1G3Y A;  3JVL A;  4RG8 A;  1E6I A;  4YC9 A;  3IU6 A;  1Q7Y C;  1JBM A;  1K73 C;  4UYG A;  2DXC A;  4EMK C;  2JNG A;  5FRM A;  4YAX A;  3OYJ A;  3V7C A;  2DPP B;  2WSF E;  3QJY A;  5E9K A;  3FJP A;  5E73 A;  2F5T X;  2HAX A;  4A4E A;  3UW9 A;  1KQ2 A;  5DKH A;  1N72 A;  2EIF A;  3CXC A;  5CR2 A;  2L5Q A;  3UDC A;  2K5F A;  4A4G A;  2KQW A;  4JRK A;  4NR5 A;  4IR3 A;  4R55 A;  3CBO A;  2JOY A;  4DA4 A;  3PT9 A;  1H3Z A;  4O7C A;  3CBM A;  3HP9 A;  1YJW T;  3JCM g;  5E9Y A;  3V8L A;  4OB2 B;  3EAE A;  4J6W A;  3MCA B;  4CUS A;  1HK9 A;  4O78 A;  5A5R A;  4HBV A;  2M0O A;  3S3O A;  2BIV A;  5EIS A;  2XHC A;  5I80 A;  5EGU A;  5C4Q A;  3JCM b;  3CEY A;  1WNL A;  2XID A;  5H1T A;  4ALG A;  2RHZ A;  3UV5 A;  4CUR A;  3CCS T;  4BI4 A;  4RKU E;  3X26 B;  2YEM A;  5FE0 A;  2EAY A;  4UYE A;  1Y71 A;  1F68 A;  4YY4 A;  3PNW C;  2LQK A;  3NFC A;  4BI3 A;  4PKL A;  5DY7 A;  2YLC A;  4C8Q D;  1VQO A;  2MAM A;  3CD6 A;  1EQF A;  5GAM h;  2OTL A;  4LZS A;  5LKU A;  3M57 A;  5LVQ A;  3JB9 H;  5DY9 A;  1YCY A;  2OAU A;  4IR4 A;  4XQ3 A;  1AHJ B;  2O01 E;  4M7A D;  4HXP A;  3QKJ A;  2RO0 A;  3CCU T;  1QVG S;  4IUU A;  3ONI A;  3QHS A;  5A81 A;  4NYV A;  3RMS A;  5D3N A;  4NQM A;  2ZPE B;  4TTE A;  4QSS A;  5KCH A;  4A9F A;  2YHT A;  3UVW A;  4QW2 A;  5A7C A;  2VYT A;  2QQR A;  2JN0 A;  5EWC A;  3X20 B;  5LJ5 h;  2DKW A;  4PCI A;  5F5Z A;  4C0D B;  1VQM A;  4XTW A;  3QG1 A;  5D6X A;  3G6E T;  5JI8 A;  5LJ3 g;  4RVR A;  3ER0 A;  2CZ6 B;  2L3R A;  3GOX A;  5ENG A;  2X4W A;  3JCM c;  4QQD A;  1QVF S;  4QR4 A;  5GAM j;  4J5Y A;  1XTD A;  3TLP A;  3HMF A;  4M7A F;  3MEW A;  1VQ7 A;  5CK9 A;  3INZ A;  1M1F A;  2WAC A;  1BIB A;  2DTH A;  5II2 A;  3C95 A;  4E7J A;  4O5V A;  1VQ9 A;  4M7D B;  1H64 1;  4A9L A;  4M7D A;  4F7U G;  4HXS A;  4O7F A;  4X34 A;  1VQK T;  4N0A C;  5FH8 A;  3CC7 T;  1M8V A;  3RIR A;  5GAN e;  2BKD N;  5LJ5 j;  4HKE A;  3HFN A;  3JSC A;  1YJ9 A;  3JVK A;  1NPR A;  3JB9 I;  4ZTJ A;  3L2U A;  5HEM A;  2G3R A;  4N4H A;  3DB4 A;  3C4S A;  3L42 A;  4O7E A;  5A5O A;  4CL9 A;  2Y90 A;  4OP0 A;  1VQ5 T;  4XTX A;  5HCL A;  3OYL A;  3SWN C;  4NR4 A;  4C5G A;  2DVE A;  4CFL A;  1VQ6 A;  5TCM A;  3LW5 E;  4PJO E;  4C92 E;  5DFC A;  2DVV A;  3HMH A;  2ZGW A;  4LDV A;  4L59 A;  4YH3 A;  5HM0 A;  3M53 A;  4PJO F;  4C92 F;  4NYW A;  4ZN1 A;  4RCB A;  5L97 A;  1XQH A;  4TT2 A;  4J1P A;  2IG0 A;  3HHT B;  4XUA A;  4UIT A;  2F6N A;  1N9R A;  3PIO A;  5EWW A;  1X01 A;  3G71 A;  4XTV A;  3OYF A;  3HKS A;  3FDR A;  3JCM W;  1Q81 U;  1XOV A;  4HT9 A;  5C7N A;  3CC4 T;  5D3S A;  1KD1 C;  4V2S A;  3S3M A;  1BI3 A;  4FT4 A;  5GAN d;  5GAO r;  2V8J A;  1Y96 B;  4OB0 B;  1Y96 A;  2L8D A;  5F1H A;  5HQ5 A;  4BJX A;  5FG6 A;  2RH2 A;  5LJ3 h;  5CUC A;  3P1C A;  2CKK A;  2OTJ A;  3J7A F;  2YDW A;  3O8V A;  2B8A A;  4GY5 A;  4A9J A;  4YTL A;  3E19 A;  5I83 A;  2VV5 A;  4BW3 A;  5G4S A;  2D82 A;  3UV4 A;  4KUD K;  5IG6 A;  3JVJ A;  5EM3 A;  4Z1Q A;  3S6W A;  3JCM V;  4A4H A;  3LQI A;  3CC2 T;  4UYF A;  5ENH A;  5CQ6 A;  2KMT A;  2RB6 A;  5J0D A;  5GAO l;  4RMO A;  3CCQ T;  5FE3 A;  3V7S A;  5HRW A;  4QQ6 A;  2ZPG B;  4EMH A;  4M78 G;  5FG5 A;  2R5M A;  1B34 B;  1B34 A;  4UIY A;  1U8R A;  4ME7 A;  3OSV A;  4HCZ A;  2EJF A;  5KE2 A;  1BIA A;  4XY9 A;  5F3A A;  2XIC A;  1G5V A;  1K8A C;  3SFM A;  1UGS B;  1Q86 C;  2ZPB B;  3UVD A;  3PMT A;  5D3H A;  5LJ3 j;  2DTO A;  3C12 A;  2EFI A;  2E12 A;  5C6S A;  2L5E A;  4ZW1 A;  5HJC A;  5EWV A;  4BDY A;  5I21 A;  3OYB A;  4C8Q B;  4C8Q A;  2DTI A;  3GF5 A;  1VQ7 T;  4LD9 K;  5AME A;  4YYN A;  5D3R A;  4JRP A;  2DEQ A;  4NYX A;  4M77 B;  4M77 A;  4AKN A;  4HBW A;  3JCM X;  4ATO A;  4PNO A;  5GAN h;  2L84 A;  2LSP B;  5AD3 A;  4M77 G;  3CCJ T;  3PGG A;  1VQN A;  2EYQ A;  5AD2 A;  3CPW A;  3EFR A;  2RA2 A;  5FE8 A;  3CCL A;  5BT4 A;  2JTF A;  3JB9 J;  5ENB A;  3LLR A;  1I5L A;  4O77 A;  5E9I A;  3JVM A;  2PUO B;  4M75 G;  4A9K A;  5EWD A;  2BUD A;  3RER A;  3M9Q A;  5L99 A;  3I55 T;  5FLX E;  4YBS A;  4EMK B;  5ENI A;  4EMK A;  5KH6 A;  3OYK A;  3FLG A;  1K9M U;  4FLP A;  5CY9 A;  3RKY A;  5TB6 A;  4BI8 B;  3QXE B;  4QQG A;  1K9M C;  4LZ2 A;  4O7B A;  4WHW A;  4C5H A;  4TZ8 A;  3A8H B;  3U5N A;  4QY4 A;  4ALH A;  2LCL A;  3VYG A;  3UT1 A;  2OO1 A;  5CZG A;  2P0P A;  2RD1 A;  4CFK A;  3CMA A;  3U5O A;  5IAY A;  3TRE A;  4NXJ A;  5A5P A;  3G0L A;  4QSX A;  5CQ7 A;  4BHW A;  4TYL A;  5FE9 A;  2H3J A;  4IUV A;  2K3Y A;  1BYM A;  5FG4 A;  2RS9 B;  2F6J A;  5D26 A;  5I88 A;  3OS1 A;  5DBM A;  2FVU A;  3N5B B;  5FH6 A;  4C67 A;  3OYC A;  4XU0 A;  4ELY C;  4IUP A;  5AMF A;  5HK0 A;  5GAN 7;  2VGM A;  2QI2 A;  4CUU A;  4DOV A;  4YYG A;  5D3J A;  3URG A;  5L98 A;  4Y03 A;  1KG1 A;  3CCV T;  2OSS A;  4QSR A;  1JB0 E;  5I1Q A;  4XU2 A;  1UEB A;  2CYZ B;  1U1T A;  4M7D E;  4F7U F;  4MML A;  4M7A C;  3SVH A;  4MR5 A;  2RJE A;  3OW2 S;  2M16 A;  5E9V A;  2ZPH B;  2KDS A;  4OGC A;  4QC1 A;  3E9F A;  4A9M A;  3M55 A;  5GAN 2;  5LJ5 g;  4JLG A;  4QSU A;  3RMQ A;  1YHQ T;  1Q7Y U;  1S72 A;  1YBY A;  1PSE A;  1K73 U;  2R0V A;  4TS8 A;  4QSV A;  3OSS C;  2P0K A;  3RCW A;  1LJO A;  1JJ2 A;  3UVX A;  5A2Q E;  5IGM A;  2FSA A;  3QYH B;  5F25 A;  3WVD B;  3M4Y A;  3O34 A;  5I89 A;  3OBY A;  4NUC A;  3JCM e;  2LRQ A;  4CUQ A;  4XY8 A;  2QTX A;  5IID A;  5CKE A;  2EQU A;  2GFA A;  4NRB A;  3OMC A;  4O7A A;  4KUI A;  5DFB A;  5ETD A;  4E7L A;  4J3I A;  4C0Z A;  2M1H A;  4UYD A;  2C06 A;  5HQ7 A;  3PMI A;  5GAN 6;  4Y28 E;  5F2P A;  5I2M A;  2V8I A;  3OYY A;  3CCM A;  3QSU A;  4PJO C;  5L8T A;  1OI1 A;  3M58 A;  2DIQ A;  5CCA A;  3P1E A;  3QUI A;  5KTU A;  3I56 T;  2CZ1 B;  4YK0 A;  5HRX A;  4R56 A;  2LT1 A;  3V8K A;  4QVD A;  4QC3 A;  3T9N A;  5KU3 A;  4FIB A;  5FRO A;  2RJF A;  3CXC S;  1O75 A;  3CME A;  4YYM A;  3O37 A;  5CS8 A;  1XNI A;  4MMK A;  3OYA A;  1KC8 C;  5KO4 A;  4L6V 5;  2GF7 A;  4XTU A;  4UC4 A;  5M9O A;  4N0A A;  4BW1 A;  2D9T A;  5C8G A;  4PL6 A;  3O36 A;  5LJ2 A;  2GRC A;  2DXB A;  3ZEH A;  5DLO A;  4L5G A;  5CQX A;  4O74 A;  5KCO A;  3FC3 A;  4N4F A;  2X4J A;  1VQL T;  5CQT A;  1I81 A;  3HSB A;  4BE1 A;  2KVQ G;  5IGK A;  4ZN3 A;  2LCC A;  5EI4 A;  2JTM A;  4UIU A;  2PQW A;  1G3W A;  5EPR A;  4XK8 E;  1QP2 A;  4M78 E;  2E65 A;  5EV9 A;  1YIJ T;  5DYX A;  3P8H A;  3SWN B;  2E10 A;  2K5L A;  2WP2 A;  3SWN A;  3NTI A;  2VXE A;  4TQN A;  4M78 F;  3MEU A;  5IGN A;  1VQ8 A;  4KCX A;  4MDX A;  4MR6 A;  5GMK h;  2X35 A;  2D0Q B;  5CUA A;  4MR3 A;  4BD3 A;  2MI6 A;  2P4T A;  5GAO p;  1FXX A;  2VC8 A;  4YYH A;  4HXO A;  4UIX A;  4II1 A;  5FFW A;  5GAM f;  4KT0 E;  1YJN T;  3LQH A;  1U1S A;  2PVG B;  1VQP A;  2E6Z A;  2N9G A;  1V29 B;  2K4Y A;  4NUE A;  4E7H A;  3QZS A;  3BY7 A;  1TH7 A;  4A54 A;  4MZP A;  5EQ1 A;  4TU4 A;  5FU6 C;  4M77 E;  4PKC C;  4Z02 A;  5DLX A;  2EQM A;  3CCR A;  2QEX A;  2E7O A;  3U5M A;  1PSF A;  2LNV A;  5D24 A;  2DD4 A;  4QR3 A;  5E9M A;  3G4S T;  2XK0 A;  2NXB A;  3VUZ A;  1YI2 T;  3UWN A;  4WIV A;  1OZ2 A;  3OS0 A;  4M75 E;  5LJ5 f;  4PJO D;  4C92 D;  4YBM A;  3TEE A;  4M7D G;  3M4G A;  4QVZ A;  3V8J A;  4FSX A;  5GMK j;  4M75 F;  4Y91 A;  3A8G B;  1N9S A;  3CCE T;  5GAO q;  2FL7 A;  3OYE A;  5CU8 A;  1SSF A;  4JRI A;  3MXF A;  3PIP A;  4O71 A;  3NXB A;  3OYG A;  4YBT A;  2CGH A;  4JJN K;  2KK4 A;  3NTH A;  2QQS A;  5F60 A;  3RUX A;  5GMK i;  5LKT A;  3UV2 A;  5D3P A;  2G4A A;  4HXM A;  1QVP A;  3MQM A;  3MEV A;  4XU3 A;  4QST A;  5LL6 S;  3P1D A;  3FEO A;  2E70 A;  1N27 A;  4QSQ A;  5DM7 R;  1WQW A;  2DD5 A;  2I8N A;  4ZC9 A;  3LH0 A;  3JCM f;  5GAN g;  1X0J A;  3OS2 A;  5F61 A;  4LYS A;  4Z6I A;  4YAD A;  2E7N A;  3GNF B;  5CQ8 A;  3VUB A;  2XD0 A;  4LYW A;  3OB9 A;  4QEV A;  1KD1 U;  5LUU A;  3EFS A;  4CI0 C;  4DON A;  5GAN 4;  3O35 A;  4P5N A;  5E0R A;  4UYH A;  4O70 A;  1KQS A;  1Q82 C;  2RFJ A;  3LGF A;  4OVA A;  1MGQ A;  1M1G A;  5FRN A;  4IOO A;  5COI A;  4QUU A;  1OZ3 A;  5D3L A;  3ASK A;  4NL3 A;  2MWO A;  1UGQ B;  1VQO T;  2FB7 A;  5E9L A;  3CD6 T;  1D3B B;  1D3B A;  2OTL T;  4EMG A;  5DYU A;  2D9E A;  5HEN A;  5KTW A;  1ZBX A;  3CBP A;  1X6O A;  2D6F A;  1I4K 1;  5EWH A;  4C5E A;  4FL6 A;  2KSS A;  5CUE A;  5LVR A;  4UYF B;  4MEQ A;  4WF2 A;  1N6A A;  4J7F A;  4MDW A;  3IU5 A;  5ENE A;  1NZ9 A;  2ZCF B;  3JCM Q;  4NL2 A;  4J83 A;  5G4R A;  5GAO n;  5CRZ A;  5CFW A;  3MP8 A;  2QQA A;  2RO1 A;  4JDS A;  5HQ6 A;  1VQ4 A;  5LJ3 f;  4BAC A;  1K8A U;  5I29 A;  1Q86 U;  2EJ9 A;  4F3I A;  5CIU A;  3SD4 A;  4NRA A;  4PLL A;  1VQM T;  3DLL A;  4HCC A;  5E3G A;  2F69 A;  1RL2 A;  2I2L A;  4ZTF A;  4NRC A;  3QZV A;  1N8R U;  5FE7 A;  1UB4 A;  5DYC A;  5F63 A;  1VQP T;  5EU1 A;  1N8R C;  2O4X B;  1FWZ A;  2O4X A;  4HXR A;  5LJ1 A;  2DAT A;  2RNX A;  3MO8 A;  1YJW A;  2XU8 A;  1M90 C;  1Y07 A;  4QNS A;  4C8Q G;  2RM4 A;  1YIT A;  3VV0 A;  4E7K A;  2RHX A;  3G0J A;  4OGI A;  4M7A B;  4GLK A;  4OMF B;  1VQ9 T;  4M7A A;  1M4Z A;  4O76 A;  1HXD A;  5FE2 A;  3M59 A;  1M1K C;  3Q2E A;  4FM4 B;  5IBN A;  1DJ7 B;  4YY6 A;  4ZGJ B;  4M7A G;  5DKC A;  2R10 A;  1LNX A;  4IOR A;  5DLQ E;  2DVS A;  4ZGE B;  2K2V A;  4UIV A;  2KTB B;  1YJ9 T;  2DVR A;  2E1H A;  5CKD A;  4NR9 A;  2RHI A;  3CCS A;  2E64 A;  4IUR A;  5F62 A;  2L89 A;  2DKG A;  3OS5 A;  3MUL A;  4TZ2 A;  1OYX A;  5EIC A;  4X9D A;  5FE5 A;  4OB1 B;  4FT2 A;  3RKX A;  2RI2 A;  3BDL A;  4MR4 A;  4NUD A;  2DIG A;  2MJV B;  1M9S A;  2CS7 A;  1O9S A;  1UGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...