4N4HA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.1k36me3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
188
Chain Sequence
b'QEMGTYLRFIVSRMKERAIDLVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
molecule tags Transcription
source organism Mus musculus
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
total genus 66
structure length 188
sequence length 209
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4hA02
3TLPA 5II1A 5LJ0A 4XY9A 4QYDA 2JZ2A 5L98A 5E9VA 3OYKA 2OSSA 3L2RA 4BHWA 4QSXA 3MXFA 4BACA 5F1HA 4YABA 5I83A 4BD3A 2L89A 3OYJA 3FKMX 3F70A 4QR4A 2LSPB 4IR6A 4C67A 4QUTA 4PL6A 5DW1A 4YAXA 3ZYUA 4CUTA 4QR5A 5L8TA 2EQKA 3QIIA 5EPRA 5FH7A 3OYLA 4LZ2A 5M9OA 2X4YA 4Z1QA 4BE1A 2WP1A 3D7CA 5LKUA 4NUDA 5J39A 5I7YA 1N72A 3PMIA 2GFAA 4XYAA 5C89A 3MP8A 5KE3A 4QSSA 4CUQA 3OS2A 4C66A 2DKWA 3LYIA 4HBVA 4YYHA 4J0SA 5CQAA 5FB1A 3S92A 5HQ7A 5KTXA 4C5GA 4MEPA 3OYHA 2JTFA 4QEUA 4Q0NA 2LCCA 5FH6A 3OYFA 4PS5A 4YYJA 3JVMA 4BJXA 4B9WA 4QBMA 5D3PA 5F1LA 3DLMA 3P8HA 2R0VA 4N4FA 4A9EA 3QBYA 5I89A 5FE4A 1H3ZA 5F2PA 4LYWA 3ZEHA 3AADA 5KCOA 4TU6A 4QQ6A 5C6SA 4CUPA 5I88A 4O76A 5EM3A 3NTHA 4IR4A 4CRIA 5FE6A 4QQDA 3S6WA 5CS8A 5I7XA 2L8DA 4QB3A 5ENGA 2OO1A 2RI2A 2F6NA 3BDLA 3OYMA 5CPEA 5IN1A 4NYVA 4UYHA 2QQSA 2OUOA 5FRNA 2EQMA 1XNIA 1WUMA 4KV4A 4NXJA 3OYAA 5EK9A 3U5MA 5H1TA 4WHUA 5LJ2A 1SSFA 5F63A 2WP2A 2B8AA 2RJDA 5JI8A 4LR6A 3NTIA 1OI1A 3O8VA 2EKOA 2RNYA 5DYXA 2YRVA 2YQDA 3U5NA 5D3JA 2CKKA 4YBSA 4WHWA 1WJSA 2RI7A 4HBYA 4QEWA 2RNWA 5ENIA 5EPBA 5ACYA 5I29A 4HXPA 5I40A 3LGFA 4YYDA 3SD4A 4NYXA 4NUEA 1WJRA 4ZC9A 4ZW1A 4UITA 4O7EA 4RG2A 5DX4A 4QR3A 5EWWA 4HXLA 1G5VA 5HLSA 5HELA 5JWMA 5H1UA 2MWOA 5E9MA 4QQGA 4QSQA 4YYKA 5FE8A 4PY6A 4LRGA 4YBMA 5KH6A 5EWDA 2N9GA 4A9MA 2RHUA 3MO8A 4NR6A 4QVZA 2EQJA 3L2WA 5DKCA 5G4RA 5HEMA 4YYGA 3MULA 2YYNA 2YDWA 2PQWA 4HXSA 4UYEA 4IUQA 2QQRA 2L3RA 4NUCA 5DYAA 3MP1A 2R5AA 5A5RA 5HM0A 4QC3A 5CUGA 5E7DA 2BKDN 3UT1A 3M9QA 4NYWA 5D26A 5I86A 4LD6A 3O34A 4UYGA 4C5EA 4YYIA 4QW2A 3HMEA 5LKZA 2HQEA 2DWWA 2RNXA 4XY8A 5E3GA 5FDZA 2M0OA 4MEOA 1JSPB 3UVDA 3KUFA 3S3MA 2F6JA 3U5LA 5C8GA 2KTBB 5CFWA 2RHYA 3DB4A 4YC9A 5CP5A 4CURA 3Q1JA 4IUUA 5IAYA 4QSPA 4YBTA 5D6XA 5EWVA 2E5QA 5D3SA 5ENCA 4LZSA 3LXJA 5L8UA 4QSVA 1EQFA 5HRVA 3JVLA 4LYIA 3P1CA 4IUPA 1OYXA 3MP6A 4C5IA 5E0RA 5EVAA 4YATA 5K29A 4Z6HA 2DVQA 4AKNA 5F3AA 4UC4A 4IORA 4IR5A 4PLIA 3OS0A 5BT4A 4TTEA 2YEKA 2YEMA 3LQIA 2D9TA 2GFUA 5D3LA 2H60A 5HRXA 5DFBA 5CU8A 2DAQA 2P0KA 4UIYA 4YY6A 4QSTA 1WJQA 5C85A 4QEVA 3AQAA 4IOQA 4UYFB 4UYDA 4IR3A 3MEVA 4OUFA 3LGLA 3SVHA 4KCXA 4NR9A 5EQ1A 4BE2A 5CQ6A 5EICA 2GRCA 5CQTA 5CQ3A 2RI3A 4RVRA 3MEWA 5DLZA 5FE1A 4IUTA 3OYEA 3ONIA 5DBMA 2R0YA 2L5EA 4TQNA 5LJ1A 2E7OA 5IG6A 2XDPA 3OYGA 4MEQA 4QSWA 4MR5A 5IGKA 4TU4A 4O70A 3MQMA 3DB3A 3S3OA 5FRMA 3Q2EA 4KV1A 5ETBA 2X4XA 3QJ6A 4MR3A 3O33A 5E9KA 5CGPA 4OGJA 5FG5A 3LX7A 4N4HA 2RJEA 3UV5A 5D7XA 2FHDA 3META 4BDZA 4PKLA 3DWYA 5HQ6A 5C7NA 5HENA 3MEAA 5HJCA 4J0RA 5EV9A 4Z6IA 4ALHA 4TZ2A 3OYCA 5CUCA 5D25A 1MHNA 5CTLA 1ZS5A 4CL9A 3MB3A 2RHZA 3O35A 2G4AA 5DY7A 4XUAA 4OVAA 2NLUA 4LDFA 4PLLA 5FROA 4O7AA 4O78A 4TT2A 5CQ5A 5FFYA 3DAIA 4FLPA 4E7IA 2MJVB 1X0JA 2L84A 4TT6A 5ENEA 2IG0A 5CRMA 3H6ZA 4N4IA 5L96A 3MB4A 5H1VA 4A4EA 3P5OA 4CFLA 2RHXA 4IOOA 2RJFA 4YH4A 4CFKA 5F61A 3LQJA 4O77A 5KCHA 4A9JA 5EISA 3FEOA 5A5SA 3OMCA 5E9YA 5A5QA 5HFRA 2WACA 2RS9B 3UVXA 2D82A 5I1QA 5C0MA 5D24A 3OYDA 4X2IA 4F3IA 4B9XA 2EQUA 4O74A 5EGUA 3U5JA 5D3TA 5LKXA 3S91A 5KO4A 5A5NA 5A83A 5TB6A 5D3HA 5EA1A 5HFQA 4A9HA 3P8DA 4HXMA 4O75A 3RCWA 5EPSA 5H85A 4EDUA 5E9LA 4QSUA 2O4XA 4QSRA 2L85A 4PTBA 5EWHA 4J1PA 2BUDA 4BDYA 2DIQA 5IGLA 5E3DA 3HMFA 5L99A 4A9NA 2RJCA 3E9GA 4Y03A 5DKHA 4NQMA 3QZVA 3G0JA 3UW9A 5IGMA 4IURA 2YW5A 4UIWA 5CZGA 5LVRA 4HBXA 4UIVA 3LLRA 4QC1A 5C87A 5CQ7A 3P1DA 4QNSA 5CQ8A 5FFVA 5BT3A 5ENBA 3MUKA 4J3IA 5DLXA 4BW3A 2K3YA 4YADA 5A81A 4E7KA 5FE0A 3GOXA 3UVWA 5FG6A 5D6WA 4GY5A 3MEUA 5F62A 2DVRA 5HRWA 2M16A 4Z93A 4MR4A 5F25A 3OQ5A 1RI0A 3K2JA 4QYLA 5G4SA 3C4SA 5KTWA 5FB0A 1OZ3A 5D3NA 3LQHA 4NQNA 4UIZA 3FDRA 4ALGA 4UIUA 4CUSA 5LKTA 5FE7A 4NRCA 2R57A 4E7HA 4UIXA 5FBXA 3UV2A 5DFCA 3L2QA 2O4XB 4Z1SA 3S3NA 2E3KA 2RFJA 3SVGA 5CUEA 4IKFA 4II1A 4NR8A 2DVSA 5E9IA 3O37A 5FFWA 4HXNA 5FE9A 5HQ5A 3U5PA 2K3XA 4CLBA 4L59A 4BW2A 2G3RA 5ENFA 4YYMA 3IU5A 5ENHA 3O36A 5E74A 1E6IA 4A4GA 4YYNA 2X35A 4E96A 5FE2A 4HXRA 2R5MA 5I80A 3UWNA 4E7JA 4E7LA 5KE2A 5C4QA 4C5HA 4A4FA 3P1FA 4TT4A 5AD3A 5CQ4A 5KHMA 1N27A 5F36A 5F5ZA 3OB9A 2LVMA 5ENJA 4ZTFA 2F5KA 5L97A 4X34A 4QY4A 4TYLA 4NS5A 1WGSA 1F68A 3U5KA 4HXOA 4HXKA 5A85A 4Z02A 3OS1A 4DONA 4BW4A 5IGNA 5A5OA 3PNWC 4HBWA 4ZQLA 1JM4B 3SVFA 5A82A 3CEYA 4FU6A 2E6NA 4A9OA 3Q2FA 2LTOA 3ME9A 4N4GA 3PFSA 5EU1A 2NXBA 1KHCA 2M1HA 3PMTA 2YELA 2FSAA 3OMGA 3OY9A 3QZSA 5FG4A 4MENA 4FL6A 5CUAA 3UV4A 2RO0A 5COIA 5F60A 3U5OA 5BT5A 3HMHA 4NR5A 4Q0OA 5AMEA 3UVYA 2R10A 5E73A 5EWCA 4QUUA 4WIVA 4LC2A 4A9KA 4YY4A 3L2VA 5LVQA 4ZTJA 5IIDA 2DVVA 5ETDA 4OGIA 2R58A 2R0SA 5A5PA 5CY9A 3LH0A 4O7FA 4MR6A 5CUBA 5KTUA 3QKJA 3L42A 5J0DA 4O7CA 5A7CA 5D0CA 3OYNA 3EAEA 2DATA 3G0LA 4BW1A 2EFIA 3JVJA 5CRZA 3E9FA 5DKDA 4QZSA 5AD2A 4UYFA 5FH8A 3JVKA 3GG3A 4O72A 5DYCA 2RI5A 5II2A 4IUVA 4Q5WA 4TZ8A 4N3WA 4A9FA 2RHIA 2DIGA 3QZTA 4NR4A 4CUUA 5IBNA 3H8ZA 4PCEA 5FE5A 3OA6A 2I8NA 3ASKA 5FE3A 1OZ2A 3I3JA 4PCIA 4A4HA 2GF7A 3FLGA 5LUUA 5CIUA 5EI4A 4O71A 2HQXA 4BE0A 5HCLA 2E7NA 5CUDA 3P1EA 4TS8A 3NTKA 5DW2A 3OYIA 2LRQA 3LJWA 2VYTA 4A9IA 4NR7A 2XK0A 3L2UA 5AMFA 2BIVA 4O7BA 3OYBA 3FC3A 4GPJA 2MWPA 2I7KA 5DYUA 5TCMA 2LDMA 5D3RA 4NRAA 2X4WA 5J26A 4LYSA 1WUGA 4XUBA 4YH3A 4A9LA 3NXBA 2D9EA 3IU6A 4LZRA 2RO1A 5DFDA 5EP7A 4YK0A 5D6YA 5KU3A 4HCZA 4NRBA
chains in the Genus database with same CATH superfamily
4LDUA 1UB4A 3EH1A 4DQ2A 4XY9A 4ZGEB 3OYKA 2K3BA 4OB3B 3MXFA 2HBPA 4A53A 1XTDA 5FWBA 3JAME 3V7RA 1BU1A 5IH2A 3E1SA 3F70A 2FPDA 3E2UA 4C67A 1WZOA 2E65A 1NEGA 4YAXA 4CUTA 3E19A 1X27A 3CC2A 2PUOB 3VJPA 4LZ2A 3OYLA 1YJ9A 2WP1A 3D7CA 3CCUQ 5LKUA 4J9DA 5I7YA 4O5VA 2OX7A 2DRKA 4F17A 2LCSA 4XYAA 2QQAA 2YRDA 1XJWB 4CUQA 3OS2A 4C66A 1K76A 3D1DA 1BB9A 1UUEA 3OYHA 3SB2A 5HCKA 1W2BA 5GAMg 1X2QA 2COWA 2KEAA 1QWFA 4PS5A 2HSEB 4YYJA 3JVMA 4RTZA 1BCMA 3CCUT 1MMGA 1NLOC 3PT9A 2PNIA 1M90C 1XOVA 1H3ZA 4M77E 3G4SA 1K9AA 2YWWA 1JXOA 4TU6A 1B07A 1NJIC 2QAZA 5EM3A 1V76A 5CS8A 1NE8A 4WCIA 3OYMA 4FYYB 5IN1A 1R77A 2NUPB 3RBBB 4ZN3A 5LJ3d 1XNIA 4NXJA 5EK9A 5LJ2A 5AT1B 4OMFB 2WP2A 4LR6A 4F16A 1OI1A 2EKOA 1K9MR 3CMAT 1VQ7A 2YRVA 5D3JA 1ACMB 3M0SA 2P0PA 1I8FA 4HBYA 4MZPA 2RNWA 2I0NA 2FPFA 2F69A 1JBMA 2KGTA 3GLXA 1WJRA 4ZC9A 2YUOA 3GIBA 4RG2A 5EWWA 2LCLA 3D1BA 3JCMW 1QMCA 1KD1U 5GMKm 2AKKA 2KXDA 2LP5A 1EIFA 2E5KA 2RQVA 5KH6A 2N9GA 2CH4W 4FT2A 4QVZA 1Y96B 4LUEA 4GLKA 1XQHA 5DKCA 2JS0A 4YYGA 2YYNA 2YDWA 2L3RA 2R5AA 4OMQA 5KYWA 1SSHA 5FLXE 5CUGA 2VVKA 4QVCA 2J05A 3A98A 4C5EA 4UYGA 2HSPA 1Q82C 4YYIA 3HMEA 3H41A 4OMMA 3VS4A 4MEOA 3KUFA 2XHCA 3S3MA 1YHQA 1VQ9T 3U5LA 1ZX6A 4ESRA 1YITT 5CP5A 4IUUA 2F2WA 2EYZA 4RTUA 5EWVA 2LQKA 5D3SA 3D7SB 4C8QC 3I55A 3LXJA 5L8UA 1RLQC 1LNXA 3M0PA 3P1CA 1OYXA 4C5IA 5FWCA 3JB9G 2AKLA 5F3AA 4UC4A 4PLIA 4TTEA 3G71A 2KNBB 4AKGA 2H60A 5HRXA 1YJNT 2C0TA 3H0HA 3CCLA 2CZ1B 5GAMe 2M51A 3OS5A 4J7FA 3EGDB 1BKBA 4RTWA 2DMOA 4UYFB 3MEVA 4OUFA 1CKBA 2E3HA 5CQ6A 2CZ6B 4XU0A 2GRCA 2YRCA 4IUTA 5FE1A 2XICA 2F2XA 3RKYA 5LJ5d 5DBMA 3JCMJ 2E7OA 1D3BA 1NPRA 4KGXB 4MR5A 4O70A 4FYXB 1FYNA 3LH5A 1E7OA 3NPFA 3QJ6A 4B6MA 1SHFA 4QKUA 3EG3A 1VQOQ 1N5ZA 2HQHA 2KY9A 5GANd 3O33A 3CC4Q 1OQKA 4OGJA 3CPFA 4RTVA 5IXFA 4F14A 4PKLA 5L23A 5HQ6A 2JXBA 5C7NA 4KULA 5HENA 3UPUA 1Q7YC 1QKXA 5EV9A 1WXBA 2EVRA 3UATA 3R6OA 3OYCA 3CCVT 3VKHA 1M1GA 2J6FA 1ZS5A 5GANe 2G4AA 2NLUA 2QGGA 4O7AA 4O78A 1ABOA 3I55T 5FFYA 1UGPB 4E7IA 5KYWB 3H6ZA 4N4IA 4JJBA 3CMEA 3MB4A 1NPPA 2KAFA 2RHXA 4CFKA 2FO0A 3EGUA 1OX8A 3EHQA 1UGSB 3M0RA 2XDDA 2YDLA 5EISA 1H641 4JPBW 3JCMX 1K73R 1QP2A 3G71Q 1C1AA 4PJLA 5HFRA 2RS9B 3FIFA 1TWBA 3DKMA 3I9QA 3JCMQ 2KRMA 2KT8A 2HKNA 3OYDA 2V8IA 1PRMC 3M53A 2EQUA 4O74A 5EGUA 3NGPA 5KO4A 5HFQA 1Q86U 3RCWA 5EPSA 5H85A 4EDUA 1M90R 4J6YA 1QCNA 1ABQA 1RAHB 1NJIR 4BDYA 5IGLA 3HMFA 4A9NA 4RCBA 4RTYA 1YI2Q 5IGMA 1R8OB 2QYZA 2YW5A 2EJGA 4UIWA 5CZGA 4M7AC 4UIVA 3LLRA 3VS0A 5GMKj 4QNSA 3ERRA 5ENBA 3ER0A 2DNUA 4YADA 5A81A 3CC2Q 3M4YA 4L5GA 1GXIE 3CXCP 2M16A 4J9GA 5GAN8 4M7AG 5F25A 2Z0WA 3K2JA 4JLGA 1YFNA 4J8OA 2FZGB 5KYUB 3PVLA 5KTWA 3C94A 1Q7YU 1OZ3A 1WFWA 1WXTA 5GMKl 3LQHA 4NQNA 4JRKA 1ZSZC 2FRWA 4M75D 2O9SA 1I0CA 2OTJT 1AZGB 3CC4T 3SEMA 2DPPB 4XU3A 2O4XB 3HL8A 3SVGA 4J5YA 2CS7A 5A2QE 3A8GB 1QVGS 3O37A 3U5PA 2G3RA 4YYMA 1EFNA 1UGQB 1AEYA 4LDVA 4RUGA 3O36A 2A3LA 5GANh 4YYNA 5FE2A 4HXRA 2R5MA 4OMOA 1VQ5T 4HCKA 3VUZA 4E7JA 2DBKA 3JCMh 2NYSA 1VQLQ 4C5HA 1BYMA 4TT4A 5CQ4A 2FZKB 3OB9A 4ZTFA 2KK4A 4HVUA 4XU2A 5D7UA 3U5KA 4PFZA 4PJOE 5A85A 4BW4A 1FMVA 1JM4B 2LX7A 2HZYA 3TSWA 3G6EA 4F04B 5CKDA 4A9OA 3Q2FA 3M56A 4N4GA 5EU1A 3PTAA 2M1HA 3M58A 4XU1A 5FG4A 1PCXA 1UDLA 5CUAA 4M7AB 3THKA 5COIA 3OW2S 4M77A 5EWCA 4A63B 2A0FB 1JJ2A 3CXCS 2DJQA 4A9KA 2QA4Q 4YY4A 1PD1A 4ZTJA 4GLMA 1BIAA 4AKHA 3J80E 3LH0A 1WDXA 4O7FA 3QKJA 4JS4A 2VKNA 2GTOA 2DATA 2EFIA 3J7AF 1EZZB 2ECZA 5CRZA 4QZSA 1RL2A 5FH8A 5A0LA 1OOTA 1ZSGA 4O72A 2K9GA 2CT3A 4PJOF 2HBWA 1Q7YR 2EQIA 2P84A 3CPWS 5FE5A 4C8QG 5LUUA 4RTXA 4CC3A 5EI4A 4O71A 2HQXA 1UFFA 4AFSC 2E7NA 5GAMf 3NTKA 5DW2A 1PSEA 4DA4A 2LRQA 3HP9A 1JO8A 5IT9E 2ZPFB 3L2UA 5AMFA 3MKDA 4J9BA 3OYBA 2XI9A 4GPJA 5DYUA 2LJ1A 4M7AA 4VUBA 3GF5A 2G6FX 1ZBXA 2L3PA 2DBMA 1K73C 5J26A 3HRTA 5LL6S 5D6YA 2KXCA 4YK0A 3WVDB 5GAN4 2QA4A 4HCZA 1I1JA 3TLPA 5II1A 5LJ0A 2CDTA 1VQOA 2EGAA 4BACA 3VU3C 1ZUKA 5LJ3f 1HYOA 5I83A 2HD0A 3OYJA 3FKMX 2BZYA 4QR4A 3FB9A 5CKEA 4AG2C 5ECAA 5CAIA 5L8TA 1IGUA 3O5ZA 5LJ5e 4JS5A 4Z1QA 4BE1A 2CREA 2XKOC 1N72A 4ANJA 1CSKA 4J6XA 2GFAA 3MP8A 5KE3A 2DKWA 2RF0A 4YYHA 1SKUB 4TVRA 4PJNA 4C5GA 3S92A 3SFMA 1PKSA 1I81A 1KD1R 2CT4A 4Q0NA 2PUKB 1BK2A 2LCCA 5FU6B 2YT6A 5GANg 4B9WA 5HK0A 5D3PA 3JCMg 2COZA 3DLMA 3P8HA 3QBYA 1K8AC 5FE4A 3ZEHA 3AADA 4QQ6A 5I88A 1TUCA 4O76A 4CRIA 4QQDA 1UTIA 5I7XA 4AKIA 2F6NA 5DM7R 2QQSA 2OUOA 2EQMA 2LQNA 5KYYB 2DD5A 2ZCFB 4M7DD 1WUMA 4FYWB 4D8DA 4KV4A 3OYAA 3SWNA 3U5MA 4WHUA 1SSFA 4C0FA 3NFCA 3NTIA 3O8VA 2ED1A 3CCST 1YIJA 3AHUA 1NLPC 1IHVA 1KHIA 2RNYA 3X28B 1WA7A 2YQDA 3U5NA 3CCRT 4X9CA 1ZSZB 2K5FA 4IUVA 2DL5A 4HXPA 5I40A 1YJ9T 4YYDA 4XTZA 1KFZA 1NEBA 4A54A 2JN0A 1S72Q 3SD4A 3JCMc 4ZW1A 4O7EA 5DX4A 1RAEB 3CCLT 4HXLA 1G5VA 5HLSA 5JWMA 2DM1A 5H1UA 4DOWA 2MWOA 4FCYA 3VRYA 5E9MA 4QQGA 4QSQA 1VQ5Q 5FE8A 4PY6A 3HTRA 1KJWA 3VV0A 5I11A 4A9MA 3NHNA 2K5IA 4OF1A 2QXFA 1N9SA 4AG1C 3MO8A 4JRPA 2EQJA 3L2WA 3CBOA 5HEMA 1W2BP 3M4GA 2JUFA 1G3SA 4HXSA 3X25B 1PWTA 2QQRA 5DYAA 1M1KR 1UE9A 3MP1A 4RKUE 5A5RA 5HM0A 4QC3A 1D1BA 1GFDA 2CP5A 4NYWA 4M7DG 1JXMA 4HCCA 3VS2A 2ZPEB 1MGQA 2C0IA 2DWWA 2RNXA 1MMNA 3OBWA 2HDAA 1JSPB 4LN2A 1AT1B 1YWOA 2Y4XA 3I5RA 1YJWT 2E6ZA 3DB4A 4Y91A 4M77D 2CH4A 1X6OA 4LZSA 3TSZA 2DZCA 1G2BA 2JS2A 2QEXQ 4AKNA 2DVQA 2EJ9A 1WPYA 4IORA 2AHJB 2EGCA 4M75F 1FMWA 2YEKA 3LQIA 1AWXA 4JZ3A 1YBYA 1SG5A 4DBQA 2JOYA 5DFBA 1YITQ 2QTVA 1C0MA 2KBTA 4F7UB 1TUGB 2OTJA 3I35A 4YY6A 4J9IA 4QSTA 1WJQA 5C85A 4ORZA 3AQAA 2DE0X 4IOQA 1K9MU 2FRYA 3LGLA 3MJXA 4M77C 4FT4A 5EICA 4J9EA 5GAOq 1W2BS 2R0YA 2DEUA 2L5EA 4TQNA 5LJ1A 2EJNA 2XDPA 4QSWA 3VYGA 2CSIA 3VYHB 3CBPA 3MQMA 5FRMA 4KV1A 1WLPB 2DL4A 1QQJA 1S1NA 5IHIA 3CMAQ 1V1CA 3L1AA 4AFQC 4FSSA 5E9KA 3EG9B 1M2VA 2YLBA 3CBMA 2RJEA 4BDZA 5D7XA 3CD6A 5HJCA 4J0RA 4Z6IA 3V7SA 4ALHA 2KI7A 4M78E 1QCOA 1YJWA 5CTLA 1M8MA 1GCQC 1Y96A 4MMLA 3DLLA 2JM8A 2DFUA 1W1FA 1AWOA 5GJWB 1RLPC 4PNOA 3T9NA 2QEXT 1PSFA 3C0CA 1MNEA 2VGNA 5H1VA 2CSQA 2P4TA 4CFLA 1QKWA 4LNPA 3CC7A 5CK9A 3LW5E 1M2VB 5KCHA 4O77A 4PJOA 5IXBA 1VYVA 2E64A 2OAUA 4M4ZA 5E9YA 2NUTA 5A5QA 3V7CA 3A8HB 2YHTA 3UVXA 1QVPA 4F7UG 5LJ5f 4C8QD 5D24A 2OTJQ 5FU7B 4ME7A 1KD1C 3CCMA 3BDUA 3U5JA 2A37A 5A5NA 5A83A 2OTLQ 1P92A 3P8DA 3VS7A 2VUBA 3M5AA 1AHJB 4P5NA 3RUXA 2P0QA 1T0HA 3OW2P 4QSRA 1N8RU 2L0AA 1B7TA 2RQUA 1D09B 2DIQA 5L99A 5GAN2 2KRSA 3EGXA 4GBQA 2CP3A 4NQMA 2GTJA 4IURA 3G0JA 3X24B 2GCXA 2DF6A 3PGGA 4HBXA 4KT0E 4QC1A 4DBHA 5C87A 2PTKA 4OMLA 1UEBA 5CQ8A 3CD6Q 4EMHA 5GAN7 3SHWA 2QDLA 4J3IA 1WQ7A 3BFMA 4BW3A 3CCRQ 4XAXB 5IHNA 2WSEE 5D6WA 1S72T 5F62A 4HCBA 2DVRA 2MOXA 4Z93A 5KYXA 1DJ7B 2KQWA 2PVGB 1Q82R 2CUBA 1JJ2P 1D1CA 3FJPA 5FB0A 1TOVA 5D3NA 1SHGA 3FDRA 1ZKRA 1B34B 3A5ZB 2LT1A 1KQ2A 4BY6C 1VQ6A 4M78B 5LKTA 4UIUA 5FE7A 3A1PA 1SEMA 2F2VA 2R57A 4LDYA 4E7HA 1KIKA 2QA4T 3UV2A 4JRIA 5DFCA 4LDXA 3L2QA 2EGEA 3S3NA 4BI3A 2E3KA 2RFJA 4IKFA 5CUEA 4M78D 4NR8A 4M75G 1KC8R 2KRNA 2DTOA 1PM3A 2V1QA 4ELYC 5ENFA 1UHFA 3IU5A 4M7AE 1E6IA 4PFOA 4J9FA 4E7LA 2E70A 4DEYA 2CP0A 5C4QA 2DL7A 3EHRA 8AT1B 1N27A 1W4SA 3GP8A 3EG0A 2LVMA 2XIDA 5ENJA 2F5KA 5L97A 2OJ2A 3QWYA 3RIRA 4NS5A 1WGSA 2XG8D 1H92A 2DLPA 1HD3A 4DONA 4AT1B 3PNWC 1E6GA 4ZQLA 4NOYA 5A82A 2D8HA 3OSVA 4HXJA 2Y4YA 1VQ8Q 1KHCA 1K73U 2YELA 3VKIA 1TSFA 3H9NA 2RO0A 1FMKA 3HMHA 3UVYA 5CKBA 1JQQA 2LMJA 2DA9A 1QVGA 1UJYA 1KSWA 2H3EB 3RMQA 3KXTA 2DKGA 2DVVA 4XK8E 2R0SA 5A5PA 5CY9A 4PJMA 4M7DF 2E3IA 2ZZDA 4HVVA 3L42A 3OYNA 4PK4A 3G0LA 4PJJA 4ZGJB 4BW1A 4PJOC 2J6OA 3E9FA 4YTLA 4BI8B 2L5QA 2RH2A 4RMOA 5GJVB 3GG3A 1O9SA 1TH7A 2QQ9A 1BBZA 4TZ8A 4A9FA 2RHIA 2DIGA 4NR4A 5IBNA 2RK2A 4R56A 5GAMd 3ASKA 3OYYA 5FE3A 3I3JA 4PCIA 4E6RA 2O2OA 3FLGA 5CIUA 3CCJT 1VA7A 1PKTA 2DYIA 2EIFA 2BE7D 4BUGA 4V2SA 1VQLA 3OYIA 2EBPA 2GBQA 4A9IA 1TU0B 2BIVA 1SRMA 4E2FB 1QVFA 4M7AF 2RQRA 2O01E 2MWPA 2I7KA 3TU4K 3U23A 1IRXA 2K79A 1M2OA 5TCMA 4OB1B 3JCMP 4NRAA 3EGXB 4X9DA 3CCLQ 2YXYA 2PU9B 4IIMA 3EG1A 4LYSA 4YH3A 3NXBA 1KQSS 3IU6A 4LZRA 3I55Q 2CP7A 4BI4A 4XTVA 5EP7A 4C8QE 3URGA 3CCMQ 3A8LB 2JZ2A 1HJDA 2K2MA 5E9VA 3L2RA 3OSSC 1YNZA 5F1HA 4YABA 4BD3A 1ZSZA 4QUTA 3LWHA 9ATCB 1IXDA 5DW1A 4QR5A 5EPRA 5FH7A 4PJOB 4NL2A 5M9OA 2X4YA 1WQWA 1BIBA 2ROTA 5J39A 2EYXA 2OTLT 3PMIA 3QXEB 1U06A 1AD5A 5KYUA 2DXUA 3QDRB 1VQ4A 4QSSA 1R0CB 1WX6A 2O9VA 2RM4A 2YUQA 3LYIA 4HBVA 3QO3A 4J0SA 2QI2A 3VRZA 4C92C 1D0YA 5KTXA 5HQ7A 3RR6A 4MEPA 1M27C 5CCAA 1GBRA 3EFOA 4QEUA 1M4ZA 5FH6A 3OYFA 2V8JA 1MMDA 4HVWA 1Y71A 4QBMA 5F1LA 3VS1A 4N4FA 4O6JA 5I89A 2D0QB 1FWZA 1X6GA 2L2PA 1GBQA 3I56A 5C6SA 2EPDA 3KFVA 5HY6A 3NTHA 5FE6A 2DZ9A 2PVOB 3S6WA 3CMEQ 2OO1A 4NYVA 4LUDA 5CR2A 1WHLA 2JT4A 4RCCA 1HXDA 4MZMA 4R55A 2K5LA 2EYQA 5H1TA 2LQ8A 3CCJQ 2RJDA 5F63A 1AWWA 5DY9A 1N8RR 5A0DA 5DYXA 1UHCA 2XMFA 3CPWA 4F7UA 3QYHB 4YBSA 4WHWA 1QLYA 5EPBA 4EMKA 3LGFA 1K0SA 3CCQQ 2LJ0A 3HPWA 4NYXA 2K2VA 4PJOG 4M78A 4XTUA 3RKXA 4UITA 2KYMA 2VV5A 5GAOp 1D0ZA 2RK1A 4C8QF 8ATCB 1O75A 2NUPA 1JU5C 4OB0B 2FB7A 4C8QB 1BCOA 4LRGA 4Z8AA 2VWFA 2AZSA 2DERA 1PD0A 2JMAA 1I07A 4NR6A 2LJ3A 4J7IA 2CYZB 3MULA 1OPLA 1A0NB 2PQWA 1EX4A 4JJNK 4NUCA 3JCMf 1NZ9A 2E1HA 1VQNA 2O88A 5GAOl 3QWXX 3UT1A 2AIRB 2BKDN 3M9QA 3CCEQ 3A8MB 1GCPA 5D26A 4ZNXA 5J3BA 2MYSA 4J9CA 2L3SA 4LD6A 2HL5C 2KMTA 4QW2A 2HQEA 3TREA 5E3GA 5FDZA 2M0OA 3UVDA 2F6JA 2KTBB 1Z9ZA 3CCVA 2RHYA 4EPCA 2JW4A 4YBTA 3CCSA 4LDWA 4OB2B 2QEXA 4KUIA 4LYIA 4Z89A 4E7SA 4XTYA 4FW1A 5EVAA 5GAOn 4KRTA 2DTIA 5BT4A 2GFUA 1Q95G 2D9TA 5CVIA 1Q82U 5D3LA 4M7DE 3CCQA 2DAQA 2P0KA 3ZFJA 5CQXA 4QEVA 3M55A 3G4SQ 4UYDA 4IR3A 2KSSA 3RESA 3SVHA 1M5Q1 1X43A 4NR9A 5EQ1A 4OMPA 4BE2A 1AVZC 5CQTA 5CQ3A 5KYNA 2RI3A 4RVRA 5DLZA 3OYEA 4M78G 3EFOB 2PVDB 4C0DB 5KYYA 1YWPA 5IG6A 2HEQA 3CCUA 3M0UA 4OGEA 3OYGA 4MEQA 4TU4A 4J83A 3MHXA 2FG0A 3Q2EA 5ETBA 5L8RE 1QWEA 2X4XA 4C92E 1Q81U 3C95A 3QZ9B 4MR3A 5CGPA 3KBGA 5FG5A 1WI7A 1RAIB 3META 3UV5A 2FHDA 4N0AC 2JNGA 2VXFA 1YJ9Q 1IO6A 3DWYA 3PVQA 1M90U 3QG1A 2PZ1A 5LJ5h 1Q86R 1D0XA 4QVDA 1LOJA 2D0NA 1MHNA 4Z88A 2QK0A 1FX7A 2RHZA 3O35A 2ROLA 5DY7A 4XUAA 2W0ZA 4LDFA 1AWJA 1NBEB 1K8AR 5CQ5A 1MV0B 3DAIA 2L84A 4TT6A 2RD1A 1GFCA 3CCSQ 5CRMA 1M1KU 5L96A 3QJYA 4A4EA 2DK3A 4C92G 2K57A 4YH4A 2XDBA 3LQJA 4A9JA 3FEOA 5A5SA 3OMCA 5I2MA 3VS6A 1Q81C 2WACA 2DTHA 2EW3A 2ESWA 4WTOB 3FJ5A 5C0MA 1VQ7Q 2ABLA 4X2IA 4F3IA 2DVEA 2XU8A 3S91A 2J06A 2MMPA 4XTXA 3WVEB 5TB6A 1IHWA 2RN8A 5D3HA 5EA1A 4A9HA 1JB0E 1I5OB 4O75A 2ED0A 5E9LA 4QSUA 3JCMV 3TCJA 4BB7A 2DXCA 3BY7A 2L85A 4PTBA 1OU8A 3ZBDA 2GQIA 3QZ5B 3R6NA 3CCET 2MCNA 3BE3A 1MNDA 1QW1A 2RJCA 4Y03A 5DKHA 1WHKA 3UA6A 2I2LA 3UW9A 2J7IA 1G83A 3C12A 2A28A 1VQMA 4M7DB 3P1DA 2NUZA 1M9SA 5FFVA 5BT3A 1G3TA 3MUKA 3CCJA 1LCKA 2SEMA 2OI3A 1ZUYA 2CZ7B 2KROA 3HSBA 2FVUA 1QCFA 2DILA 3M54A 3UVWA 5FG6A 5LJ3g 4GY5A 1N8RC 5GMKi 2P4RA 4MR4A 1WXUA 1SRLA 3OQ5A 1W70A 2QDYB 3JB9J 5G4SA 1NM7A 2GNCA 3C4SA 3G71T 2RNAA 4IIOA 1ARKA 4UIZA 4KGVB 3JB9I 4CUSA 2YLCA 1QP3A 2KR3A 2A08A 4NRCA 4JZ4A 1YCSB 5HK3A 4UIXA 4C92B 5FBXA 2AZVA 2RQTA 2WSFE 2RQWA 3PIPA 2JM9A 4Z1SA 5CKFA 3IQLA 1YHQQ 5FFWA 2DVSA 5E9IA 5I22A 4HXNA 5FE9A 4BW2A 4XQ3A 5E74A 4A4GA 2ZPIB 3UWNA 5KE2A 1KQSP 2ZPHB 4EMKC 1U1TA 4A4FA 3P1FA 2EWNA 3CC2T 5KHMA 5F36A 5F5ZA 4C0ZA 5GAN5 2HMAA 3CQTA 4M77F 3JB9H 4QY4A 1TXQA 3RERA 1PHTA 4RG8A 1RAGB 4HXOA 2LNVA 3V8JA 1VQ4T 2RMOA 3OS1A 5IGNA 5FU6C 5A5OA 3RKWA 1IREB 1F1BB 4HA8A 3UF4A 3CEYA 4FU6A 1X2KA 2OAWA 3EG9A 2VB6A 3ME9A 2F5TX 2NXBA 2E10A 3G1JA 3PMTA 4EIKA 3QZSA 2EJFA 3JV3A 1KQ1A 2MAMA 5KYXB 2A7YA 5GMKh 5F60A 3U5OA 5BT5A 4NR5A 1CKAA 4Q0OA 4FW2A 1VQPT 1G3YA 1K9MC 2R10A 5E73A 2JTMA 3ULRB 2YUPA 1RAAB 5LJ5g 3CC4A 5LVQA 3V8KA 5IIDA 1PUOA 2KT1A 5ETDA 2DD4A 2IPOB 4L6V5 5KTUA 4ZN1A 5J0DA 1KC8U 1X75C 2E12A 3EAEA 2F1LA 1GRIA 2DXTA 1VQOT 1OEBA 1NYFA 2RA2A 2BZXA 2DRMA 2DJZA 1M30A 5DKDA 1VQ5A 3OBYA 3JVKA 3SDZA 2XD0A 1OX9A 3INZA 3MCAB 1B34A 1Y7XA 1VOMA 4N3WA 4FYVB 4M77G 1ZBJA 2EKHA 3H8ZA 3HKSA 3OA6A 3EG2A 1I4K1 1OZ2A 1HSQA 4A4HA 1YIJQ 1PG5B 4E47A 2DEQA 3TQ7P 4BE0A 1YJNQ 5CUDA 1AOJA 3P1EA 2K6DA 2MIOA 1S72A 2WSCE 2XK0A 3V8LA 1J3TA 4DOVA 3NMZC 1W6XA 4KBMB 4M7AD 2LT4A 2LDMA 5D3RA 4CI0C 4KH0B 3I5SA 4XUBA 4JJDA 4EMGA 4A9LA 2D9EA 3VS3A 4ZGDB 3MPUB 5LJ3j 2FL7A 5DLQE 4F7UE 1U5SA 1YI2A 1VQ9Q 1UECA 1TTHB 3JB9F 1YHQT 4QYDA 2ZAEA 2MPXC 2RPNA 5L98A 2LZ6B 5LJ3h 1ZUUA 3JCMb 2OSSA 1YITA 4BHWA 1JJ2S 4QSXA 4WF2A 1M3AA 1K1ZA 5GAN3 2L89A 5A0GA 2LSPB 3M0TA 4IR6A 3CMAA 4PL6A 3HFNA 2QTXA 3ZYUA 3QIIA 1X69A 2EQKA 2GQVA 1BI3A 3QDFA 4NUDA 4OP0A 4A4KA 2LC4A 1M3CA 1SF9A 2V1RA 5C89A 1KC8C 2DVJA 1H8KA 2Y90A 3HRSA 2A36A 5CQAA 5FB1A 2VGMA 2JJ9A 2JTFA 2EYYA 4M75B 4KH1B 3VS5A 3PIOA 1WNLA 4BJXA 4M75E 1BI2A 1VYTA 4NL3A 5EG2A 3M0QA 2R0VA 1MMAA 4ATOA 4A9EA 4QT7A 1VQPA 1QVFS 5F2PA 2YUNA 4N0AA 4LYWA 2X4JA 3M59A 5KCOA 1VQNT 2DXBA 4CUPA 2K4YA 1U1SA 4IR4A 2L8DA 4QB3A 5ENGA 2RI2A 3BDLA 4MDWA 5CPEA 4UYHA 1RACB 5FRNA 2E41A 2EYWA 1QVGP 1VQ9A 3ZL7C 4M7DA 2COYA 5CQYA 2B8AA 2H8HA 1UG1A 1PNJA 5JI8A 1B3QA 3G6EQ 5GAOr 2L3QA 1NJIU 3LWIA 3EGDA 1WHHA 2JTEA 2M02A 1VQMQ 2CKKA 1VQKT 1WJSA 3CMET 2RI7A 4QEWA 5ENIA 5I29A 5ACYA 4NUEA 4M78F 1YJWQ 2MF2A 2OTLA 4XTWA 3GNFB 4QR3A 1VIEA 2YSQA 5HELA 4M75C 4YYKA 4YBMA 5EWDA 1M1FA 1ZLMA 3CC7Q 2RHUA 3VKGA 3FRNA 2HNIA 3CCMT 2H3JA 1N6AA 4D6WA 5G4RA 3REAB 1I5LA 2GGRA 4UYEA 2FPEA 4IUQA 4AMCA 1VQNQ 2DL3A 1VQ4Q 1IZ6A 2X3WD 3G4ST 3X26B 4LE9A 1N9RA 5E7DA 2D1XA 1KG1A 5I86A 1G8XA 4D8KA 2NWMA 1T3SA 3O34A 1YI2T 5LKZA 4XY8A 1VQKQ 2HKQB 3PE0A 5DLOA 1IGQA 3GNGA 5C8GA 5GMKe 5CFWA 1WYXA 1TUDA 4JDSA 4YC9A 4CURA 3Q1JA 5IAYA 3BW1A 4QSPA 3EFRA 3J81E 4R0KA 3JCMe 1BI0A 5D6XA 2E5QA 5ENCA 3M57A 4QSVA 1EQFA 5HRVA 2DETA 1OULA 3JVLA 4IUPA 3MP6A 5E0RA 2X9HA 4YATA 3SWNC 3GPLA 5K29A 4Z6HA 3OS0A 3CC7T 4IR5A 2YEMA 2KDSA 2QGFB 5CU8A 1VQ6T 1LVKA 4C92A 4UIYA 2D6FA 4CC4B 4CC2A 2VXEA 1NG2A 4KCXA 1BI1A 1VQ8A 3EH2A 3MEWA 2DO3A 3QUIA 3ONIA 1GL5A 4DBRA 2O31A 1VIFA 5IGKA 3UA7A 3H0FA 3DB3A 3S3OA 3REBB 1C6VX 1D1AA 4Y28E 5HKCA 2FYKA 4DEXA 3AT1B 4HT9A 2BTTA 3LX7A 3TVTA 4N4HA 2X3XD 3MEAA 4E7ZA 1RI9A 4TZ2A 1X01A 5CUCA 5D25A 1RABB 2BZ8A 4CL9A 2QG9B 3MB3A 5GAOm 4OVAA 4PLLA 5FROA 2CP2A 4X1VA 4TT2A 1YIJT 3P8BB 4FLPA 1VQ7T 2MJVB 3EFSA 1X0JA 5EC7A 5ENEA 4OMNA 2IG0A 2KE9A 1YN8A 2KVQG 1M8VA 3P5OA 4FIBA 2DX1A 4IOOA 2RJFA 2MI6A 2D8JA 2IVWA 5F61A 5LJ3e 4AFUC 3CCQT 2ZPGB 1YJNA 3HRUA 2BE9B 4PJOD 1T0JA 2D82A 4DBFA 1Y07A 5I1QA 1D3BB 3JSCA 4C8QA 4B9XA 2VASA 1VQ8T 1PC0A 5D3TA 5LKXA 1UGRB 3JRZA 2RB6A 2ZGWA 4HXMA 2O4XA 4EMKB 1Z9QA 3GBQA 5EWHA 5AYFA 4J1PA 4KGZB 2BUDA 5E3DA 1RADB 2VC8A 3E9GA 1LPLA 3QZVA 4KUDK 5LVRA 1E6HA 5CQ7A 1GCQA 2B86A 3RDVA 1PRLC 5DLXA 4HT8A 2SRCA 2K3YA 4M77B 2QASA 1YCYA 1AZEA 4E7KA 5FE0A 3GOXA 4LD9K 3MEUA 3N5BB 5HRWA 2KYBA 1WHMA 5GAMj 3OW2A 1RUWA 4J9HA 1RI0A 2HAXA 4QYLA 3CXCA 4HKEA 4JRQA 4JUVA 4PFPA 3JCMd 3SWNB 1IB8A 1OU9A 4ALGA 2DL8A 2E4HA 2K7AA 3HFOA 5I21A 3WXMB 4C0GA 1ZQ1A 1YP5A 4CC7A 2J6KA 3RMSA 3H0IA 4C92F 5FW9A 1VQPQ 4II1A 4Y92A 5IHKA 2DYBA 5HQ5A 1MV3A 1OPKA 2K3XA 4L59A 1MUZA 4CLBA 2IIMA 1R0BG 7AT1B 1KQSA 5GAMh 5ENHA 2ENMA 1WHGA 2X35A 4J6WA 4E96A 5I80A 2FZCB 2AK5A 4M78C 3I56Q 3HHTB 2FEIA 5AD3A 1UJ0A 3VUBA 1VQMT 3CD6T 4X34A 4MDXA 4TYLA 4FSXA 1F68A 2AT1B 3TEEA 4HXKA 4ELZC 4Z02A 1T3LA 4FM4B 2LNHB 4HBWA 1K0XA 3SVFA 1K4US 1OV3A 2E6NA 2EAYA 2LX9A 1VQLT 3RNJA 1KK7A 5CO7A 1FXXA 2LTOA 2QQBA 3PFSA 4K11A 1NYGA 2C06A 4JJCA 4BY6B 5CKHA 2FSAA 3OMGA 3OY9A 4MENA 1WIEA 4FL6A 5GANf 3X20B 3QPHA 1VUBA 3UV4A 1WHJA 2C0OA 1Q86C 1X6BA 5AMEA 1V29B 4QUUA 4AI6A 1HK9A 3QSUA 4WIVA 4LC2A 4LXCA 1ZA2B 2W10A 3L2VA 1K8AU 1M3BA 5GANj 4AFZC 5GAN6 4OGIA 2R58A 1U3OA 1U8RA 4MR6A 5CUBA 3A8OB 2CGHA 2HL3A 4O7CA 5A7CA 5D0CA 1JRIA 2JMCA 5FU7C 2ZPBB 3JVJA 1TS9A 4MMKA 3UDCA 5LJ5j 3JB9D 1QVFP 4C92D 1Y0MA 5AD2A 4UYFA 2MK5A 4F7UF 3CCRA 1Q81R 1VQKA 3CCEA 1JEGA 5DYCA 3G7ZA 2RI5A 5II2A 4Q5WA 3QZTA 4CUUA 1SPKA 4M75A 4PKCC 1UGVA 5I2SA 4PCEA 1Y57A 2M9UA 2I8NA 4C0DC 1M1KC 1LJOA 1H3HA 4MZTA 4OGCA 2GF7A 2NUTB 2CUDA 5HCLA 3G6ET 4TS8A 3QHSA 1VQ6Q 2LQWA 3LJWA 2VYTA 4NR7A 3L2ZA 4RTTA 1ZHIA 6AT1B 4O7BA 1ZA1B 3FC3A 2CZ0B 3CPWP 4M7DC 1VYUA 2ATCB 2V8KA 1RAFB 2JVVA 2HCKA 3CCVQ 2X4WA 2M0YA 1G3WA 2CP6A 1TG0A 4JLIA 1WUGA 3I56T 3QYGB 2RO1A 5DFDA 5KU3A 2V26A 2X51A 4NRBA
chains in the Genus database with same CATH topology
4LDUA 1UB4A 4DQ2A 4XY9A 4ZGEB 3OYKA 4OB3B 3MXFA 2HBPA 4A53A 1XTDA 3JAME 3V7RA 3E1SA 3F70A 4C67A 2E65A 4YAXA 4CUTA 3E19A 3CC2A 2PUOB 3VJPA 4LZ2A 3OYLA 1YJ9A 2WP1A 3D7CA 5LKUA 5I7YA 4O5VA 4XYAA 2QQAA 4CUQA 3OS2A 4C66A 3OYHA 3SB2A 1W2BA 5GAMg 4PS5A 4YYJA 3JVMA 3CCUT 3PT9A 1M90C 1XOVA 1H3ZA 4M77E 3G4SA 4TU6A 1NJIC 5EM3A 5CS8A 1NE8A 3OYMA 5IN1A 4ZN3A 5LJ3d 1XNIA 4NXJA 5EK9A 5LJ2A 4OMFB 2WP2A 4LR6A 1OI1A 2EKOA 3CMAT 1VQ7A 2YRVA 5D3JA 2P0PA 1I8FA 4HBYA 4MZPA 2RNWA 2F69A 1JBMA 3GLXA 1WJRA 4ZC9A 3GIBA 4RG2A 5EWWA 2LCLA 3JCMW 1KD1U 5GMKm 1EIFA 5KH6A 2N9GA 4FT2A 4QVZA 1Y96B 4GLKA 1XQHA 5DKCA 4YYGA 2YYNA 2YDWA 2L3RA 2R5AA 5FLXE 5CUGA 4QVCA 4C5EA 4UYGA 1Q82C 4YYIA 3HMEA 4MEOA 3KUFA 2XHCA 3S3MA 1YHQA 1VQ9T 3U5LA 1YITT 5CP5A 4IUUA 5EWVA 2LQKA 5D3SA 4C8QC 3I55A 3LXJA 5L8UA 1LNXA 3P1CA 1OYXA 4C5IA 3JB9G 5F3AA 4UC4A 4PLIA 4TTEA 3G71A 2H60A 5HRXA 1YJNT 3CCLA 2CZ1B 5GAMe 3OS5A 4J7FA 1BKBA 4UYFB 3MEVA 4OUFA 4XU0A 5CQ6A 2CZ6B 2GRCA 4IUTA 5FE1A 2XICA 3RKYA 5LJ5d 3JCMJ 5DBMA 2E7OA 1D3BA 1NPRA 4MR5A 4O70A 3QJ6A 2KY9A 5GANd 3O33A 4OGJA 3CPFA 4PKLA 3UPUA 5HQ6A 4KULA 5C7NA 1Q7YC 5HENA 5EV9A 3R6OA 3OYCA 3CCVT 1M1GA 1ZS5A 5GANe 2G4AA 2NLUA 4O7AA 4O78A 3I55T 5FFYA 1UGPB 4E7IA 3H6ZA 4N4IA 3CMEA 3MB4A 1NPPA 2KAFA 2RHXA 4CFKA 1UGSB 2XDDA 5EISA 1H641 3JCMX 1QP2A 5HFRA 2RS9B 3FIFA 3DKMA 3JCMQ 3OYDA 2V8IA 3M53A 2EQUA 4O74A 5EGUA 5KO4A 5HFQA 1Q86U 3RCWA 5EPSA 5H85A 4EDUA 4J6YA 4BDYA 5IGLA 3HMFA 4A9NA 4RCBA 5IGMA 1R8OB 2YW5A 2EJGA 4UIWA 5CZGA 4M7AC 4UIVA 3LLRA 5GMKj 4QNSA 5ENBA 3ER0A 4YADA 5A81A 3M4YA 4L5GA 1GXIE 2M16A 5GAN8 4M7AG 5F25A 3K2JA 4JLGA 4J8OA 5KTWA 3C94A 1Q7YU 1OZ3A 5GMKl 3LQHA 4NQNA 4JRKA 4M75D 2OTJT 3CC4T 2DPPB 4XU3A 2O4XB 3HL8A 3SVGA 4J5YA 2CS7A 5A2QE 3A8GB 1QVGS 3O37A 3U5PA 2G3RA 4YYMA 1UGQB 4LDVA 3O36A 2A3LA 5GANh 4YYNA 5FE2A 4HXRA 2R5MA 1VQ5T 4E7JA 3VUZA 3JCMh 4C5HA 1BYMA 4TT4A 5CQ4A 3OB9A 4ZTFA 2KK4A 4XU2A 3U5KA 4PJOE 5A85A 4BW4A 1JM4B 3G6EA 5CKDA 4A9OA 3Q2FA 3M56A 4N4GA 5EU1A 3PTAA 2M1HA 3M58A 4XU1A 5FG4A 5CUAA 4M7AB 5COIA 3OW2S 4M77A 5EWCA 1JJ2A 3CXCS 4A9KA 4YY4A 4ZTJA 1BIAA 3J80E 3LH0A 4O7FA 3QKJA 4JS4A 2DATA 2EFIA 3J7AF 5CRZA 4QZSA 1RL2A 5A0LA 5FH8A 4O72A 4PJOF 3CPWS 5FE5A 4C8QG 5LUUA 5EI4A 4O71A 2HQXA 2E7NA 5GAMf 3NTKA 5DW2A 1PSEA 4DA4A 2LRQA 3HP9A 5IT9E 2ZPFB 3L2UA 5AMFA 3OYBA 2XI9A 4GPJA 5DYUA 4M7AA 4VUBA 3GF5A 1ZBXA 1K73C 5J26A 3HRTA 5LL6S 5D6YA 4YK0A 3WVDB 5GAN4 2QA4A 4HCZA 3TLPA 5II1A 5LJ0A 1VQOA 4BACA 3VU3C 5LJ3f 5I83A 2HD0A 3OYJA 3FKMX 5CKEA 4QR4A 3FB9A 5CAIA 5L8TA 5LJ5e 4JS5A 4Z1QA 4BE1A 2XKOC 1N72A 4J6XA 2GFAA 3MP8A 5KE3A 2DKWA 4YYHA 4TVRA 4C5GA 3S92A 3SFMA 1I81A 4Q0NA 2PUKB 2LCCA 5FU6B 5GANg 4B9WA 5HK0A 5D3PA 3JCMg 3DLMA 3P8HA 3QBYA 1K8AC 5FE4A 3ZEHA 3AADA 4QQ6A 5I88A 4O76A 4CRIA 4QQDA 5I7XA 2F6NA 5DM7R 2QQSA 2OUOA 2EQMA 2DD5A 2ZCFB 4M7DD 1WUMA 4KV4A 3OYAA 3SWNA 3U5MA 4WHUA 1SSFA 4C0FA 3NFCA 3NTIA 3O8VA 1YIJA 3CCST 3AHUA 1KHIA 2RNYA 3X28B 2YQDA 3U5NA 3CCRT 4X9CA 2K5FA 4IUVA 4HXPA 5I40A 1YJ9T 4YYDA 4XTZA 4A54A 2JN0A 3SD4A 3JCMc 4ZW1A 4O7EA 5DX4A 3CCLT 4HXLA 1G5VA 5HLSA 5JWMA 5H1UA 4DOWA 2MWOA 5E9MA 4QQGA 4QSQA 5FE8A 4PY6A 3VV0A 4A9MA 2K5IA 4OF1A 2QXFA 1N9SA 3MO8A 4JRPA 2EQJA 3L2WA 3CBOA 5HEMA 3M4GA 2JUFA 1G3SA 4HXSA 3X25B 2QQRA 5DYAA 3MP1A 4RKUE 5A5RA 5HM0A 4QC3A 4NYWA 4M7DG 4HCCA 2ZPEB 1MGQA 2DWWA 2RNXA 3OBWA 1JSPB 2Y4XA 1YJWT 2E6ZA 3DB4A 4Y91A 4M77D 1X6OA 4LZSA 2DZCA 4AKNA 2DVQA 2EJ9A 1WPYA 4IORA 2AHJB 4M75F 2YEKA 3LQIA 1YBYA 2JOYA 5DFBA 4F7UB 2OTJA 4YY6A 4QSTA 1WJQA 5C85A 3AQAA 4IOQA 1K9MU 4M77C 3LGLA 4FT4A 5EICA 5GAOq 1W2BS 2R0YA 2L5EA 4TQNA 5LJ1A 2XDPA 4QSWA 3VYGA 3VYHB 3CBPA 3MQMA 5FRMA 4KV1A 3L1AA 5E9KA 2YLBA 3CBMA 2RJEA 4BDZA 5D7XA 3CD6A 5HJCA 4J0RA 4Z6IA 3V7SA 4ALHA 4M78E 1YJWA 5CTLA 1Y96A 4MMLA 3DLLA 4PNOA 3T9NA 2QEXT 1PSFA 2VGNA 5H1VA 2P4TA 4CFLA 3CC7A 5CK9A 3LW5E 5KCHA 4O77A 4PJOA 2E64A 2OAUA 5E9YA 3V7CA 5A5QA 3A8HB 2YHTA 3UVXA 1QVPA 4F7UG 5LJ5f 4C8QD 5D24A 5FU7B 4ME7A 1KD1C 3CCMA 3BDUA 3U5JA 5A5NA 5A83A 1P92A 3P8DA 2VUBA 3M5AA 1AHJB 4P5NA 3RUXA 2P0QA 4QSRA 1N8RU 2DIQA 5L99A 5GAN2 4NQMA 4IURA 3X24B 3G0JA 2GCXA 3PGGA 4HBXA 4KT0E 4QC1A 5C87A 1UEBA 5CQ8A 4EMHA 5GAN7 4J3IA 1WQ7A 3BFMA 4BW3A 4XAXB 2WSEE 5D6WA 1S72T 5F62A 4HCBA 2DVRA 4Z93A 1DJ7B 2KQWA 2PVGB 3FJPA 5FB0A 5D3NA 3FDRA 1B34B 3A5ZB 2LT1A 1KQ2A 4BY6C 1VQ6A 4M78B 5LKTA 4UIUA 5FE7A 2R57A 4LDYA 4E7HA 2QA4T 3UV2A 4JRIA 5DFCA 4LDXA 3L2QA 3S3NA 4BI3A 2E3KA 2RFJA 4IKFA 5CUEA 4M78D 4NR8A 4M75G 2DTOA 4ELYC 5ENFA 3IU5A 4M7AE 1E6IA 4E7LA 2E70A 5C4QA 1N27A 1W4SA 3GP8A 2LVMA 2XIDA 5ENJA 2F5KA 5L97A 3RIRA 4NS5A 1WGSA 2XG8D 4DONA 3PNWC 4ZQLA 4NOYA 5A82A 3OSVA 2Y4YA 1KHCA 1K73U 2YELA 3VKIA 2RO0A 3HMHA 3UVYA 5CKBA 1QVGA 3RMQA 3KXTA 2DKGA 2DVVA 4XK8E 2R0SA 5A5PA 5CY9A 4M7DF 2ZZDA 3L42A 3OYNA 3G0LA 4ZGJB 4BW1A 4PJOC 3E9FA 4YTLA 4BI8B 2L5QA 2RH2A 4RMOA 3GG3A 1O9SA 1TH7A 2QQ9A 4TZ8A 4A9FA 2RHIA 2DIGA 4NR4A 5IBNA 2RK2A 4R56A 5GAMd 3ASKA 3OYYA 5FE3A 3I3JA 4PCIA 3FLGA 5CIUA 3CCJT 2EIFA 4BUGA 4V2SA 1VQLA 3OYIA 4A9IA 2BIVA 1QVFA 4M7AF 2O01E 2MWPA 2I7KA 3TU4K 5TCMA 4OB1B 3JCMP 4NRAA 4X9DA 2PU9B 4LYSA 4YH3A 3NXBA 1KQSS 3IU6A 4LZRA 4BI4A 4XTVA 5EP7A 4C8QE 3URGA 3A8LB 2JZ2A 5E9VA 3L2RA 3OSSC 5F1HA 4YABA 4BD3A 4QUTA 3LWHA 5DW1A 4QR5A 5EPRA 5FH7A 4PJOB 4NL2A 5M9OA 2X4YA 1WQWA 1BIBA 5J39A 2OTLT 3PMIA 3QXEB 2DXUA 3QDRB 1VQ4A 4QSSA 2RM4A 3LYIA 4HBVA 3QO3A 4J0SA 2QI2A 4C92C 5KTXA 5HQ7A 4MEPA 5CCAA 4QEUA 1M4ZA 5FH6A 3OYFA 2V8JA 1Y71A 4QBMA 5F1LA 4N4FA 4O6JA 5I89A 2D0QB 1FWZA 3I56A 5C6SA 5HY6A 3NTHA 5FE6A 2DZ9A 2PVOB 3S6WA 2OO1A 4NYVA 5CR2A 4RCCA 1HXDA 4MZMA 4R55A 2K5LA 2EYQA 5H1TA 2LQ8A 2RJDA 5F63A 5DY9A 5A0DA 5DYXA 3CPWA 4F7UA 3QYHB 4YBSA 4WHWA 5EPBA 4EMKA 3LGFA 3HPWA 4NYXA 2K2VA 4PJOG 4M78A 4XTUA 3RKXA 4UITA 2VV5A 5GAOp 2RK1A 4C8QF 1O75A 4OB0B 2FB7A 4C8QB 4LRGA 4NR6A 4J7IA 2CYZB 3MULA 2PQWA 4JJNK 4NUCA 3JCMf 1NZ9A 2E1HA 1VQNA 5GAOl 3UT1A 2BKDN 3M9QA 3A8MB 5D26A 5J3BA 4LD6A 2KMTA 4QW2A 2HQEA 3TREA 5E3GA 5FDZA 2M0OA 3UVDA 2F6JA 2KTBB 3CCVA 2RHYA 4EPCA 4YBTA 3CCSA 4LDWA 4OB2B 2QEXA 4KUIA 4LYIA 4XTYA 5EVAA 5GAOn 2DTIA 5BT4A 2GFUA 2D9TA 5CVIA 1Q82U 5D3LA 4M7DE 3CCQA 2DAQA 2P0KA 3ZFJA 5CQXA 4QEVA 3M55A 4UYDA 4IR3A 2KSSA 3RESA 3SVHA 1M5Q1 4NR9A 5EQ1A 4BE2A 5CQTA 5CQ3A 2RI3A 4RVRA 5DLZA 3OYEA 4M78G 2PVDB 4C0DB 3CCUA 5IG6A 4OGEA 3OYGA 4MEQA 4TU4A 4J83A 3MHXA 3Q2EA 5ETBA 5L8RE 2X4XA 4C92E 1Q81U 3C95A 3QZ9B 4MR3A 5CGPA 3KBGA 5FG5A 3META 3UV5A 2FHDA 4N0AC 2JNGA 2VXFA 3DWYA 1M90U 3QG1A 5LJ5h 4QVDA 1LOJA 1MHNA 1FX7A 2RHZA 3O35A 5DY7A 4XUAA 4LDFA 5CQ5A 3DAIA 2L84A 4TT6A 2RD1A 5CRMA 1M1KU 5L96A 4C92G 4A4EA 2DK3A 3QJYA 2K57A 4YH4A 2XDBA 3LQJA 4A9JA 3FEOA 5A5SA 3OMCA 5I2MA 1Q81C 2WACA 2DTHA 5C0MA 4X2IA 4F3IA 2DVEA 2XU8A 3S91A 4XTXA 2MMPA 3WVEB 5TB6A 5D3HA 5EA1A 4A9HA 1JB0E 4O75A 5E9LA 4QSUA 3JCMV 3TCJA 4BB7A 2DXCA 3BY7A 2L85A 4PTBA 3ZBDA 3QZ5B 3CCET 1QW1A 2RJCA 4Y03A 5DKHA 3UW9A 2I2LA 3C12A 1VQMA 4M7DB 3P1DA 1M9SA 5FFVA 5BT3A 1G3TA 3MUKA 3CCJA 2CZ7B 3HSBA 2FVUA 3M54A 3UVWA 5FG6A 5LJ3g 4GY5A 1N8RC 5GMKi 4MR4A 3OQ5A 2QDYB 3JB9J 5G4SA 3C4SA 3G71T 4UIZA 3JB9I 4CUSA 2YLCA 1QP3A 4NRCA 5HK3A 4UIXA 4C92B 5FBXA 2WSFE 3PIPA 4Z1SA 5CKFA 5FFWA 2DVSA 5E9IA 4HXNA 5FE9A 4BW2A 4XQ3A 5E74A 4A4GA 2ZPIB 3UWNA 5KE2A 2ZPHB 4EMKC 1U1TA 4A4FA 3P1FA 2EWNA 3CC2T 5KHMA 5F36A 5F5ZA 4C0ZA 5GAN5 4M77F 3JB9H 4QY4A 3RERA 4RG8A 4HXOA 2LNVA 3V8JA 1VQ4T 3OS1A 5IGNA 5FU6C 5A5OA 3RKWA 1IREB 4HA8A 3CEYA 4FU6A 3ME9A 2F5TX 2NXBA 2E10A 3PMTA 3QZSA 2EJFA 1KQ1A 2MAMA 2A7YA 5GMKh 5F60A 3U5OA 5BT5A 4NR5A 1VQPT 4Q0OA 1G3YA 1K9MC 2R10A 5E73A 2JTMA 5LJ5g 3CC4A 5LVQA 3V8KA 5IIDA 5ETDA 2DD4A 4L6V5 5KTUA 4ZN1A 5J0DA 1KC8U 1X75C 2E12A 3EAEA 2DXTA 1VQOT 2RA2A 2DJZA 5DKDA 1VQ5A 3OBYA 3JVKA 3SDZA 2XD0A 3INZA 3MCAB 1B34A 1Y7XA 4N3WA 4M77G 3H8ZA 3HKSA 3OA6A 1I4K1 1OZ2A 4A4HA 4E47A 2DEQA 4BE0A 5CUDA 3P1EA 1S72A 2WSCE 2XK0A 3V8LA 4DOVA 4KBMB 4M7AD 2LT4A 2LDMA 5D3RA 4CI0C 4XUBA 4EMGA 4A9LA 2D9EA 4ZGDB 5LJ3j 2FL7A 5DLQE 4F7UE 1YI2A 3JB9F 1YHQT 4QYDA 5L98A 5LJ3h 3JCMb 2OSSA 1YITA 4BHWA 1JJ2S 4QSXA 4WF2A 5GAN3 2L89A 5A0GA 2LSPB 4IR6A 3CMAA 4PL6A 3HFNA 2QTXA 3ZYUA 3QIIA 2EQKA 2GQVA 1BI3A 4NUDA 4OP0A 4A4KA 2LC4A 5C89A 1KC8C 2Y90A 3HRSA 5CQAA 5FB1A 2VGMA 2JTFA 4M75B 3PIOA 1WNLA 4BJXA 4M75E 1BI2A 4NL3A 5EG2A 2R0VA 4ATOA 4A9EA 1VQPA 1QVFS 5F2PA 4N0AA 4LYWA 2X4JA 3M59A 5KCOA 1VQNT 2DXBA 4CUPA 2K4YA 1U1SA 4IR4A 2L8DA 4QB3A 5ENGA 2RI2A 3BDLA 4MDWA 5CPEA 4UYHA 5FRNA 2E41A 1VQ9A 4M7DA 5CQYA 2B8AA 5JI8A 5GAOr 1NJIU 3LWIA 2CKKA 1VQKT 1WJSA 3CMET 2RI7A 4QEWA 5ENIA 5I29A 5ACYA 4NUEA 4M78F 2MF2A 2OTLA 4XTWA 3GNFB 4QR3A 1VIEA 5HELA 4M75C 4YYKA 4YBMA 5EWDA 1M1FA 2RHUA 3FRNA 3CCMT 2HNIA 2H3JA 1N6AA 4D6WA 5G4RA 1I5LA 4UYEA 4IUQA 1IZ6A 3G4ST 3X26B 1N9RA 5E7DA 1KG1A 5I86A 3O34A 1YI2T 5LKZA 4XY8A 5DLOA 3GNGA 5C8GA 5GMKe 5CFWA 4JDSA 4YC9A 4CURA 3Q1JA 5IAYA 3BW1A 4QSPA 3EFRA 3J81E 3JCMe 1BI0A 5D6XA 2E5QA 5ENCA 3M57A 4QSVA 1EQFA 5HRVA 3JVLA 4IUPA 3MP6A 5E0RA 3SWNC 4YATA 3GPLA 5K29A 4Z6HA 3OS0A 3CC7T 4IR5A 2YEMA 2KDSA 5CU8A 1VQ6T 4C92A 4UIYA 2D6FA 2VXEA 4KCXA 1BI1A 1VQ8A 3MEWA 2DO3A 3QUIA 3ONIA 1VIFA 5IGKA 3DB3A 3S3OA 4Y28E 5HKCA 2FYKA 4HT9A 3LX7A 4N4HA 3MEAA 4TZ2A 1X01A 5CUCA 5D25A 4CL9A 3MB3A 5GAOm 4OVAA 4PLLA 5FROA 4TT2A 1YIJT 3P8BB 4FLPA 1VQ7T 2MJVB 3EFSA 1X0JA 5ENEA 2IG0A 2KVQG 1M8VA 3P5OA 4FIBA 4IOOA 2RJFA 2MI6A 2IVWA 5F61A 5LJ3e 3CCQT 2ZPGB 1YJNA 3HRUA 4PJOD 2D82A 1Y07A 5I1QA 1D3BB 3JSCA 4C8QA 4B9XA 1VQ8T 5D3TA 5LKXA 1UGRB 3JRZA 2RB6A 2ZGWA 4HXMA 2O4XA 4EMKB 5EWHA 5AYFA 4J1PA 2BUDA 5E3DA 2VC8A 3E9GA 3QZVA 4KUDK 5LVRA 5CQ7A 5DLXA 4HT8A 2K3YA 4M77B 1YCYA 4E7KA 5FE0A 3GOXA 4LD9K 3MEUA 3N5BB 5HRWA 5GAMj 3OW2A 1RI0A 2HAXA 4QYLA 3CXCA 4HKEA 4JRQA 4JUVA 3JCMd 3SWNB 4ALGA 3HFOA 5I21A 3WXMB 4C0GA 1ZQ1A 3RMSA 4C92F 4II1A 5HQ5A 2K3XA 4L59A 4CLBA 1KQSA 5GAMh 5ENHA 2X35A 4J6WA 4E96A 5I80A 4M78C 3HHTB 5AD3A 3VUBA 1VQMT 3CD6T 4X34A 4MDXA 4TYLA 4FSXA 1F68A 3TEEA 4HXKA 4ELZC 4Z02A 4FM4B 4HBWA 3SVFA 2E6NA 2EAYA 2LX9A 1VQLT 5CO7A 1FXXA 2LTOA 2QQBA 3PFSA 2C06A 4BY6B 5CKHA 2FSAA 3OMGA 3OY9A 4MENA 4FL6A 5GANf 3X20B 3QPHA 1VUBA 3UV4A 1Q86C 5AMEA 1V29B 4QUUA 1HK9A 3QSUA 4WIVA 4LC2A 3L2VA 1K8AU 5GANj 5GAN6 4OGIA 2R58A 1U8RA 4MR6A 5CUBA 3A8OB 2CGHA 4O7CA 5A7CA 5D0CA 1JRIA 5FU7C 2ZPBB 3JVJA 4MMKA 3UDCA 5LJ5j 3JB9D 4C92D 5AD2A 4UYFA 4F7UF 3CCRA 1VQKA 3CCEA 5DYCA 3G7ZA 2RI5A 5II2A 4Q5WA 3QZTA 4CUUA 4M75A 5I2SA 4PKCC 4PCEA 2M9UA 2I8NA 4C0DC 1M1KC 1LJOA 4MZTA 4OGCA 2GF7A 5HCLA 3G6ET 4TS8A 3QHSA 3LJWA 2VYTA 4NR7A 3L2ZA 1ZHIA 4O7BA 3FC3A 2CZ0B 4M7DC 2V8KA 2JVVA 2X4WA 1G3WA 4JLIA 1WUGA 3I56T 3QYGB 2RO1A 5DFDA 5KU3A 4NRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLP A;  5II1 A;  5LJ0 A;  4XY9 A;  4QYD A;  2JZ2 A;  5L98 A;  5E9V A;  3OYK A;  2OSS A;  3L2R A;  4BHW A;  4QSX A;  3MXF A;  4BAC A;  5F1H A;  4YAB A;  5I83 A;  4BD3 A;  2L89 A;  3OYJ A;  3FKM X;  3F70 A;  4QR4 A;  2LSP B;  4IR6 A;  4C67 A;  4QUT A;  4PL6 A;  5DW1 A;  4YAX A;  3ZYU A;  4CUT A;  4QR5 A;  5L8T A;  2EQK A;  3QII A;  5EPR A;  5FH7 A;  3OYL A;  4LZ2 A;  5M9O A;  2X4Y A;  4Z1Q A;  4BE1 A;  2WP1 A;  3D7C A;  5LKU A;  4NUD A;  5J39 A;  5I7Y A;  1N72 A;  3PMI A;  2GFA A;  4XYA A;  5C89 A;  3MP8 A;  5KE3 A;  4QSS A;  4CUQ A;  3OS2 A;  4C66 A;  2DKW A;  3LYI A;  4HBV A;  4YYH A;  4J0S A;  5CQA A;  5FB1 A;  3S92 A;  5HQ7 A;  5KTX A;  4C5G A;  4MEP A;  3OYH A;  2JTF A;  4QEU A;  4Q0N A;  2LCC A;  5FH6 A;  3OYF A;  4PS5 A;  4YYJ A;  3JVM A;  4BJX A;  4B9W A;  4QBM A;  5D3P A;  5F1L A;  3DLM A;  3P8H A;  2R0V A;  4N4F A;  4A9E A;  3QBY A;  5I89 A;  5FE4 A;  1H3Z A;  5F2P A;  4LYW A;  3ZEH A;  3AAD A;  5KCO A;  4TU6 A;  4QQ6 A;  5C6S A;  4CUP A;  5I88 A;  4O76 A;  5EM3 A;  3NTH A;  4IR4 A;  4CRI A;  5FE6 A;  4QQD A;  3S6W A;  5CS8 A;  5I7X A;  2L8D A;  4QB3 A;  5ENG A;  2OO1 A;  2RI2 A;  2F6N A;  3BDL A;  3OYM A;  5CPE A;  5IN1 A;  4NYV A;  4UYH A;  2QQS A;  2OUO A;  5FRN A;  2EQM A;  1XNI A;  1WUM A;  4KV4 A;  4NXJ A;  3OYA A;  5EK9 A;  3U5M A;  5H1T A;  4WHU A;  5LJ2 A;  1SSF A;  5F63 A;  2WP2 A;  2B8A A;  2RJD A;  5JI8 A;  4LR6 A;  3NTI A;  1OI1 A;  3O8V A;  2EKO A;  2RNY A;  5DYX A;  2YRV A;  2YQD A;  3U5N A;  5D3J A;  2CKK A;  4YBS A;  4WHW A;  1WJS A;  2RI7 A;  4HBY A;  4QEW A;  2RNW A;  5ENI A;  5EPB A;  5ACY A;  5I29 A;  4HXP A;  5I40 A;  3LGF A;  4YYD A;  3SD4 A;  4NYX A;  4NUE A;  1WJR A;  4ZC9 A;  4ZW1 A;  4UIT A;  4O7E A;  4RG2 A;  5DX4 A;  4QR3 A;  5EWW A;  4HXL A;  1G5V A;  5HLS A;  5HEL A;  5JWM A;  5H1U A;  2MWO A;  5E9M A;  4QQG A;  4QSQ A;  4YYK A;  5FE8 A;  4PY6 A;  4LRG A;  4YBM A;  5KH6 A;  5EWD A;  2N9G A;  4A9M A;  2RHU A;  3MO8 A;  4NR6 A;  4QVZ A;  2EQJ A;  3L2W A;  5DKC A;  5G4R A;  5HEM A;  4YYG A;  3MUL A;  2YYN A;  2YDW A;  2PQW A;  4HXS A;  4UYE A;  4IUQ A;  2QQR A;  2L3R A;  4NUC A;  5DYA A;  3MP1 A;  2R5A A;  5A5R A;  5HM0 A;  4QC3 A;  5CUG A;  5E7D A;  2BKD N;  3UT1 A;  3M9Q A;  4NYW A;  5D26 A;  5I86 A;  4LD6 A;  3O34 A;  4UYG A;  4C5E A;  4YYI A;  4QW2 A;  3HME A;  5LKZ A;  2HQE A;  2DWW A;  2RNX A;  4XY8 A;  5E3G A;  5FDZ A;  2M0O A;  4MEO A;  1JSP B;  3UVD A;  3KUF A;  3S3M A;  2F6J A;  3U5L A;  5C8G A;  2KTB B;  5CFW A;  2RHY A;  3DB4 A;  4YC9 A;  5CP5 A;  4CUR A;  3Q1J A;  4IUU A;  5IAY A;  4QSP A;  4YBT A;  5D6X A;  5EWV A;  2E5Q A;  5D3S A;  5ENC A;  4LZS A;  3LXJ A;  5L8U A;  4QSV A;  1EQF A;  5HRV A;  3JVL A;  4LYI A;  3P1C A;  4IUP A;  1OYX A;  3MP6 A;  4C5I A;  5E0R A;  5EVA A;  4YAT A;  5K29 A;  4Z6H A;  2DVQ A;  4AKN A;  5F3A A;  4UC4 A;  4IOR A;  4IR5 A;  4PLI A;  3OS0 A;  5BT4 A;  4TTE A;  2YEK A;  2YEM A;  3LQI A;  2D9T A;  2GFU A;  5D3L A;  2H60 A;  5HRX A;  5DFB A;  5CU8 A;  2DAQ A;  2P0K A;  4UIY A;  4YY6 A;  4QST A;  1WJQ A;  5C85 A;  4QEV A;  3AQA A;  4IOQ A;  4UYF B;  4UYD A;  4IR3 A;  3MEV A;  4OUF A;  3LGL A;  3SVH A;  4KCX A;  4NR9 A;  5EQ1 A;  4BE2 A;  5CQ6 A;  5EIC A;  2GRC A;  5CQT A;  5CQ3 A;  2RI3 A;  4RVR A;  3MEW A;  5DLZ A;  5FE1 A;  4IUT A;  3OYE A;  3ONI A;  5DBM A;  2R0Y A;  2L5E A;  4TQN A;  5LJ1 A;  2E7O A;  5IG6 A;  2XDP A;  3OYG A;  4MEQ A;  4QSW A;  4MR5 A;  5IGK A;  4TU4 A;  4O70 A;  3MQM A;  3DB3 A;  3S3O A;  5FRM A;  3Q2E A;  4KV1 A;  5ETB A;  2X4X A;  3QJ6 A;  4MR3 A;  3O33 A;  5E9K A;  5CGP A;  4OGJ A;  5FG5 A;  3LX7 A;  4N4H A;  2RJE A;  3UV5 A;  5D7X A;  2FHD A;  3MET A;  4BDZ A;  4PKL A;  3DWY A;  5HQ6 A;  5C7N A;  5HEN A;  3MEA A;  5HJC A;  4J0R A;  5EV9 A;  4Z6I A;  4ALH A;  4TZ2 A;  3OYC A;  5CUC A;  5D25 A;  1MHN A;  5CTL A;  1ZS5 A;  4CL9 A;  3MB3 A;  2RHZ A;  3O35 A;  2G4A A;  5DY7 A;  4XUA A;  4OVA A;  2NLU A;  4LDF A;  4PLL A;  5FRO A;  4O7A A;  4O78 A;  4TT2 A;  5CQ5 A;  5FFY A;  3DAI A;  4FLP A;  4E7I A;  2MJV B;  1X0J A;  2L84 A;  4TT6 A;  5ENE A;  2IG0 A;  5CRM A;  3H6Z A;  4N4I A;  5L96 A;  3MB4 A;  5H1V A;  4A4E A;  3P5O A;  4CFL A;  2RHX A;  4IOO A;  2RJF A;  4YH4 A;  4CFK A;  5F61 A;  3LQJ A;  4O77 A;  5KCH A;  4A9J A;  5EIS A;  3FEO A;  5A5S A;  3OMC A;  5E9Y A;  5A5Q A;  5HFR A;  2WAC A;  2RS9 B;  3UVX A;  2D82 A;  5I1Q A;  5C0M A;  5D24 A;  3OYD A;  4X2I A;  4F3I A;  4B9X A;  2EQU A;  4O74 A;  5EGU A;  3U5J A;  5D3T A;  5LKX A;  3S91 A;  5KO4 A;  5A5N A;  5A83 A;  5TB6 A;  5D3H A;  5EA1 A;  5HFQ A;  4A9H A;  3P8D A;  4HXM A;  4O75 A;  3RCW A;  5EPS A;  5H85 A;  4EDU A;  5E9L A;  4QSU A;  2O4X A;  4QSR A;  2L85 A;  4PTB A;  5EWH A;  4J1P A;  2BUD A;  4BDY A;  2DIQ A;  5IGL A;  5E3D A;  3HMF A;  5L99 A;  4A9N A;  2RJC A;  3E9G A;  4Y03 A;  5DKH A;  4NQM A;  3QZV A;  3G0J A;  3UW9 A;  5IGM A;  4IUR A;  2YW5 A;  4UIW A;  5CZG A;  5LVR A;  4HBX A;  4UIV A;  3LLR A;  4QC1 A;  5C87 A;  5CQ7 A;  3P1D A;  4QNS A;  5CQ8 A;  5FFV A;  5BT3 A;  5ENB A;  3MUK A;  4J3I A;  5DLX A;  4BW3 A;  2K3Y A;  4YAD A;  5A81 A;  4E7K A;  5FE0 A;  3GOX A;  3UVW A;  5FG6 A;  5D6W A;  4GY5 A;  3MEU A;  5F62 A;  2DVR A;  5HRW A;  2M16 A;  4Z93 A;  4MR4 A;  5F25 A;  3OQ5 A;  1RI0 A;  3K2J A;  4QYL A;  5G4S A;  3C4S A;  5KTW A;  5FB0 A;  1OZ3 A;  5D3N A;  3LQH A;  4NQN A;  4UIZ A;  3FDR A;  4ALG A;  4UIU A;  4CUS A;  5LKT A;  5FE7 A;  4NRC A;  2R57 A;  4E7H A;  4UIX A;  5FBX A;  3UV2 A;  5DFC A;  3L2Q A;  2O4X B;  4Z1S A;  3S3N A;  2E3K A;  2RFJ A;  3SVG A;  5CUE A;  4IKF A;  4II1 A;  4NR8 A;  2DVS A;  5E9I A;  3O37 A;  5FFW A;  4HXN A;  5FE9 A;  5HQ5 A;  3U5P A;  2K3X A;  4CLB A;  4L59 A;  4BW2 A;  2G3R A;  5ENF A;  4YYM A;  3IU5 A;  5ENH A;  3O36 A;  5E74 A;  1E6I A;  4A4G A;  4YYN A;  2X35 A;  4E96 A;  5FE2 A;  4HXR A;  2R5M A;  5I80 A;  3UWN A;  4E7J A;  4E7L A;  5KE2 A;  5C4Q A;  4C5H A;  4A4F A;  3P1F A;  4TT4 A;  5AD3 A;  5CQ4 A;  5KHM A;  1N27 A;  5F36 A;  5F5Z A;  3OB9 A;  2LVM A;  5ENJ A;  4ZTF A;  2F5K A;  5L97 A;  4X34 A;  4QY4 A;  4TYL A;  4NS5 A;  1WGS A;  1F68 A;  3U5K A;  4HXO A;  4HXK A;  5A85 A;  4Z02 A;  3OS1 A;  4DON A;  4BW4 A;  5IGN A;  5A5O A;  3PNW C;  4HBW A;  4ZQL A;  1JM4 B;  3SVF A;  5A82 A;  3CEY A;  4FU6 A;  2E6N A;  4A9O A;  3Q2F A;  2LTO A;  3ME9 A;  4N4G A;  3PFS A;  5EU1 A;  2NXB A;  1KHC A;  2M1H A;  3PMT A;  2YEL A;  2FSA A;  3OMG A;  3OY9 A;  3QZS A;  5FG4 A;  4MEN A;  4FL6 A;  5CUA A;  3UV4 A;  2RO0 A;  5COI A;  5F60 A;  3U5O A;  5BT5 A;  3HMH A;  4NR5 A;  4Q0O A;  5AME A;  3UVY A;  2R10 A;  5E73 A;  5EWC A;  4QUU A;  4WIV A;  4LC2 A;  4A9K A;  4YY4 A;  3L2V A;  5LVQ A;  4ZTJ A;  5IID A;  2DVV A;  5ETD A;  4OGI A;  2R58 A;  2R0S A;  5A5P A;  5CY9 A;  3LH0 A;  4O7F A;  4MR6 A;  5CUB A;  5KTU A;  3QKJ A;  3L42 A;  5J0D A;  4O7C A;  5A7C A;  5D0C A;  3OYN A;  3EAE A;  2DAT A;  3G0L A;  4BW1 A;  2EFI A;  3JVJ A;  5CRZ A;  3E9F A;  5DKD A;  4QZS A;  5AD2 A;  4UYF A;  5FH8 A;  3JVK A;  3GG3 A;  4O72 A;  5DYC A;  2RI5 A;  5II2 A;  4IUV A;  4Q5W A;  4TZ8 A;  4N3W A;  4A9F A;  2RHI A;  2DIG A;  3QZT A;  4NR4 A;  4CUU A;  5IBN A;  3H8Z A;  4PCE A;  5FE5 A;  3OA6 A;  2I8N A;  3ASK A;  5FE3 A;  1OZ2 A;  3I3J A;  4PCI A;  4A4H A;  2GF7 A;  3FLG A;  5LUU A;  5CIU A;  5EI4 A;  4O71 A;  2HQX A;  4BE0 A;  5HCL A;  2E7N A;  5CUD A;  3P1E A;  4TS8 A;  3NTK A;  5DW2 A;  3OYI A;  2LRQ A;  3LJW A;  2VYT A;  4A9I A;  4NR7 A;  2XK0 A;  3L2U A;  5AMF A;  2BIV A;  4O7B A;  3OYB A;  3FC3 A;  4GPJ A;  2MWP A;  2I7K A;  5DYU A;  5TCM A;  2LDM A;  5D3R A;  4NRA A;  2X4W A;  5J26 A;  4LYS A;  1WUG A;  4XUB A;  4YH3 A;  4A9L A;  3NXB A;  2D9E A;  3IU6 A;  4LZR A;  2RO1 A;  5DFD A;  5EP7 A;  4YK0 A;  5D6Y A;  5KU3 A;  4HCZ A;  4NRB A; 
#chains in the Genus database with same CATH topology
 4LDU A;  1UB4 A;  3EH1 A;  4DQ2 A;  4XY9 A;  4ZGE B;  3OYK A;  2K3B A;  4OB3 B;  3MXF A;  2HBP A;  4A53 A;  1XTD A;  5FWB A;  3JAM E;  3V7R A;  1BU1 A;  5IH2 A;  3E1S A;  3F70 A;  2FPD A;  3E2U A;  4C67 A;  1WZO A;  2E65 A;  1NEG A;  4YAX A;  4CUT A;  3E19 A;  1X27 A;  3CC2 A;  2PUO B;  3VJP A;  4LZ2 A;  3OYL A;  1YJ9 A;  2WP1 A;  3D7C A;  3CCU Q;  5LKU A;  4J9D A;  5I7Y A;  4O5V A;  2OX7 A;  2DRK A;  4F17 A;  2LCS A;  4XYA A;  2QQA A;  2YRD A;  1XJW B;  4CUQ A;  3OS2 A;  4C66 A;  1K76 A;  3D1D A;  1BB9 A;  1UUE A;  3OYH A;  3SB2 A;  5HCK A;  1W2B A;  5GAM g;  1X2Q A;  2COW A;  2KEA A;  1QWF A;  4PS5 A;  2HSE B;  4YYJ A;  3JVM A;  4RTZ A;  1BCM A;  3CCU T;  1MMG A;  1NLO C;  3PT9 A;  2PNI A;  1M90 C;  1XOV A;  1H3Z A;  4M77 E;  3G4S A;  1K9A A;  2YWW A;  1JXO A;  4TU6 A;  1B07 A;  1NJI C;  2QAZ A;  5EM3 A;  1V76 A;  5CS8 A;  1NE8 A;  4WCI A;  3OYM A;  4FYY B;  5IN1 A;  1R77 A;  2NUP B;  3RBB B;  4ZN3 A;  5LJ3 d;  1XNI A;  4NXJ A;  5EK9 A;  5LJ2 A;  5AT1 B;  4OMF B;  2WP2 A;  4LR6 A;  4F16 A;  1OI1 A;  2EKO A;  1K9M R;  3CMA T;  1VQ7 A;  2YRV A;  5D3J A;  1ACM B;  3M0S A;  2P0P A;  1I8F A;  4HBY A;  4MZP A;  2RNW A;  2I0N A;  2FPF A;  2F69 A;  1JBM A;  2KGT A;  3GLX A;  1WJR A;  4ZC9 A;  2YUO A;  3GIB A;  4RG2 A;  5EWW A;  2LCL A;  3D1B A;  3JCM W;  1QMC A;  1KD1 U;  5GMK m;  2AKK A;  2KXD A;  2LP5 A;  1EIF A;  2E5K A;  2RQV A;  5KH6 A;  2N9G A;  2CH4 W;  4FT2 A;  4QVZ A;  1Y96 B;  4LUE A;  4GLK A;  1XQH A;  5DKC A;  2JS0 A;  4YYG A;  2YYN A;  2YDW A;  2L3R A;  2R5A A;  4OMQ A;  5KYW A;  1SSH A;  5FLX E;  5CUG A;  2VVK A;  4QVC A;  2J05 A;  3A98 A;  4C5E A;  4UYG A;  2HSP A;  1Q82 C;  4YYI A;  3HME A;  3H41 A;  4OMM A;  3VS4 A;  4MEO A;  3KUF A;  2XHC A;  3S3M A;  1YHQ A;  1VQ9 T;  3U5L A;  1ZX6 A;  4ESR A;  1YIT T;  5CP5 A;  4IUU A;  2F2W A;  2EYZ A;  4RTU A;  5EWV A;  2LQK A;  5D3S A;  3D7S B;  4C8Q C;  3I55 A;  3LXJ A;  5L8U A;  1RLQ C;  1LNX A;  3M0P A;  3P1C A;  1OYX A;  4C5I A;  5FWC A;  3JB9 G;  2AKL A;  5F3A A;  4UC4 A;  4PLI A;  4TTE A;  3G71 A;  2KNB B;  4AKG A;  2H60 A;  5HRX A;  1YJN T;  2C0T A;  3H0H A;  3CCL A;  2CZ1 B;  5GAM e;  2M51 A;  3OS5 A;  4J7F A;  3EGD B;  1BKB A;  4RTW A;  2DMO A;  4UYF B;  3MEV A;  4OUF A;  1CKB A;  2E3H A;  5CQ6 A;  2CZ6 B;  4XU0 A;  2GRC A;  2YRC A;  4IUT A;  5FE1 A;  2XIC A;  2F2X A;  3RKY A;  5LJ5 d;  5DBM A;  3JCM J;  2E7O A;  1D3B A;  1NPR A;  4KGX B;  4MR5 A;  4O70 A;  4FYX B;  1FYN A;  3LH5 A;  1E7O A;  3NPF A;  3QJ6 A;  4B6M A;  1SHF A;  4QKU A;  3EG3 A;  1VQO Q;  1N5Z A;  2HQH A;  2KY9 A;  5GAN d;  3O33 A;  3CC4 Q;  1OQK A;  4OGJ A;  3CPF A;  4RTV A;  5IXF A;  4F14 A;  4PKL A;  5L23 A;  5HQ6 A;  2JXB A;  5C7N A;  4KUL A;  5HEN A;  3UPU A;  1Q7Y C;  1QKX A;  5EV9 A;  1WXB A;  2EVR A;  3UAT A;  3R6O A;  3OYC A;  3CCV T;  3VKH A;  1M1G A;  2J6F A;  1ZS5 A;  5GAN e;  2G4A A;  2NLU A;  2QGG A;  4O7A A;  4O78 A;  1ABO A;  3I55 T;  5FFY A;  1UGP B;  4E7I A;  5KYW B;  3H6Z A;  4N4I A;  4JJB A;  3CME A;  3MB4 A;  1NPP A;  2KAF A;  2RHX A;  4CFK A;  2FO0 A;  3EGU A;  1OX8 A;  3EHQ A;  1UGS B;  3M0R A;  2XDD A;  2YDL A;  5EIS A;  1H64 1;  4JPB W;  3JCM X;  1K73 R;  1QP2 A;  3G71 Q;  1C1A A;  4PJL A;  5HFR A;  2RS9 B;  3FIF A;  1TWB A;  3DKM A;  3I9Q A;  3JCM Q;  2KRM A;  2KT8 A;  2HKN A;  3OYD A;  2V8I A;  1PRM C;  3M53 A;  2EQU A;  4O74 A;  5EGU A;  3NGP A;  5KO4 A;  5HFQ A;  1Q86 U;  3RCW A;  5EPS A;  5H85 A;  4EDU A;  1M90 R;  4J6Y A;  1QCN A;  1ABQ A;  1RAH B;  1NJI R;  4BDY A;  5IGL A;  3HMF A;  4A9N A;  4RCB A;  4RTY A;  1YI2 Q;  5IGM A;  1R8O B;  2QYZ A;  2YW5 A;  2EJG A;  4UIW A;  5CZG A;  4M7A C;  4UIV A;  3LLR A;  3VS0 A;  5GMK j;  4QNS A;  3ERR A;  5ENB A;  3ER0 A;  2DNU A;  4YAD A;  5A81 A;  3CC2 Q;  3M4Y A;  4L5G A;  1GXI E;  3CXC P;  2M16 A;  4J9G A;  5GAN 8;  4M7A G;  5F25 A;  2Z0W A;  3K2J A;  4JLG A;  1YFN A;  4J8O A;  2FZG B;  5KYU B;  3PVL A;  5KTW A;  3C94 A;  1Q7Y U;  1OZ3 A;  1WFW A;  1WXT A;  5GMK l;  3LQH A;  4NQN A;  4JRK A;  1ZSZ C;  2FRW A;  4M75 D;  2O9S A;  1I0C A;  2OTJ T;  1AZG B;  3CC4 T;  3SEM A;  2DPP B;  4XU3 A;  2O4X B;  3HL8 A;  3SVG A;  4J5Y A;  2CS7 A;  5A2Q E;  3A8G B;  1QVG S;  3O37 A;  3U5P A;  2G3R A;  4YYM A;  1EFN A;  1UGQ B;  1AEY A;  4LDV A;  4RUG A;  3O36 A;  2A3L A;  5GAN h;  4YYN A;  5FE2 A;  4HXR A;  2R5M A;  4OMO A;  1VQ5 T;  4HCK A;  3VUZ A;  4E7J A;  2DBK A;  3JCM h;  2NYS A;  1VQL Q;  4C5H A;  1BYM A;  4TT4 A;  5CQ4 A;  2FZK B;  3OB9 A;  4ZTF A;  2KK4 A;  4HVU A;  4XU2 A;  5D7U A;  3U5K A;  4PFZ A;  4PJO E;  5A85 A;  4BW4 A;  1FMV A;  1JM4 B;  2LX7 A;  2HZY A;  3TSW A;  3G6E A;  4F04 B;  5CKD A;  4A9O A;  3Q2F A;  3M56 A;  4N4G A;  5EU1 A;  3PTA A;  2M1H A;  3M58 A;  4XU1 A;  5FG4 A;  1PCX A;  1UDL A;  5CUA A;  4M7A B;  3THK A;  5COI A;  3OW2 S;  4M77 A;  5EWC A;  4A63 B;  2A0F B;  1JJ2 A;  3CXC S;  2DJQ A;  4A9K A;  2QA4 Q;  4YY4 A;  1PD1 A;  4ZTJ A;  4GLM A;  1BIA A;  4AKH A;  3J80 E;  3LH0 A;  1WDX A;  4O7F A;  3QKJ A;  4JS4 A;  2VKN A;  2GTO A;  2DAT A;  2EFI A;  3J7A F;  1EZZ B;  2ECZ A;  5CRZ A;  4QZS A;  1RL2 A;  5FH8 A;  5A0L A;  1OOT A;  1ZSG A;  4O72 A;  2K9G A;  2CT3 A;  4PJO F;  2HBW A;  1Q7Y R;  2EQI A;  2P84 A;  3CPW S;  5FE5 A;  4C8Q G;  5LUU A;  4RTX A;  4CC3 A;  5EI4 A;  4O71 A;  2HQX A;  1UFF A;  4AFS C;  2E7N A;  5GAM f;  3NTK A;  5DW2 A;  1PSE A;  4DA4 A;  2LRQ A;  3HP9 A;  1JO8 A;  5IT9 E;  2ZPF B;  3L2U A;  5AMF A;  3MKD A;  4J9B A;  3OYB A;  2XI9 A;  4GPJ A;  5DYU A;  2LJ1 A;  4M7A A;  4VUB A;  3GF5 A;  2G6F X;  1ZBX A;  2L3P A;  2DBM A;  1K73 C;  5J26 A;  3HRT A;  5LL6 S;  5D6Y A;  2KXC A;  4YK0 A;  3WVD B;  5GAN 4;  2QA4 A;  4HCZ A;  1I1J A;  3TLP A;  5II1 A;  5LJ0 A;  2CDT A;  1VQO A;  2EGA A;  4BAC A;  3VU3 C;  1ZUK A;  5LJ3 f;  1HYO A;  5I83 A;  2HD0 A;  3OYJ A;  3FKM X;  2BZY A;  4QR4 A;  3FB9 A;  5CKE A;  4AG2 C;  5ECA A;  5CAI A;  5L8T A;  1IGU A;  3O5Z A;  5LJ5 e;  4JS5 A;  4Z1Q A;  4BE1 A;  2CRE A;  2XKO C;  1N72 A;  4ANJ A;  1CSK A;  4J6X A;  2GFA A;  3MP8 A;  5KE3 A;  2DKW A;  2RF0 A;  4YYH A;  1SKU B;  4TVR A;  4PJN A;  4C5G A;  3S92 A;  3SFM A;  1PKS A;  1I81 A;  1KD1 R;  2CT4 A;  4Q0N A;  2PUK B;  1BK2 A;  2LCC A;  5FU6 B;  2YT6 A;  5GAN g;  4B9W A;  5HK0 A;  5D3P A;  3JCM g;  2COZ A;  3DLM A;  3P8H A;  3QBY A;  1K8A C;  5FE4 A;  3ZEH A;  3AAD A;  4QQ6 A;  5I88 A;  1TUC A;  4O76 A;  4CRI A;  4QQD A;  1UTI A;  5I7X A;  4AKI A;  2F6N A;  5DM7 R;  2QQS A;  2OUO A;  2EQM A;  2LQN A;  5KYY B;  2DD5 A;  2ZCF B;  4M7D D;  1WUM A;  4FYW B;  4D8D A;  4KV4 A;  3OYA A;  3SWN A;  3U5M A;  4WHU A;  1SSF A;  4C0F A;  3NFC A;  3NTI A;  3O8V A;  2ED1 A;  3CCS T;  1YIJ A;  3AHU A;  1NLP C;  1IHV A;  1KHI A;  2RNY A;  3X28 B;  1WA7 A;  2YQD A;  3U5N A;  3CCR T;  4X9C A;  1ZSZ B;  2K5F A;  4IUV A;  2DL5 A;  4HXP A;  5I40 A;  1YJ9 T;  4YYD A;  4XTZ A;  1KFZ A;  1NEB A;  4A54 A;  2JN0 A;  1S72 Q;  3SD4 A;  3JCM c;  4ZW1 A;  4O7E A;  5DX4 A;  1RAE B;  3CCL T;  4HXL A;  1G5V A;  5HLS A;  5JWM A;  2DM1 A;  5H1U A;  4DOW A;  2MWO A;  4FCY A;  3VRY A;  5E9M A;  4QQG A;  4QSQ A;  1VQ5 Q;  5FE8 A;  4PY6 A;  3HTR A;  1KJW A;  3VV0 A;  5I11 A;  4A9M A;  3NHN A;  2K5I A;  4OF1 A;  2QXF A;  1N9S A;  4AG1 C;  3MO8 A;  4JRP A;  2EQJ A;  3L2W A;  3CBO A;  5HEM A;  1W2B P;  3M4G A;  2JUF A;  1G3S A;  4HXS A;  3X25 B;  1PWT A;  2QQR A;  5DYA A;  1M1K R;  1UE9 A;  3MP1 A;  4RKU E;  5A5R A;  5HM0 A;  4QC3 A;  1D1B A;  1GFD A;  2CP5 A;  4NYW A;  4M7D G;  1JXM A;  4HCC A;  3VS2 A;  2ZPE B;  1MGQ A;  2C0I A;  2DWW A;  2RNX A;  1MMN A;  3OBW A;  2HDA A;  1JSP B;  4LN2 A;  1AT1 B;  1YWO A;  2Y4X A;  3I5R A;  1YJW T;  2E6Z A;  3DB4 A;  4Y91 A;  4M77 D;  2CH4 A;  1X6O A;  4LZS A;  3TSZ A;  2DZC A;  1G2B A;  2JS2 A;  2QEX Q;  4AKN A;  2DVQ A;  2EJ9 A;  1WPY A;  4IOR A;  2AHJ B;  2EGC A;  4M75 F;  1FMW A;  2YEK A;  3LQI A;  1AWX A;  4JZ3 A;  1YBY A;  1SG5 A;  4DBQ A;  2JOY A;  5DFB A;  1YIT Q;  2QTV A;  1C0M A;  2KBT A;  4F7U B;  1TUG B;  2OTJ A;  3I35 A;  4YY6 A;  4J9I A;  4QST A;  1WJQ A;  5C85 A;  4ORZ A;  3AQA A;  2DE0 X;  4IOQ A;  1K9M U;  2FRY A;  3LGL A;  3MJX A;  4M77 C;  4FT4 A;  5EIC A;  4J9E A;  5GAO q;  1W2B S;  2R0Y A;  2DEU A;  2L5E A;  4TQN A;  5LJ1 A;  2EJN A;  2XDP A;  4QSW A;  3VYG A;  2CSI A;  3VYH B;  3CBP A;  3MQM A;  5FRM A;  4KV1 A;  1WLP B;  2DL4 A;  1QQJ A;  1S1N A;  5IHI A;  3CMA Q;  1V1C A;  3L1A A;  4AFQ C;  4FSS A;  5E9K A;  3EG9 B;  1M2V A;  2YLB A;  3CBM A;  2RJE A;  4BDZ A;  5D7X A;  3CD6 A;  5HJC A;  4J0R A;  4Z6I A;  3V7S A;  4ALH A;  2KI7 A;  4M78 E;  1QCO A;  1YJW A;  5CTL A;  1M8M A;  1GCQ C;  1Y96 A;  4MML A;  3DLL A;  2JM8 A;  2DFU A;  1W1F A;  1AWO A;  5GJW B;  1RLP C;  4PNO A;  3T9N A;  2QEX T;  1PSF A;  3C0C A;  1MNE A;  2VGN A;  5H1V A;  2CSQ A;  2P4T A;  4CFL A;  1QKW A;  4LNP A;  3CC7 A;  5CK9 A;  3LW5 E;  1M2V B;  5KCH A;  4O77 A;  4PJO A;  5IXB A;  1VYV A;  2E64 A;  2OAU A;  4M4Z A;  5E9Y A;  2NUT A;  5A5Q A;  3V7C A;  3A8H B;  2YHT A;  3UVX A;  1QVP A;  4F7U G;  5LJ5 f;  4C8Q D;  5D24 A;  2OTJ Q;  5FU7 B;  4ME7 A;  1KD1 C;  3CCM A;  3BDU A;  3U5J A;  2A37 A;  5A5N A;  5A83 A;  2OTL Q;  1P92 A;  3P8D A;  3VS7 A;  2VUB A;  3M5A A;  1AHJ B;  4P5N A;  3RUX A;  2P0Q A;  1T0H A;  3OW2 P;  4QSR A;  1N8R U;  2L0A A;  1B7T A;  2RQU A;  1D09 B;  2DIQ A;  5L99 A;  5GAN 2;  2KRS A;  3EGX A;  4GBQ A;  2CP3 A;  4NQM A;  2GTJ A;  4IUR A;  3G0J A;  3X24 B;  2GCX A;  2DF6 A;  3PGG A;  4HBX A;  4KT0 E;  4QC1 A;  4DBH A;  5C87 A;  2PTK A;  4OML A;  1UEB A;  5CQ8 A;  3CD6 Q;  4EMH A;  5GAN 7;  3SHW A;  2QDL A;  4J3I A;  1WQ7 A;  3BFM A;  4BW3 A;  3CCR Q;  4XAX B;  5IHN A;  2WSE E;  5D6W A;  1S72 T;  5F62 A;  4HCB A;  2DVR A;  2MOX A;  4Z93 A;  5KYX A;  1DJ7 B;  2KQW A;  2PVG B;  1Q82 R;  2CUB A;  1JJ2 P;  1D1C A;  3FJP A;  5FB0 A;  1TOV A;  5D3N A;  1SHG A;  3FDR A;  1ZKR A;  1B34 B;  3A5Z B;  2LT1 A;  1KQ2 A;  4BY6 C;  1VQ6 A;  4M78 B;  5LKT A;  4UIU A;  5FE7 A;  3A1P A;  1SEM A;  2F2V A;  2R57 A;  4LDY A;  4E7H A;  1KIK A;  2QA4 T;  3UV2 A;  4JRI A;  5DFC A;  4LDX A;  3L2Q A;  2EGE A;  3S3N A;  4BI3 A;  2E3K A;  2RFJ A;  4IKF A;  5CUE A;  4M78 D;  4NR8 A;  4M75 G;  1KC8 R;  2KRN A;  2DTO A;  1PM3 A;  2V1Q A;  4ELY C;  5ENF A;  1UHF A;  3IU5 A;  4M7A E;  1E6I A;  4PFO A;  4J9F A;  4E7L A;  2E70 A;  4DEY A;  2CP0 A;  5C4Q A;  2DL7 A;  3EHR A;  8AT1 B;  1N27 A;  1W4S A;  3GP8 A;  3EG0 A;  2LVM A;  2XID A;  5ENJ A;  2F5K A;  5L97 A;  2OJ2 A;  3QWY A;  3RIR A;  4NS5 A;  1WGS A;  2XG8 D;  1H92 A;  2DLP A;  1HD3 A;  4DON A;  4AT1 B;  3PNW C;  1E6G A;  4ZQL A;  4NOY A;  5A82 A;  2D8H A;  3OSV A;  4HXJ A;  2Y4Y A;  1VQ8 Q;  1KHC A;  1K73 U;  2YEL A;  3VKI A;  1TSF A;  3H9N A;  2RO0 A;  1FMK A;  3HMH A;  3UVY A;  5CKB A;  1JQQ A;  2LMJ A;  2DA9 A;  1QVG A;  1UJY A;  1KSW A;  2H3E B;  3RMQ A;  3KXT A;  2DKG A;  2DVV A;  4XK8 E;  2R0S A;  5A5P A;  5CY9 A;  4PJM A;  4M7D F;  2E3I A;  2ZZD A;  4HVV A;  3L42 A;  3OYN A;  4PK4 A;  3G0L A;  4PJJ A;  4ZGJ B;  4BW1 A;  4PJO C;  2J6O A;  3E9F A;  4YTL A;  4BI8 B;  2L5Q A;  2RH2 A;  4RMO A;  5GJV B;  3GG3 A;  1O9S A;  1TH7 A;  2QQ9 A;  1BBZ A;  4TZ8 A;  4A9F A;  2RHI A;  2DIG A;  4NR4 A;  5IBN A;  2RK2 A;  4R56 A;  5GAM d;  3ASK A;  3OYY A;  5FE3 A;  3I3J A;  4PCI A;  4E6R A;  2O2O A;  3FLG A;  5CIU A;  3CCJ T;  1VA7 A;  1PKT A;  2DYI A;  2EIF A;  2BE7 D;  4BUG A;  4V2S A;  1VQL A;  3OYI A;  2EBP A;  2GBQ A;  4A9I A;  1TU0 B;  2BIV A;  1SRM A;  4E2F B;  1QVF A;  4M7A F;  2RQR A;  2O01 E;  2MWP A;  2I7K A;  3TU4 K;  3U23 A;  1IRX A;  2K79 A;  1M2O A;  5TCM A;  4OB1 B;  3JCM P;  4NRA A;  3EGX B;  4X9D A;  3CCL Q;  2YXY A;  2PU9 B;  4IIM A;  3EG1 A;  4LYS A;  4YH3 A;  3NXB A;  1KQS S;  3IU6 A;  4LZR A;  3I55 Q;  2CP7 A;  4BI4 A;  4XTV A;  5EP7 A;  4C8Q E;  3URG A;  3CCM Q;  3A8L B;  2JZ2 A;  1HJD A;  2K2M A;  5E9V A;  3L2R A;  3OSS C;  1YNZ A;  5F1H A;  4YAB A;  4BD3 A;  1ZSZ A;  4QUT A;  3LWH A;  9ATC B;  1IXD A;  5DW1 A;  4QR5 A;  5EPR A;  5FH7 A;  4PJO B;  4NL2 A;  5M9O A;  2X4Y A;  1WQW A;  1BIB A;  2ROT A;  5J39 A;  2EYX A;  2OTL T;  3PMI A;  3QXE B;  1U06 A;  1AD5 A;  5KYU A;  2DXU A;  3QDR B;  1VQ4 A;  4QSS A;  1R0C B;  1WX6 A;  2O9V A;  2RM4 A;  2YUQ A;  3LYI A;  4HBV A;  3QO3 A;  4J0S A;  2QI2 A;  3VRZ A;  4C92 C;  1D0Y A;  5KTX A;  5HQ7 A;  3RR6 A;  4MEP A;  1M27 C;  5CCA A;  1GBR A;  3EFO A;  4QEU A;  1M4Z A;  5FH6 A;  3OYF A;  2V8J A;  1MMD A;  4HVW A;  1Y71 A;  4QBM A;  5F1L A;  3VS1 A;  4N4F A;  4O6J A;  5I89 A;  2D0Q B;  1FWZ A;  1X6G A;  2L2P A;  1GBQ A;  3I56 A;  5C6S A;  2EPD A;  3KFV A;  5HY6 A;  3NTH A;  5FE6 A;  2DZ9 A;  2PVO B;  3S6W A;  3CME Q;  2OO1 A;  4NYV A;  4LUD A;  5CR2 A;  1WHL A;  2JT4 A;  4RCC A;  1HXD A;  4MZM A;  4R55 A;  2K5L A;  2EYQ A;  5H1T A;  2LQ8 A;  3CCJ Q;  2RJD A;  5F63 A;  1AWW A;  5DY9 A;  1N8R R;  5A0D A;  5DYX A;  1UHC A;  2XMF A;  3CPW A;  4F7U A;  3QYH B;  4YBS A;  4WHW A;  1QLY A;  5EPB A;  4EMK A;  3LGF A;  1K0S A;  3CCQ Q;  2LJ0 A;  3HPW A;  4NYX A;  2K2V A;  4PJO G;  4M78 A;  4XTU A;  3RKX A;  4UIT A;  2KYM A;  2VV5 A;  5GAO p;  1D0Z A;  2RK1 A;  4C8Q F;  8ATC B;  1O75 A;  2NUP A;  1JU5 C;  4OB0 B;  2FB7 A;  4C8Q B;  1BCO A;  4LRG A;  4Z8A A;  2VWF A;  2AZS A;  2DER A;  1PD0 A;  2JMA A;  1I07 A;  4NR6 A;  2LJ3 A;  4J7I A;  2CYZ B;  3MUL A;  1OPL A;  1A0N B;  2PQW A;  1EX4 A;  4JJN K;  4NUC A;  3JCM f;  1NZ9 A;  2E1H A;  1VQN A;  2O88 A;  5GAO l;  3QWX X;  3UT1 A;  2AIR B;  2BKD N;  3M9Q A;  3CCE Q;  3A8M B;  1GCP A;  5D26 A;  4ZNX A;  5J3B A;  2MYS A;  4J9C A;  2L3S A;  4LD6 A;  2HL5 C;  2KMT A;  4QW2 A;  2HQE A;  3TRE A;  5E3G A;  5FDZ A;  2M0O A;  3UVD A;  2F6J A;  2KTB B;  1Z9Z A;  3CCV A;  2RHY A;  4EPC A;  2JW4 A;  4YBT A;  3CCS A;  4LDW A;  4OB2 B;  2QEX A;  4KUI A;  4LYI A;  4Z89 A;  4E7S A;  4XTY A;  4FW1 A;  5EVA A;  5GAO n;  4KRT A;  2DTI A;  5BT4 A;  2GFU A;  1Q95 G;  2D9T A;  5CVI A;  1Q82 U;  5D3L A;  4M7D E;  3CCQ A;  2DAQ A;  2P0K A;  3ZFJ A;  5CQX A;  4QEV A;  3M55 A;  3G4S Q;  4UYD A;  4IR3 A;  2KSS A;  3RES A;  3SVH A;  1M5Q 1;  1X43 A;  4NR9 A;  5EQ1 A;  4OMP A;  4BE2 A;  1AVZ C;  5CQT A;  5CQ3 A;  5KYN A;  2RI3 A;  4RVR A;  5DLZ A;  3OYE A;  4M78 G;  3EFO B;  2PVD B;  4C0D B;  5KYY A;  1YWP A;  5IG6 A;  2HEQ A;  3CCU A;  3M0U A;  4OGE A;  3OYG A;  4MEQ A;  4TU4 A;  4J83 A;  3MHX A;  2FG0 A;  3Q2E A;  5ETB A;  5L8R E;  1QWE A;  2X4X A;  4C92 E;  1Q81 U;  3C95 A;  3QZ9 B;  4MR3 A;  5CGP A;  3KBG A;  5FG5 A;  1WI7 A;  1RAI B;  3MET A;  3UV5 A;  2FHD A;  4N0A C;  2JNG A;  2VXF A;  1YJ9 Q;  1IO6 A;  3DWY A;  3PVQ A;  1M90 U;  3QG1 A;  2PZ1 A;  5LJ5 h;  1Q86 R;  1D0X A;  4QVD A;  1LOJ A;  2D0N A;  1MHN A;  4Z88 A;  2QK0 A;  1FX7 A;  2RHZ A;  3O35 A;  2ROL A;  5DY7 A;  4XUA A;  2W0Z A;  4LDF A;  1AWJ A;  1NBE B;  1K8A R;  5CQ5 A;  1MV0 B;  3DAI A;  2L84 A;  4TT6 A;  2RD1 A;  1GFC A;  3CCS Q;  5CRM A;  1M1K U;  5L96 A;  3QJY A;  4A4E A;  2DK3 A;  4C92 G;  2K57 A;  4YH4 A;  2XDB A;  3LQJ A;  4A9J A;  3FEO A;  5A5S A;  3OMC A;  5I2M A;  3VS6 A;  1Q81 C;  2WAC A;  2DTH A;  2EW3 A;  2ESW A;  4WTO B;  3FJ5 A;  5C0M A;  1VQ7 Q;  2ABL A;  4X2I A;  4F3I A;  2DVE A;  2XU8 A;  3S91 A;  2J06 A;  2MMP A;  4XTX A;  3WVE B;  5TB6 A;  1IHW A;  2RN8 A;  5D3H A;  5EA1 A;  4A9H A;  1JB0 E;  1I5O B;  4O75 A;  2ED0 A;  5E9L A;  4QSU A;  3JCM V;  3TCJ A;  4BB7 A;  2DXC A;  3BY7 A;  2L85 A;  4PTB A;  1OU8 A;  3ZBD A;  2GQI A;  3QZ5 B;  3R6N A;  3CCE T;  2MCN A;  3BE3 A;  1MND A;  1QW1 A;  2RJC A;  4Y03 A;  5DKH A;  1WHK A;  3UA6 A;  2I2L A;  3UW9 A;  2J7I A;  1G83 A;  3C12 A;  2A28 A;  1VQM A;  4M7D B;  3P1D A;  2NUZ A;  1M9S A;  5FFV A;  5BT3 A;  1G3T A;  3MUK A;  3CCJ A;  1LCK A;  2SEM A;  2OI3 A;  1ZUY A;  2CZ7 B;  2KRO A;  3HSB A;  2FVU A;  1QCF A;  2DIL A;  3M54 A;  3UVW A;  5FG6 A;  5LJ3 g;  4GY5 A;  1N8R C;  5GMK i;  2P4R A;  4MR4 A;  1WXU A;  1SRL A;  3OQ5 A;  1W70 A;  2QDY B;  3JB9 J;  5G4S A;  1NM7 A;  2GNC A;  3C4S A;  3G71 T;  2RNA A;  4IIO A;  1ARK A;  4UIZ A;  4KGV B;  3JB9 I;  4CUS A;  2YLC A;  1QP3 A;  2KR3 A;  2A08 A;  4NRC A;  4JZ4 A;  1YCS B;  5HK3 A;  4UIX A;  4C92 B;  5FBX A;  2AZV A;  2RQT A;  2WSF E;  2RQW A;  3PIP A;  2JM9 A;  4Z1S A;  5CKF A;  3IQL A;  1YHQ Q;  5FFW A;  2DVS A;  5E9I A;  5I22 A;  4HXN A;  5FE9 A;  4BW2 A;  4XQ3 A;  5E74 A;  4A4G A;  2ZPI B;  3UWN A;  5KE2 A;  1KQS P;  2ZPH B;  4EMK C;  1U1T A;  4A4F A;  3P1F A;  2EWN A;  3CC2 T;  5KHM A;  5F36 A;  5F5Z A;  4C0Z A;  5GAN 5;  2HMA A;  3CQT A;  4M77 F;  3JB9 H;  4QY4 A;  1TXQ A;  3RER A;  1PHT A;  4RG8 A;  1RAG B;  4HXO A;  2LNV A;  3V8J A;  1VQ4 T;  2RMO A;  3OS1 A;  5IGN A;  5FU6 C;  5A5O A;  3RKW A;  1IRE B;  1F1B B;  4HA8 A;  3UF4 A;  3CEY A;  4FU6 A;  1X2K A;  2OAW A;  3EG9 A;  2VB6 A;  3ME9 A;  2F5T X;  2NXB A;  2E10 A;  3G1J A;  3PMT A;  4EIK A;  3QZS A;  2EJF A;  3JV3 A;  1KQ1 A;  2MAM A;  5KYX B;  2A7Y A;  5GMK h;  5F60 A;  3U5O A;  5BT5 A;  4NR5 A;  1CKA A;  4Q0O A;  4FW2 A;  1VQP T;  1G3Y A;  1K9M C;  2R10 A;  5E73 A;  2JTM A;  3ULR B;  2YUP A;  1RAA B;  5LJ5 g;  3CC4 A;  5LVQ A;  3V8K A;  5IID A;  1PUO A;  2KT1 A;  5ETD A;  2DD4 A;  2IPO B;  4L6V 5;  5KTU A;  4ZN1 A;  5J0D A;  1KC8 U;  1X75 C;  2E12 A;  3EAE A;  2F1L A;  1GRI A;  2DXT A;  1VQO T;  1OEB A;  1NYF A;  2RA2 A;  2BZX A;  2DRM A;  2DJZ A;  1M30 A;  5DKD A;  1VQ5 A;  3OBY A;  3JVK A;  3SDZ A;  2XD0 A;  1OX9 A;  3INZ A;  3MCA B;  1B34 A;  1Y7X A;  1VOM A;  4N3W A;  4FYV B;  4M77 G;  1ZBJ A;  2EKH A;  3H8Z A;  3HKS A;  3OA6 A;  3EG2 A;  1I4K 1;  1OZ2 A;  1HSQ A;  4A4H A;  1YIJ Q;  1PG5 B;  4E47 A;  2DEQ A;  3TQ7 P;  4BE0 A;  1YJN Q;  5CUD A;  1AOJ A;  3P1E A;  2K6D A;  2MIO A;  1S72 A;  2WSC E;  2XK0 A;  3V8L A;  1J3T A;  4DOV A;  3NMZ C;  1W6X A;  4KBM B;  4M7A D;  2LT4 A;  2LDM A;  5D3R A;  4CI0 C;  4KH0 B;  3I5S A;  4XUB A;  4JJD A;  4EMG A;  4A9L A;  2D9E A;  3VS3 A;  4ZGD B;  3MPU B;  5LJ3 j;  2FL7 A;  5DLQ E;  4F7U E;  1U5S A;  1YI2 A;  1VQ9 Q;  1UEC A;  1TTH B;  3JB9 F;  1YHQ T;  4QYD A;  2ZAE A;  2MPX C;  2RPN A;  5L98 A;  2LZ6 B;  5LJ3 h;  1ZUU A;  3JCM b;  2OSS A;  1YIT A;  4BHW A;  1JJ2 S;  4QSX A;  4WF2 A;  1M3A A;  1K1Z A;  5GAN 3;  2L89 A;  5A0G A;  2LSP B;  3M0T A;  4IR6 A;  3CMA A;  4PL6 A;  3HFN A;  2QTX A;  3ZYU A;  3QII A;  1X69 A;  2EQK A;  2GQV A;  1BI3 A;  3QDF A;  4NUD A;  4OP0 A;  4A4K A;  2LC4 A;  1M3C A;  1SF9 A;  2V1R A;  5C89 A;  1KC8 C;  2DVJ A;  1H8K A;  2Y90 A;  3HRS A;  2A36 A;  5CQA A;  5FB1 A;  2VGM A;  2JJ9 A;  2JTF A;  2EYY A;  4M75 B;  4KH1 B;  3VS5 A;  3PIO A;  1WNL A;  4BJX A;  4M75 E;  1BI2 A;  1VYT A;  4NL3 A;  5EG2 A;  3M0Q A;  2R0V A;  1MMA A;  4ATO A;  4A9E A;  4QT7 A;  1VQP A;  1QVF S;  5F2P A;  2YUN A;  4N0A A;  4LYW A;  2X4J A;  3M59 A;  5KCO A;  1VQN T;  2DXB A;  4CUP A;  2K4Y A;  1U1S A;  4IR4 A;  2L8D A;  4QB3 A;  5ENG A;  2RI2 A;  3BDL A;  4MDW A;  5CPE A;  4UYH A;  1RAC B;  5FRN A;  2E41 A;  2EYW A;  1QVG P;  1VQ9 A;  3ZL7 C;  4M7D A;  2COY A;  5CQY A;  2B8A A;  2H8H A;  1UG1 A;  1PNJ A;  5JI8 A;  1B3Q A;  3G6E Q;  5GAO r;  2L3Q A;  1NJI U;  3LWI A;  3EGD A;  1WHH A;  2JTE A;  2M02 A;  1VQM Q;  2CKK A;  1VQK T;  1WJS A;  3CME T;  2RI7 A;  4QEW A;  5ENI A;  5I29 A;  5ACY A;  4NUE A;  4M78 F;  1YJW Q;  2MF2 A;  2OTL A;  4XTW A;  3GNF B;  4QR3 A;  1VIE A;  2YSQ A;  5HEL A;  4M75 C;  4YYK A;  4YBM A;  5EWD A;  1M1F A;  1ZLM A;  3CC7 Q;  2RHU A;  3VKG A;  3FRN A;  2HNI A;  3CCM T;  2H3J A;  1N6A A;  4D6W A;  5G4R A;  3REA B;  1I5L A;  2GGR A;  4UYE A;  2FPE A;  4IUQ A;  4AMC A;  1VQN Q;  2DL3 A;  1VQ4 Q;  1IZ6 A;  2X3W D;  3G4S T;  3X26 B;  4LE9 A;  1N9R A;  5E7D A;  2D1X A;  1KG1 A;  5I86 A;  1G8X A;  4D8K A;  2NWM A;  1T3S A;  3O34 A;  1YI2 T;  5LKZ A;  4XY8 A;  1VQK Q;  2HKQ B;  3PE0 A;  5DLO A;  1IGQ A;  3GNG A;  5C8G A;  5GMK e;  5CFW A;  1WYX A;  1TUD A;  4JDS A;  4YC9 A;  4CUR A;  3Q1J A;  5IAY A;  3BW1 A;  4QSP A;  3EFR A;  3J81 E;  4R0K A;  3JCM e;  1BI0 A;  5D6X A;  2E5Q A;  5ENC A;  3M57 A;  4QSV A;  1EQF A;  5HRV A;  2DET A;  1OUL A;  3JVL A;  4IUP A;  3MP6 A;  5E0R A;  2X9H A;  4YAT A;  3SWN C;  3GPL A;  5K29 A;  4Z6H A;  3OS0 A;  3CC7 T;  4IR5 A;  2YEM A;  2KDS A;  2QGF B;  5CU8 A;  1VQ6 T;  1LVK A;  4C92 A;  4UIY A;  2D6F A;  4CC4 B;  4CC2 A;  2VXE A;  1NG2 A;  4KCX A;  1BI1 A;  1VQ8 A;  3EH2 A;  3MEW A;  2DO3 A;  3QUI A;  3ONI A;  1GL5 A;  4DBR A;  2O31 A;  1VIF A;  5IGK A;  3UA7 A;  3H0F A;  3DB3 A;  3S3O A;  3REB B;  1C6V X;  1D1A A;  4Y28 E;  5HKC A;  2FYK A;  4DEX A;  3AT1 B;  4HT9 A;  2BTT A;  3LX7 A;  3TVT A;  4N4H A;  2X3X D;  3MEA A;  4E7Z A;  1RI9 A;  4TZ2 A;  1X01 A;  5CUC A;  5D25 A;  1RAB B;  2BZ8 A;  4CL9 A;  2QG9 B;  3MB3 A;  5GAO m;  4OVA A;  4PLL A;  5FRO A;  2CP2 A;  4X1V A;  4TT2 A;  1YIJ T;  3P8B B;  4FLP A;  1VQ7 T;  2MJV B;  3EFS A;  1X0J A;  5EC7 A;  5ENE A;  4OMN A;  2IG0 A;  2KE9 A;  1YN8 A;  2KVQ G;  1M8V A;  3P5O A;  4FIB A;  2DX1 A;  4IOO A;  2RJF A;  2MI6 A;  2D8J A;  2IVW A;  5F61 A;  5LJ3 e;  4AFU C;  3CCQ T;  2ZPG B;  1YJN A;  3HRU A;  2BE9 B;  4PJO D;  1T0J A;  2D82 A;  4DBF A;  1Y07 A;  5I1Q A;  1D3B B;  3JSC A;  4C8Q A;  4B9X A;  2VAS A;  1VQ8 T;  1PC0 A;  5D3T A;  5LKX A;  1UGR B;  3JRZ A;  2RB6 A;  2ZGW A;  4HXM A;  2O4X A;  4EMK B;  1Z9Q A;  3GBQ A;  5EWH A;  5AYF A;  4J1P A;  4KGZ B;  2BUD A;  5E3D A;  1RAD B;  2VC8 A;  3E9G A;  1LPL A;  3QZV A;  4KUD K;  5LVR A;  1E6H A;  5CQ7 A;  1GCQ A;  2B86 A;  3RDV A;  1PRL C;  5DLX A;  4HT8 A;  2SRC A;  2K3Y A;  4M77 B;  2QAS A;  1YCY A;  1AZE A;  4E7K A;  5FE0 A;  3GOX A;  4LD9 K;  3MEU A;  3N5B B;  5HRW A;  2KYB A;  1WHM A;  5GAM j;  3OW2 A;  1RUW A;  4J9H A;  1RI0 A;  2HAX A;  4QYL A;  3CXC A;  4HKE A;  4JRQ A;  4JUV A;  4PFP A;  3JCM d;  3SWN B;  1IB8 A;  1OU9 A;  4ALG A;  2DL8 A;  2E4H A;  2K7A A;  3HFO A;  5I21 A;  3WXM B;  4C0G A;  1ZQ1 A;  1YP5 A;  4CC7 A;  2J6K A;  3RMS A;  3H0I A;  4C92 F;  5FW9 A;  1VQP Q;  4II1 A;  4Y92 A;  5IHK A;  2DYB A;  5HQ5 A;  1MV3 A;  1OPK A;  2K3X A;  4L59 A;  1MUZ A;  4CLB A;  2IIM A;  1R0B G;  7AT1 B;  1KQS A;  5GAM h;  5ENH A;  2ENM A;  1WHG A;  2X35 A;  4J6W A;  4E96 A;  5I80 A;  2FZC B;  2AK5 A;  4M78 C;  3I56 Q;  3HHT B;  2FEI A;  5AD3 A;  1UJ0 A;  3VUB A;  1VQM T;  3CD6 T;  4X34 A;  4MDX A;  4TYL A;  4FSX A;  1F68 A;  2AT1 B;  3TEE A;  4HXK A;  4ELZ C;  4Z02 A;  1T3L A;  4FM4 B;  2LNH B;  4HBW A;  1K0X A;  3SVF A;  1K4U S;  1OV3 A;  2E6N A;  2EAY A;  2LX9 A;  1VQL T;  3RNJ A;  1KK7 A;  5CO7 A;  1FXX A;  2LTO A;  2QQB A;  3PFS A;  4K11 A;  1NYG A;  2C06 A;  4JJC A;  4BY6 B;  5CKH A;  2FSA A;  3OMG A;  3OY9 A;  4MEN A;  1WIE A;  4FL6 A;  5GAN f;  3X20 B;  3QPH A;  1VUB A;  3UV4 A;  1WHJ A;  2C0O A;  1Q86 C;  1X6B A;  5AME A;  1V29 B;  4QUU A;  4AI6 A;  1HK9 A;  3QSU A;  4WIV A;  4LC2 A;  4LXC A;  1ZA2 B;  2W10 A;  3L2V A;  1K8A U;  1M3B A;  5GAN j;  4AFZ C;  5GAN 6;  4OGI A;  2R58 A;  1U3O A;  1U8R A;  4MR6 A;  5CUB A;  3A8O B;  2CGH A;  2HL3 A;  4O7C A;  5A7C A;  5D0C A;  1JRI A;  2JMC A;  5FU7 C;  2ZPB B;  3JVJ A;  1TS9 A;  4MMK A;  3UDC A;  5LJ5 j;  3JB9 D;  1QVF P;  4C92 D;  1Y0M A;  5AD2 A;  4UYF A;  2MK5 A;  4F7U F;  3CCR A;  1Q81 R;  1VQK A;  3CCE A;  1JEG A;  5DYC A;  3G7Z A;  2RI5 A;  5II2 A;  4Q5W A;  3QZT A;  4CUU A;  1SPK A;  4M75 A;  4PKC C;  1UGV A;  5I2S A;  4PCE A;  1Y57 A;  2M9U A;  2I8N A;  4C0D C;  1M1K C;  1LJO A;  1H3H A;  4MZT A;  4OGC A;  2GF7 A;  2NUT B;  2CUD A;  5HCL A;  3G6E T;  4TS8 A;  3QHS A;  1VQ6 Q;  2LQW A;  3LJW A;  2VYT A;  4NR7 A;  3L2Z A;  4RTT A;  1ZHI A;  6AT1 B;  4O7B A;  1ZA1 B;  3FC3 A;  2CZ0 B;  3CPW P;  4M7D C;  1VYU A;  2ATC B;  2V8K A;  1RAF B;  2JVV A;  2HCK A;  3CCV Q;  2X4W A;  2M0Y A;  1G3W A;  2CP6 A;  1TG0 A;  4JLI A;  1WUG A;  3I56 T;  3QYG B;  2RO1 A;  5DFD A;  5KU3 A;  2V26 A;  2X51 A;  4NRB A; 
#chains in the Genus database with same CATH homology
 4LDU A;  1UB4 A;  4DQ2 A;  4XY9 A;  4ZGE B;  3OYK A;  4OB3 B;  3MXF A;  2HBP A;  4A53 A;  1XTD A;  3JAM E;  3V7R A;  3E1S A;  3F70 A;  4C67 A;  2E65 A;  4YAX A;  4CUT A;  3E19 A;  3CC2 A;  2PUO B;  3VJP A;  4LZ2 A;  3OYL A;  1YJ9 A;  2WP1 A;  3D7C A;  5LKU A;  5I7Y A;  4O5V A;  4XYA A;  2QQA A;  4CUQ A;  3OS2 A;  4C66 A;  3OYH A;  3SB2 A;  1W2B A;  5GAM g;  4PS5 A;  4YYJ A;  3JVM A;  3CCU T;  3PT9 A;  1M90 C;  1XOV A;  1H3Z A;  4M77 E;  3G4S A;  4TU6 A;  1NJI C;  5EM3 A;  5CS8 A;  1NE8 A;  3OYM A;  5IN1 A;  4ZN3 A;  5LJ3 d;  1XNI A;  4NXJ A;  5EK9 A;  5LJ2 A;  4OMF B;  2WP2 A;  4LR6 A;  1OI1 A;  2EKO A;  3CMA T;  1VQ7 A;  2YRV A;  5D3J A;  2P0P A;  1I8F A;  4HBY A;  4MZP A;  2RNW A;  2F69 A;  1JBM A;  3GLX A;  1WJR A;  4ZC9 A;  3GIB A;  4RG2 A;  5EWW A;  2LCL A;  3JCM W;  1KD1 U;  5GMK m;  1EIF A;  5KH6 A;  2N9G A;  4FT2 A;  4QVZ A;  1Y96 B;  4GLK A;  1XQH A;  5DKC A;  4YYG A;  2YYN A;  2YDW A;  2L3R A;  2R5A A;  5FLX E;  5CUG A;  4QVC A;  4C5E A;  4UYG A;  1Q82 C;  4YYI A;  3HME A;  4MEO A;  3KUF A;  2XHC A;  3S3M A;  1YHQ A;  1VQ9 T;  3U5L A;  1YIT T;  5CP5 A;  4IUU A;  5EWV A;  2LQK A;  5D3S A;  4C8Q C;  3I55 A;  3LXJ A;  5L8U A;  1LNX A;  3P1C A;  1OYX A;  4C5I A;  3JB9 G;  5F3A A;  4UC4 A;  4PLI A;  4TTE A;  3G71 A;  2H60 A;  5HRX A;  1YJN T;  3CCL A;  2CZ1 B;  5GAM e;  3OS5 A;  4J7F A;  1BKB A;  4UYF B;  3MEV A;  4OUF A;  4XU0 A;  5CQ6 A;  2CZ6 B;  2GRC A;  4IUT A;  5FE1 A;  2XIC A;  3RKY A;  5LJ5 d;  3JCM J;  5DBM A;  2E7O A;  1D3B A;  1NPR A;  4MR5 A;  4O70 A;  3QJ6 A;  2KY9 A;  5GAN d;  3O33 A;  4OGJ A;  3CPF A;  4PKL A;  3UPU A;  5HQ6 A;  4KUL A;  5C7N A;  1Q7Y C;  5HEN A;  5EV9 A;  3R6O A;  3OYC A;  3CCV T;  1M1G A;  1ZS5 A;  5GAN e;  2G4A A;  2NLU A;  4O7A A;  4O78 A;  3I55 T;  5FFY A;  1UGP B;  4E7I A;  3H6Z A;  4N4I A;  3CME A;  3MB4 A;  1NPP A;  2KAF A;  2RHX A;  4CFK A;  1UGS B;  2XDD A;  5EIS A;  1H64 1;  3JCM X;  1QP2 A;  5HFR A;  2RS9 B;  3FIF A;  3DKM A;  3JCM Q;  3OYD A;  2V8I A;  3M53 A;  2EQU A;  4O74 A;  5EGU A;  5KO4 A;  5HFQ A;  1Q86 U;  3RCW A;  5EPS A;  5H85 A;  4EDU A;  4J6Y A;  4BDY A;  5IGL A;  3HMF A;  4A9N A;  4RCB A;  5IGM A;  1R8O B;  2YW5 A;  2EJG A;  4UIW A;  5CZG A;  4M7A C;  4UIV A;  3LLR A;  5GMK j;  4QNS A;  5ENB A;  3ER0 A;  4YAD A;  5A81 A;  3M4Y A;  4L5G A;  1GXI E;  2M16 A;  5GAN 8;  4M7A G;  5F25 A;  3K2J A;  4JLG A;  4J8O A;  5KTW A;  3C94 A;  1Q7Y U;  1OZ3 A;  5GMK l;  3LQH A;  4NQN A;  4JRK A;  4M75 D;  2OTJ T;  3CC4 T;  2DPP B;  4XU3 A;  2O4X B;  3HL8 A;  3SVG A;  4J5Y A;  2CS7 A;  5A2Q E;  3A8G B;  1QVG S;  3O37 A;  3U5P A;  2G3R A;  4YYM A;  1UGQ B;  4LDV A;  3O36 A;  2A3L A;  5GAN h;  4YYN A;  5FE2 A;  4HXR A;  2R5M A;  1VQ5 T;  4E7J A;  3VUZ A;  3JCM h;  4C5H A;  1BYM A;  4TT4 A;  5CQ4 A;  3OB9 A;  4ZTF A;  2KK4 A;  4XU2 A;  3U5K A;  4PJO E;  5A85 A;  4BW4 A;  1JM4 B;  3G6E A;  5CKD A;  4A9O A;  3Q2F A;  3M56 A;  4N4G A;  5EU1 A;  3PTA A;  2M1H A;  3M58 A;  4XU1 A;  5FG4 A;  5CUA A;  4M7A B;  5COI A;  3OW2 S;  4M77 A;  5EWC A;  1JJ2 A;  3CXC S;  4A9K A;  4YY4 A;  4ZTJ A;  1BIA A;  3J80 E;  3LH0 A;  4O7F A;  3QKJ A;  4JS4 A;  2DAT A;  2EFI A;  3J7A F;  5CRZ A;  4QZS A;  1RL2 A;  5A0L A;  5FH8 A;  4O72 A;  4PJO F;  3CPW S;  5FE5 A;  4C8Q G;  5LUU A;  5EI4 A;  4O71 A;  2HQX A;  2E7N A;  5GAM f;  3NTK A;  5DW2 A;  1PSE A;  4DA4 A;  2LRQ A;  3HP9 A;  5IT9 E;  2ZPF B;  3L2U A;  5AMF A;  3OYB A;  2XI9 A;  4GPJ A;  5DYU A;  4M7A A;  4VUB A;  3GF5 A;  1ZBX A;  1K73 C;  5J26 A;  3HRT A;  5LL6 S;  5D6Y A;  4YK0 A;  3WVD B;  5GAN 4;  2QA4 A;  4HCZ A;  3TLP A;  5II1 A;  5LJ0 A;  1VQO A;  4BAC A;  3VU3 C;  5LJ3 f;  5I83 A;  2HD0 A;  3OYJ A;  3FKM X;  5CKE A;  4QR4 A;  3FB9 A;  5CAI A;  5L8T A;  5LJ5 e;  4JS5 A;  4Z1Q A;  4BE1 A;  2XKO C;  1N72 A;  4J6X A;  2GFA A;  3MP8 A;  5KE3 A;  2DKW A;  4YYH A;  4TVR A;  4C5G A;  3S92 A;  3SFM A;  1I81 A;  4Q0N A;  2PUK B;  2LCC A;  5FU6 B;  5GAN g;  4B9W A;  5HK0 A;  5D3P A;  3JCM g;  3DLM A;  3P8H A;  3QBY A;  1K8A C;  5FE4 A;  3ZEH A;  3AAD A;  4QQ6 A;  5I88 A;  4O76 A;  4CRI A;  4QQD A;  5I7X A;  2F6N A;  5DM7 R;  2QQS A;  2OUO A;  2EQM A;  2DD5 A;  2ZCF B;  4M7D D;  1WUM A;  4KV4 A;  3OYA A;  3SWN A;  3U5M A;  4WHU A;  1SSF A;  4C0F A;  3NFC A;  3NTI A;  3O8V A;  1YIJ A;  3CCS T;  3AHU A;  1KHI A;  2RNY A;  3X28 B;  2YQD A;  3U5N A;  3CCR T;  4X9C A;  2K5F A;  4IUV A;  4HXP A;  5I40 A;  1YJ9 T;  4YYD A;  4XTZ A;  4A54 A;  2JN0 A;  3SD4 A;  3JCM c;  4ZW1 A;  4O7E A;  5DX4 A;  3CCL T;  4HXL A;  1G5V A;  5HLS A;  5JWM A;  5H1U A;  4DOW A;  2MWO A;  5E9M A;  4QQG A;  4QSQ A;  5FE8 A;  4PY6 A;  3VV0 A;  4A9M A;  2K5I A;  4OF1 A;  2QXF A;  1N9S A;  3MO8 A;  4JRP A;  2EQJ A;  3L2W A;  3CBO A;  5HEM A;  3M4G A;  2JUF A;  1G3S A;  4HXS A;  3X25 B;  2QQR A;  5DYA A;  3MP1 A;  4RKU E;  5A5R A;  5HM0 A;  4QC3 A;  4NYW A;  4M7D G;  4HCC A;  2ZPE B;  1MGQ A;  2DWW A;  2RNX A;  3OBW A;  1JSP B;  2Y4X A;  1YJW T;  2E6Z A;  3DB4 A;  4Y91 A;  4M77 D;  1X6O A;  4LZS A;  2DZC A;  4AKN A;  2DVQ A;  2EJ9 A;  1WPY A;  4IOR A;  2AHJ B;  4M75 F;  2YEK A;  3LQI A;  1YBY A;  2JOY A;  5DFB A;  4F7U B;  2OTJ A;  4YY6 A;  4QST A;  1WJQ A;  5C85 A;  3AQA A;  4IOQ A;  1K9M U;  4M77 C;  3LGL A;  4FT4 A;  5EIC A;  5GAO q;  1W2B S;  2R0Y A;  2L5E A;  4TQN A;  5LJ1 A;  2XDP A;  4QSW A;  3VYG A;  3VYH B;  3CBP A;  3MQM A;  5FRM A;  4KV1 A;  3L1A A;  5E9K A;  2YLB A;  3CBM A;  2RJE A;  4BDZ A;  5D7X A;  3CD6 A;  5HJC A;  4J0R A;  4Z6I A;  3V7S A;  4ALH A;  4M78 E;  1YJW A;  5CTL A;  1Y96 A;  4MML A;  3DLL A;  4PNO A;  3T9N A;  2QEX T;  1PSF A;  2VGN A;  5H1V A;  2P4T A;  4CFL A;  3CC7 A;  5CK9 A;  3LW5 E;  5KCH A;  4O77 A;  4PJO A;  2E64 A;  2OAU A;  5E9Y A;  3V7C A;  5A5Q A;  3A8H B;  2YHT A;  3UVX A;  1QVP A;  4F7U G;  5LJ5 f;  4C8Q D;  5D24 A;  5FU7 B;  4ME7 A;  1KD1 C;  3CCM A;  3BDU A;  3U5J A;  5A5N A;  5A83 A;  1P92 A;  3P8D A;  2VUB A;  3M5A A;  1AHJ B;  4P5N A;  3RUX A;  2P0Q A;  4QSR A;  1N8R U;  2DIQ A;  5L99 A;  5GAN 2;  4NQM A;  4IUR A;  3X24 B;  3G0J A;  2GCX A;  3PGG A;  4HBX A;  4KT0 E;  4QC1 A;  5C87 A;  1UEB A;  5CQ8 A;  4EMH A;  5GAN 7;  4J3I A;  1WQ7 A;  3BFM A;  4BW3 A;  4XAX B;  2WSE E;  5D6W A;  1S72 T;  5F62 A;  4HCB A;  2DVR A;  4Z93 A;  1DJ7 B;  2KQW A;  2PVG B;  3FJP A;  5FB0 A;  5D3N A;  3FDR A;  1B34 B;  3A5Z B;  2LT1 A;  1KQ2 A;  4BY6 C;  1VQ6 A;  4M78 B;  5LKT A;  4UIU A;  5FE7 A;  2R57 A;  4LDY A;  4E7H A;  2QA4 T;  3UV2 A;  4JRI A;  5DFC A;  4LDX A;  3L2Q A;  3S3N A;  4BI3 A;  2E3K A;  2RFJ A;  4IKF A;  5CUE A;  4M78 D;  4NR8 A;  4M75 G;  2DTO A;  4ELY C;  5ENF A;  3IU5 A;  4M7A E;  1E6I A;  4E7L A;  2E70 A;  5C4Q A;  1N27 A;  1W4S A;  3GP8 A;  2LVM A;  2XID A;  5ENJ A;  2F5K A;  5L97 A;  3RIR A;  4NS5 A;  1WGS A;  2XG8 D;  4DON A;  3PNW C;  4ZQL A;  4NOY A;  5A82 A;  3OSV A;  2Y4Y A;  1KHC A;  1K73 U;  2YEL A;  3VKI A;  2RO0 A;  3HMH A;  3UVY A;  5CKB A;  1QVG A;  3RMQ A;  3KXT A;  2DKG A;  2DVV A;  4XK8 E;  2R0S A;  5A5P A;  5CY9 A;  4M7D F;  2ZZD A;  3L42 A;  3OYN A;  3G0L A;  4ZGJ B;  4BW1 A;  4PJO C;  3E9F A;  4YTL A;  4BI8 B;  2L5Q A;  2RH2 A;  4RMO A;  3GG3 A;  1O9S A;  1TH7 A;  2QQ9 A;  4TZ8 A;  4A9F A;  2RHI A;  2DIG A;  4NR4 A;  5IBN A;  2RK2 A;  4R56 A;  5GAM d;  3ASK A;  3OYY A;  5FE3 A;  3I3J A;  4PCI A;  3FLG A;  5CIU A;  3CCJ T;  2EIF A;  4BUG A;  4V2S A;  1VQL A;  3OYI A;  4A9I A;  2BIV A;  1QVF A;  4M7A F;  2O01 E;  2MWP A;  2I7K A;  3TU4 K;  5TCM A;  4OB1 B;  3JCM P;  4NRA A;  4X9D A;  2PU9 B;  4LYS A;  4YH3 A;  3NXB A;  1KQS S;  3IU6 A;  4LZR A;  4BI4 A;  4XTV A;  5EP7 A;  4C8Q E;  3URG A;  3A8L B;  2JZ2 A;  5E9V A;  3L2R A;  3OSS C;  5F1H A;  4YAB A;  4BD3 A;  4QUT A;  3LWH A;  5DW1 A;  4QR5 A;  5EPR A;  5FH7 A;  4PJO B;  4NL2 A;  5M9O A;  2X4Y A;  1WQW A;  1BIB A;  5J39 A;  2OTL T;  3PMI A;  3QXE B;  2DXU A;  3QDR B;  1VQ4 A;  4QSS A;  2RM4 A;  3LYI A;  4HBV A;  3QO3 A;  4J0S A;  2QI2 A;  4C92 C;  5KTX A;  5HQ7 A;  4MEP A;  5CCA A;  4QEU A;  1M4Z A;  5FH6 A;  3OYF A;  2V8J A;  1Y71 A;  4QBM A;  5F1L A;  4N4F A;  4O6J A;  5I89 A;  2D0Q B;  1FWZ A;  3I56 A;  5C6S A;  5HY6 A;  3NTH A;  5FE6 A;  2DZ9 A;  2PVO B;  3S6W A;  2OO1 A;  4NYV A;  5CR2 A;  4RCC A;  1HXD A;  4MZM A;  4R55 A;  2K5L A;  2EYQ A;  5H1T A;  2LQ8 A;  2RJD A;  5F63 A;  5DY9 A;  5A0D A;  5DYX A;  3CPW A;  4F7U A;  3QYH B;  4YBS A;  4WHW A;  5EPB A;  4EMK A;  3LGF A;  3HPW A;  4NYX A;  2K2V A;  4PJO G;  4M78 A;  4XTU A;  3RKX A;  4UIT A;  2VV5 A;  5GAO p;  2RK1 A;  4C8Q F;  1O75 A;  4OB0 B;  2FB7 A;  4C8Q B;  4LRG A;  4NR6 A;  4J7I A;  2CYZ B;  3MUL A;  2PQW A;  4JJN K;  4NUC A;  3JCM f;  1NZ9 A;  2E1H A;  1VQN A;  5GAO l;  3UT1 A;  2BKD N;  3M9Q A;  3A8M B;  5D26 A;  5J3B A;  4LD6 A;  2KMT A;  4QW2 A;  2HQE A;  3TRE A;  5E3G A;  5FDZ A;  2M0O A;  3UVD A;  2F6J A;  2KTB B;  3CCV A;  2RHY A;  4EPC A;  4YBT A;  3CCS A;  4LDW A;  4OB2 B;  2QEX A;  4KUI A;  4LYI A;  4XTY A;  5EVA A;  5GAO n;  2DTI A;  5BT4 A;  2GFU A;  2D9T A;  5CVI A;  1Q82 U;  5D3L A;  4M7D E;  3CCQ A;  2DAQ A;  2P0K A;  3ZFJ A;  5CQX A;  4QEV A;  3M55 A;  4UYD A;  4IR3 A;  2KSS A;  3RES A;  3SVH A;  1M5Q 1;  4NR9 A;  5EQ1 A;  4BE2 A;  5CQT A;  5CQ3 A;  2RI3 A;  4RVR A;  5DLZ A;  3OYE A;  4M78 G;  2PVD B;  4C0D B;  3CCU A;  5IG6 A;  4OGE A;  3OYG A;  4MEQ A;  4TU4 A;  4J83 A;  3MHX A;  3Q2E A;  5ETB A;  5L8R E;  2X4X A;  4C92 E;  1Q81 U;  3C95 A;  3QZ9 B;  4MR3 A;  5CGP A;  3KBG A;  5FG5 A;  3MET A;  3UV5 A;  2FHD A;  4N0A C;  2JNG A;  2VXF A;  3DWY A;  1M90 U;  3QG1 A;  5LJ5 h;  4QVD A;  1LOJ A;  1MHN A;  1FX7 A;  2RHZ A;  3O35 A;  5DY7 A;  4XUA A;  4LDF A;  5CQ5 A;  3DAI A;  2L84 A;  4TT6 A;  2RD1 A;  5CRM A;  1M1K U;  5L96 A;  4C92 G;  4A4E A;  2DK3 A;  3QJY A;  2K57 A;  4YH4 A;  2XDB A;  3LQJ A;  4A9J A;  3FEO A;  5A5S A;  3OMC A;  5I2M A;  1Q81 C;  2WAC A;  2DTH A;  5C0M A;  4X2I A;  4F3I A;  2DVE A;  2XU8 A;  3S91 A;  4XTX A;  2MMP A;  3WVE B;  5TB6 A;  5D3H A;  5EA1 A;  4A9H A;  1JB0 E;  4O75 A;  5E9L A;  4QSU A;  3JCM V;  3TCJ A;  4BB7 A;  2DXC A;  3BY7 A;  2L85 A;  4PTB A;  3ZBD A;  3QZ5 B;  3CCE T;  1QW1 A;  2RJC A;  4Y03 A;  5DKH A;  3UW9 A;  2I2L A;  3C12 A;  1VQM A;  4M7D B;  3P1D A;  1M9S A;  5FFV A;  5BT3 A;  1G3T A;  3MUK A;  3CCJ A;  2CZ7 B;  3HSB A;  2FVU A;  3M54 A;  3UVW A;  5FG6 A;  5LJ3 g;  4GY5 A;  1N8R C;  5GMK i;  4MR4 A;  3OQ5 A;  2QDY B;  3JB9 J;  5G4S A;  3C4S A;  3G71 T;  4UIZ A;  3JB9 I;  4CUS A;  2YLC A;  1QP3 A;  4NRC A;  5HK3 A;  4UIX A;  4C92 B;  5FBX A;  2WSF E;  3PIP A;  4Z1S A;  5CKF A;  5FFW A;  2DVS A;  5E9I A;  4HXN A;  5FE9 A;  4BW2 A;  4XQ3 A;  5E74 A;  4A4G A;  2ZPI B;  3UWN A;  5KE2 A;  2ZPH B;  4EMK C;  1U1T A;  4A4F A;  3P1F A;  2EWN A;  3CC2 T;  5KHM A;  5F36 A;  5F5Z A;  4C0Z A;  5GAN 5;  4M77 F;  3JB9 H;  4QY4 A;  3RER A;  4RG8 A;  4HXO A;  2LNV A;  3V8J A;  1VQ4 T;  3OS1 A;  5IGN A;  5FU6 C;  5A5O A;  3RKW A;  1IRE B;  4HA8 A;  3CEY A;  4FU6 A;  3ME9 A;  2F5T X;  2NXB A;  2E10 A;  3PMT A;  3QZS A;  2EJF A;  1KQ1 A;  2MAM A;  2A7Y A;  5GMK h;  5F60 A;  3U5O A;  5BT5 A;  4NR5 A;  1VQP T;  4Q0O A;  1G3Y A;  1K9M C;  2R10 A;  5E73 A;  2JTM A;  5LJ5 g;  3CC4 A;  5LVQ A;  3V8K A;  5IID A;  5ETD A;  2DD4 A;  4L6V 5;  5KTU A;  4ZN1 A;  5J0D A;  1KC8 U;  1X75 C;  2E12 A;  3EAE A;  2DXT A;  1VQO T;  2RA2 A;  2DJZ A;  5DKD A;  1VQ5 A;  3OBY A;  3JVK A;  3SDZ A;  2XD0 A;  3INZ A;  3MCA B;  1B34 A;  1Y7X A;  4N3W A;  4M77 G;  3H8Z A;  3HKS A;  3OA6 A;  1I4K 1;  1OZ2 A;  4A4H A;  4E47 A;  2DEQ A;  4BE0 A;  5CUD A;  3P1E A;  1S72 A;  2WSC E;  2XK0 A;  3V8L A;  4DOV A;  4KBM B;  4M7A D;  2LT4 A;  2LDM A;  5D3R A;  4CI0 C;  4XUB A;  4EMG A;  4A9L A;  2D9E A;  4ZGD B;  5LJ3 j;  2FL7 A;  5DLQ E;  4F7U E;  1YI2 A;  3JB9 F;  1YHQ T;  4QYD A;  5L98 A;  5LJ3 h;  3JCM b;  2OSS A;  1YIT A;  4BHW A;  1JJ2 S;  4QSX A;  4WF2 A;  5GAN 3;  2L89 A;  5A0G A;  2LSP B;  4IR6 A;  3CMA A;  4PL6 A;  3HFN A;  2QTX A;  3ZYU A;  3QII A;  2EQK A;  2GQV A;  1BI3 A;  4NUD A;  4OP0 A;  4A4K A;  2LC4 A;  5C89 A;  1KC8 C;  2Y90 A;  3HRS A;  5CQA A;  5FB1 A;  2VGM A;  2JTF A;  4M75 B;  3PIO A;  1WNL A;  4BJX A;  4M75 E;  1BI2 A;  4NL3 A;  5EG2 A;  2R0V A;  4ATO A;  4A9E A;  1VQP A;  1QVF S;  5F2P A;  4N0A A;  4LYW A;  2X4J A;  3M59 A;  5KCO A;  1VQN T;  2DXB A;  4CUP A;  2K4Y A;  1U1S A;  4IR4 A;  2L8D A;  4QB3 A;  5ENG A;  2RI2 A;  3BDL A;  4MDW A;  5CPE A;  4UYH A;  5FRN A;  2E41 A;  1VQ9 A;  4M7D A;  5CQY A;  2B8A A;  5JI8 A;  5GAO r;  1NJI U;  3LWI A;  2CKK A;  1VQK T;  1WJS A;  3CME T;  2RI7 A;  4QEW A;  5ENI A;  5I29 A;  5ACY A;  4NUE A;  4M78 F;  2MF2 A;  2OTL A;  4XTW A;  3GNF B;  4QR3 A;  1VIE A;  5HEL A;  4M75 C;  4YYK A;  4YBM A;  5EWD A;  1M1F A;  2RHU A;  3FRN A;  3CCM T;  2HNI A;  2H3J A;  1N6A A;  4D6W A;  5G4R A;  1I5L A;  4UYE A;  4IUQ A;  1IZ6 A;  3G4S T;  3X26 B;  1N9R A;  5E7D A;  1KG1 A;  5I86 A;  3O34 A;  1YI2 T;  5LKZ A;  4XY8 A;  5DLO A;  3GNG A;  5C8G A;  5GMK e;  5CFW A;  4JDS A;  4YC9 A;  4CUR A;  3Q1J A;  5IAY A;  3BW1 A;  4QSP A;  3EFR A;  3J81 E;  3JCM e;  1BI0 A;  5D6X A;  2E5Q A;  5ENC A;  3M57 A;  4QSV A;  1EQF A;  5HRV A;  3JVL A;  4IUP A;  3MP6 A;  5E0R A;  3SWN C;  4YAT A;  3GPL A;  5K29 A;  4Z6H A;  3OS0 A;  3CC7 T;  4IR5 A;  2YEM A;  2KDS A;  5CU8 A;  1VQ6 T;  4C92 A;  4UIY A;  2D6F A;  2VXE A;  4KCX A;  1BI1 A;  1VQ8 A;  3MEW A;  2DO3 A;  3QUI A;  3ONI A;  1VIF A;  5IGK A;  3DB3 A;  3S3O A;  4Y28 E;  5HKC A;  2FYK A;  4HT9 A;  3LX7 A;  4N4H A;  3MEA A;  4TZ2 A;  1X01 A;  5CUC A;  5D25 A;  4CL9 A;  3MB3 A;  5GAO m;  4OVA A;  4PLL A;  5FRO A;  4TT2 A;  1YIJ T;  3P8B B;  4FLP A;  1VQ7 T;  2MJV B;  3EFS A;  1X0J A;  5ENE A;  2IG0 A;  2KVQ G;  1M8V A;  3P5O A;  4FIB A;  4IOO A;  2RJF A;  2MI6 A;  2IVW A;  5F61 A;  5LJ3 e;  3CCQ T;  2ZPG B;  1YJN A;  3HRU A;  4PJO D;  2D82 A;  1Y07 A;  5I1Q A;  1D3B B;  3JSC A;  4C8Q A;  4B9X A;  1VQ8 T;  5D3T A;  5LKX A;  1UGR B;  3JRZ A;  2RB6 A;  2ZGW A;  4HXM A;  2O4X A;  4EMK B;  5EWH A;  5AYF A;  4J1P A;  2BUD A;  5E3D A;  2VC8 A;  3E9G A;  3QZV A;  4KUD K;  5LVR A;  5CQ7 A;  5DLX A;  4HT8 A;  2K3Y A;  4M77 B;  1YCY A;  4E7K A;  5FE0 A;  3GOX A;  4LD9 K;  3MEU A;  3N5B B;  5HRW A;  5GAM j;  3OW2 A;  1RI0 A;  2HAX A;  4QYL A;  3CXC A;  4HKE A;  4JRQ A;  4JUV A;  3JCM d;  3SWN B;  4ALG A;  3HFO A;  5I21 A;  3WXM B;  4C0G A;  1ZQ1 A;  3RMS A;  4C92 F;  4II1 A;  5HQ5 A;  2K3X A;  4L59 A;  4CLB A;  1KQS A;  5GAM h;  5ENH A;  2X35 A;  4J6W A;  4E96 A;  5I80 A;  4M78 C;  3HHT B;  5AD3 A;  3VUB A;  1VQM T;  3CD6 T;  4X34 A;  4MDX A;  4TYL A;  4FSX A;  1F68 A;  3TEE A;  4HXK A;  4ELZ C;  4Z02 A;  4FM4 B;  4HBW A;  3SVF A;  2E6N A;  2EAY A;  2LX9 A;  1VQL T;  5CO7 A;  1FXX A;  2LTO A;  2QQB A;  3PFS A;  2C06 A;  4BY6 B;  5CKH A;  2FSA A;  3OMG A;  3OY9 A;  4MEN A;  4FL6 A;  5GAN f;  3X20 B;  3QPH A;  1VUB A;  3UV4 A;  1Q86 C;  5AME A;  1V29 B;  4QUU A;  1HK9 A;  3QSU A;  4WIV A;  4LC2 A;  3L2V A;  1K8A U;  5GAN j;  5GAN 6;  4OGI A;  2R58 A;  1U8R A;  4MR6 A;  5CUB A;  3A8O B;  2CGH A;  4O7C A;  5A7C A;  5D0C A;  1JRI A;  5FU7 C;  2ZPB B;  3JVJ A;  4MMK A;  3UDC A;  5LJ5 j;  3JB9 D;  4C92 D;  5AD2 A;  4UYF A;  4F7U F;  3CCR A;  1VQK A;  3CCE A;  5DYC A;  3G7Z A;  2RI5 A;  5II2 A;  4Q5W A;  3QZT A;  4CUU A;  4M75 A;  5I2S A;  4PKC C;  4PCE A;  2M9U A;  2I8N A;  4C0D C;  1M1K C;  1LJO A;  4MZT A;  4OGC A;  2GF7 A;  5HCL A;  3G6E T;  4TS8 A;  3QHS A;  3LJW A;  2VYT A;  4NR7 A;  3L2Z A;  1ZHI A;  4O7B A;  3FC3 A;  2CZ0 B;  4M7D C;  2V8K A;  2JVV A;  2X4W A;  1G3W A;  4JLI A;  1WUG A;  3I56 T;  3QYG B;  2RO1 A;  5DFD A;  5KU3 A;  4NRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...