5H85A

Crystal structure of the bromodomain of human crebbp in complex with uo37d
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
MRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title Binding Motifs in the CBP Bromodomain: An Analysis of 20 Crystal Structures of Complexes with Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 118
sequence length 118
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h85A00
4A9EA 5HFRA 5E0RA 3G0LA 4CURA 2N9GA 4MR3A 5FG6A 4WHUA 5FFYA 4GPJA 3LQIA 5BT4A 5FE8A 5ENBA 3TLPA 2RS9B 5FH8A 5EU1A 5E74A 4CLBA 4BW1A 3JVLA 2DVSA 5E7DA 5EVAA 5C87A 5A5OA 1N72A 5AMEA 3IU5A 4KV1A 4ZC9A 3IU6A 2R10A 5HQ5A 5H1TA 5CUGA 4QSTA 4UYHA 5E9IA 4HBVA 3QZVA 5BT3A 5KU3A 3UV2A 4YYNA 3MUKA 5DW1A 4A9KA 4O7AA 4UYFA 5DKDA 4NYWA 4YADA 3O34A 5A5SA 4A9FA 4CFLA 4WIVA 5CUCA 4QSRA 4TYLA 5ENFA 4NQNA 1F68A 5DFBA 2RNXA 4YYJA 4MR6A 2F6NA 3P1CA 5F2PA 5F5ZA 5FE4A 3LJWA 2RNYA 5LKUA 5LKTA 5A5QA 4E96A 4NRBA 5EV9A 4CUSA 5F61A 5DW2A 5A7CA 5FE2A 3O36A 3RCWA 4BW3A 5HQ6A 2YYNA 5CQ5A 4A9MA 4ALGA 4OUFA 3U5KA 3HMHA 4CUQA 2RFJA 5IGMA 5CS8A 4O70A 5CFWA 5IG6A 5JWMA 3P5OA 5EWDA 4N4FA 5ENIA 5CRMA 3I3JA 2E7NA 5G4SA 3UVYA 4XYAA 5I29A 5HLSA 5HRXA 5EI4A 5CQ8A 5HENA 4IR5A 5DFDA 1E6IA 4PS5A 4MEPA 4HBXA 4HXLA 5EP7A 5HQ7A 3UVXA 5F1LA 4QSVA 4QC3A 2F6JA 2DKWA 4CUUA 5F60A 3QZTA 5FB0A 4QSSA 5D3LA 5FFWA 4NR7A 4UYEA 4IORA 2OO1A 4O72A 4QY4A 3MB3A 4YH4A 3UV5A 5D26A 3U5JA 4NR9A 3ONIA 2DVRA 4QEVA 2R0VA 4QC1A 4C66A 5FH7A 2DATA 4KCXA 4HXMA 5ENHA 5I7YA 2YW5A 3MQMA 4LYIA 5C7NA 5FB1A 4TQNA 4YYGA 5DYUA 5ACYA 4XY9A 3ZYUA 3GG3A 4J1PA 5EWCA 4YYKA 4J3IA 4UIXA 4NQMA 5A81A 4IOOA 5CQTA 5BT5A 2L85A 3DWYA 4O74A 4NRAA 4ZQLA 1ZS5A 5CUBA 4UYFB 5CUDA 5II2A 5LKZA 5E3GA 2YEKA 4UIZA 4QUTA 5EISA 4QYLA 4Z1SA 5EK9A 5L8TA 4NS5A 5C8GA 4A9HA 4QR5A 5L8UA 4HXKA 5II1A 4YYIA 4QYDA 5CQ3A 5I80A 3NXBA 4QSWA 4PCIA 3O35A 4O7FA 2R0SA 5D0CA 4YATA 5EQ1A 5FG5A 5D3NA 4LZ2A 3K2JA 2E3KA 4J0RA 5A5RA 5D3HA 4O77A 4Y03A 4MEOA 5I40A 2YDWA 2KTBB 5I86A 4CUPA 4PKLA 5LJ1A 5LVQA 5DFCA 4XUAA 3UVWA 4A9NA 4A9IA 5L98A 3U5MA 2R0YA 5DLZA 5DKCA 5A85A 3O33A 4NR4A 4HXSA 5EICA 3U5OA 4ZW1A 4TZ2A 4Q0OA 5F25A 5KTXA 2D9EA 4BJXA 3UW9A 3P1DA 5K29A 4BW2A 4Z1QA 4TT2A 4QB3A 4LZSA 5CZGA 5ETDA 2I7KA 5FE9A 4YH3A 3SVFA 4N4GA 4Z6IA 4TU6A 3P1FA 5CUAA 5KHMA 4O7EA 5DLXA 5LKXA 4HXNA 4NR8A 4YYDA 5A5PA 5EA1A 3U5LA 4YAXA 4QSXA 4UIWA 5L97A 5CRZA 5D3PA 4PY6A 3AADA 4NR6A 4CL9A 5TB6A 3JVMA 4YBTA 5LUUA 4QEUA 5CP5A 5CTLA 5E9VA 5I7XA 5F1HA 4BHWA 5H1UA 4YK0A 3O37A 2D82A 5IGLA 4XUBA 2DWWA 4O76A 3UVDA 5FFVA 4A9OA 5HFQA 4HBYA 5CQ7A 5CQAA 5CU8A 4TZ8A 5LJ2A 4J0SA 4O71A 5EWHA 4BW4A 4Z93A 2L5EA 1WUGA 2FSAA 5I1QA 5ENGA 3U5NA 5FE1A 4LYSA 4O78A 4QSPA 5AMFA 4UIYA 2OUOA 5KO4A 3MULA 2I8NA 4QUUA 5KTWA 4QR4A 5HM0A 2YQDA 4TU4A 4C67A 4KV4A 5F62A 3SVHA 4QBMA 4PCEA 4IOQA 3LQJA 4NXJA 3JVJA 5FE3A 4N4IA 4HXPA 5COIA 4NUDA 2YEMA 4O7BA 4QZSA 2G4AA 4UYGA 4F3IA 3U5PA 2WP2A 4WHWA 2L84A 4XY8A 5DY7A 5E9YA 5FG4A 3MXFA 4NRCA 4PTBA 3UV4A 4LRGA 1EQFA 3LXJA 4QEWA 4IR6A 5D25A 4MR5A 5IIDA 4MR4A 5DYCA 4NYVA 2NXBA 5F63A 4LZRA 4UYDA 2GRCA 5D3TA 5FE7A 4YBSA 2DVVA 4N3WA 4YBMA 4OGJA 5CPEA 5ENEA 5E9MA 5EGUA 4ALHA 4A9JA 2WP1A 4Q0NA 3P1EA 4RVRA 5EPBA 2H60A 5EWWA 5DX4A 5E9KA 5D3JA 5E73A 4HBWA 3QZSA 5I88A 3HMEA 5FBXA 5CQ4A 4YY6A 2RNWA 4N4HA 2LSPB 5HRWA 5FH6A 1WUMA 4CFKA 4YYHA 5HJCA 5E3DA 5F36A 4TTEA 4YYMA 4IR3A 5HEMA 4NUCA 5L99A 5F3AA 3LQHA 4HXRA 5CQ6A 5A83A 4X2IA 5CUEA 5I89A 5DYAA 4O7CA 5D7XA 5H1VA 4YC9A 4O75A 5L96A 4UIVA 4DONA 2RO1A 5C85A 5IGKA 5ENJA 5E9LA 4NUEA 4LR6A 5HELA 4TT4A 4HXOA 2E7OA 5JI8A 3G0JA 5ETBA 2DVQA 5EPRA 5C89A 3S91A 4UIUA 5A82A 4LC2A 3HMFA 4A9LA 5EPSA 5IBNA 4CUTA 4LDFA 5A5NA 5H85A 5J0DA 4AKNA 4NR5A 5LJ0A 3DAIA 5DYXA 4QNSA 4LYWA 4MEQA 2YELA 4UITA 5D24A 5CGPA 5CY9A 5I83A 5LVRA 3JVKA 3MB4A 1JM4B 5KTUA 4MENA 4YY4A 1JSPB 3SVGA 4Z6HA 5AD3A 2OSSA 4QSQA 5HCLA 5DKHA 4IR4A 5TCMA 5EM3A 4QR3A 5EWVA 4TS8A 5G4RA 2RI7A 5FE0A 3Q2FA 3D7CA 5D3RA 4TT6A 5C4QA 3Q2EA 4FLPA 5D3SA 3S92A 3AQAA 4YABA 4NYXA 5ENCA 5FE6A 5FE5A 4OGIA 2MJVB 1X0JA 5HRVA 5DBMA 3FKMX 5FDZA 5AD2A 5IGNA 4QSUA
chains in the Genus database with same CATH superfamily
4A9EA 5HFRA 5E0RA 3G0LA 1PUOA 4CURA 2N9GA 3ERRA 4MR3A 5FG6A 4WHUA 5FFYA 4GPJA 3LQIA 5BT4A 5FE8A 5ENBA 3TLPA 2RS9B 5FH8A 5EU1A 5E74A 4CLBA 4BW1A 3JVLA 2DVSA 5E7DA 5EVAA 5C87A 5A5OA 1N72A 5AMEA 3IU5A 4KV1A 4ZC9A 3IU6A 2R10A 3D1DA 5HQ5A 5H1TA 5CUGA 4QSTA 4UYHA 5E9IA 4HBVA 3QZVA 5BT3A 5KU3A 3UV2A 4YYNA 3MUKA 5DW1A 4A9KA 4O7AA 4UYFA 5DKDA 4NYWA 4YADA 3O34A 5A5SA 4A9FA 4CFLA 4WIVA 5CUCA 4QSRA 4TYLA 5ENFA 4NQNA 1F68A 5DFBA 2RNXA 4YYJA 4MR6A 2F6NA 3P1CA 5F2PA 5F5ZA 5FE4A 3LJWA 2RNYA 5LKUA 5LKTA 5A5QA 4E96A 4NRBA 5EV9A 4CUSA 5F61A 5DW2A 5A7CA 5FE2A 3O36A 3RCWA 4BW3A 5HQ6A 2YYNA 5CQ5A 4A9MA 4ALGA 4OUFA 3U5KA 3HMHA 4CUQA 2RFJA 5IGMA 5CS8A 4O70A 5CFWA 5IG6A 5JWMA 3P5OA 5EWDA 4N4FA 5ENIA 5CRMA 3I3JA 2E7NA 5G4SA 3UVYA 4XYAA 5I29A 5HLSA 5HRXA 5EI4A 5CQ8A 5HENA 4IR5A 5DFDA 1E6IA 4PS5A 4MEPA 4HBXA 4HXLA 5EP7A 5HQ7A 3UVXA 5F1LA 4QSVA 4QC3A 2F6JA 2DKWA 4CUUA 5F60A 3QZTA 5FB0A 4QSSA 5D3LA 5FFWA 4NR7A 4UYEA 4IORA 2OO1A 4O72A 4QY4A 3MB3A 4YH4A 3UV5A 5D26A 3U5JA 4NR9A 3ONIA 2DVRA 4QEVA 2R0VA 4QC1A 4C66A 5FH7A 2DATA 4KCXA 4HXMA 3D1BA 5ENHA 5I7YA 2YW5A 3MQMA 4LYIA 5C7NA 5FB1A 4TQNA 4YYGA 5DYUA 4AKIA 5ACYA 4XY9A 3ZYUA 3GG3A 4J1PA 5EWCA 4YYKA 4J3IA 4UIXA 4NQMA 5A81A 4IOOA 5CQTA 5BT5A 4AKGA 2L85A 3DWYA 4O74A 4NRAA 4ZQLA 1ZS5A 5CUBA 4UYFB 5CUDA 5II2A 5LKZA 5E3GA 2YEKA 4UIZA 4QUTA 5EISA 4QYLA 4Z1SA 5EK9A 5L8TA 4NS5A 5C8GA 4A9HA 4QR5A 5L8UA 4HXKA 5II1A 4YYIA 4QYDA 5CQ3A 5I80A 3NXBA 4QSWA 4PCIA 3O35A 4O7FA 2R0SA 5D0CA 4YATA 5EQ1A 5FG5A 5D3NA 4LZ2A 3K2JA 2E3KA 4J0RA 5A5RA 5D3HA 4O77A 4Y03A 4MEOA 5I40A 2YDWA 2KTBB 5I86A 4CUPA 4PKLA 5LJ1A 5LVQA 5DFCA 4XUAA 3UVWA 4A9NA 4A9IA 5L98A 3U5MA 2R0YA 5DLZA 5DKCA 5A85A 3O33A 4NR4A 4HXSA 5EICA 3U5OA 4ZW1A 4TZ2A 4Q0OA 5F25A 5KTXA 2D9EA 4BJXA 3UW9A 3P1DA 5K29A 4BW2A 4Z1QA 4TT2A 4QB3A 4LZSA 5CZGA 5ETDA 2I7KA 5FE9A 4YH3A 3SVFA 4N4GA 4Z6IA 4TU6A 3P1FA 5CUAA 5KHMA 4O7EA 5DLXA 5LKXA 4HXNA 4NR8A 4YYDA 5A5PA 5EA1A 3U5LA 4YAXA 4QSXA 4UIWA 5L97A 5CRZA 5D3PA 4PY6A 3AADA 4NR6A 4CL9A 4AI6A 5TB6A 3JVMA 4YBTA 5LUUA 4QEUA 5CP5A 5CTLA 5E9VA 5I7XA 5F1HA 4BHWA 5H1UA 4YK0A 3O37A 2D82A 5IGLA 4XUBA 2DWWA 4O76A 3UVDA 5FFVA 4A9OA 5HFQA 4HBYA 5CQ7A 5CQAA 5CU8A 4TZ8A 5LJ2A 4J0SA 4O71A 5EWHA 4BW4A 4Z93A 2L5EA 1WUGA 2FSAA 5I1QA 5ENGA 3U5NA 5FE1A 4LYSA 4O78A 4QSPA 5AMFA 4UIYA 2OUOA 5KO4A 3MULA 2I8NA 4QUUA 5KTWA 4QR4A 4AKHA 5HM0A 2YQDA 4TU4A 4C67A 4KV4A 5F62A 3SVHA 4QBMA 4PCEA 4IOQA 3LQJA 4NXJA 3JVJA 5FE3A 4N4IA 4HXPA 5COIA 4NUDA 2YEMA 4O7BA 4QZSA 2G4AA 4UYGA 4F3IA 3U5PA 2WP2A 4WHWA 2L84A 4XY8A 5DY7A 5E9YA 5FG4A 3MXFA 4NRCA 4PTBA 3UV4A 4LRGA 3VKHA 1EQFA 3LXJA 4QEWA 4IR6A 5D25A 4MR5A 5IIDA 4MR4A 5DYCA 4NYVA 2NXBA 5F63A 4LZRA 4UYDA 2GRCA 5D3TA 5FE7A 4YBSA 2DVVA 4N3WA 4YBMA 4OGJA 5CPEA 5ENEA 5E9MA 5EGUA 4ALHA 4A9JA 2WP1A 4Q0NA 3P1EA 4RVRA 5EPBA 2H60A 5EWWA 5DX4A 5E9KA 5D3JA 5E73A 4HBWA 3QZSA 5I88A 3HMEA 5FBXA 5CQ4A 4YY6A 2RNWA 4N4HA 2LSPB 5HRWA 5FH6A 1WUMA 4CFKA 4YYHA 5HJCA 5E3DA 5F36A 4TTEA 4YYMA 4IR3A 5HEMA 4NUCA 5L99A 5F3AA 3LQHA 4HXRA 5CQ6A 5A83A 4X2IA 5CUEA 5I89A 5DYAA 4O7CA 5D7XA 5H1VA 4YC9A 4O75A 5L96A 4UIVA 4DONA 2RO1A 5C85A 5IGKA 5ENJA 5E9LA 4NUEA 4LR6A 5HELA 4TT4A 4HXOA 2E7OA 5JI8A 3G0JA 5ETBA 2DVQA 5EPRA 5C89A 3S91A 4UIUA 5A82A 4LC2A 3HMFA 4A9LA 5EPSA 5IBNA 4CUTA 4LDFA 5A5NA 5H85A 5J0DA 4AKNA 4NR5A 5LJ0A 3DAIA 5DYXA 4QNSA 4LYWA 4MEQA 2YELA 4UITA 5D24A 5CGPA 5CY9A 5I83A 5LVRA 3JVKA 3MB4A 1JM4B 5KTUA 4MENA 4YY4A 1JSPB 3SVGA 4Z6HA 5AD3A 2OSSA 1ZKRA 4QSQA 5HCLA 5DKHA 4IR4A 5TCMA 5EM3A 4QR3A 5EWVA 4TS8A 5G4RA 2RI7A 5FE0A 3Q2FA 3D7CA 5D3RA 4TT6A 5C4QA 3Q2EA 4FLPA 5D3SA 3S92A 3AQAA 4YABA 4NYXA 5ENCA 5FE6A 2EJNA 5FE5A 4OGIA 2MJVB 1X0JA 5HRVA 5DBMA 3FKMX 5FDZA 5AD2A 5IGNA 3VKGA 4QSUA
chains in the Genus database with same CATH topology
4A9EA 5HFRA 5E0RA 3G0LA 4CURA 2N9GA 4MR3A 5FG6A 4WHUA 5FFYA 4GPJA 3LQIA 5BT4A 5FE8A 5ENBA 3TLPA 2RS9B 5FH8A 5EU1A 5E74A 4CLBA 4BW1A 3JVLA 2DVSA 5E7DA 5EVAA 5C87A 5A5OA 1N72A 5AMEA 3IU5A 4KV1A 4ZC9A 3IU6A 2R10A 5HQ5A 5H1TA 5CUGA 4QSTA 4UYHA 5E9IA 4HBVA 3QZVA 5BT3A 5KU3A 3UV2A 4YYNA 3MUKA 5DW1A 4A9KA 4O7AA 4UYFA 5DKDA 4NYWA 4YADA 3O34A 5A5SA 4A9FA 4CFLA 4WIVA 5CUCA 4QSRA 4TYLA 5ENFA 4NQNA 1F68A 5DFBA 2RNXA 4YYJA 4MR6A 2F6NA 3P1CA 5F2PA 5F5ZA 5FE4A 3LJWA 2RNYA 5LKUA 5LKTA 5A5QA 4E96A 4NRBA 5EV9A 4CUSA 5F61A 5DW2A 5A7CA 5FE2A 3O36A 3RCWA 4BW3A 5HQ6A 2YYNA 5CQ5A 4A9MA 4ALGA 4OUFA 3U5KA 3HMHA 4CUQA 2RFJA 5IGMA 5CS8A 4O70A 5CFWA 5IG6A 5JWMA 3P5OA 5EWDA 4N4FA 5ENIA 5CRMA 3I3JA 2E7NA 5G4SA 3UVYA 4XYAA 5I29A 5HLSA 5HRXA 5EI4A 5CQ8A 5HENA 4IR5A 5DFDA 1E6IA 4PS5A 4MEPA 4HBXA 4HXLA 5EP7A 5HQ7A 3UVXA 5F1LA 4QSVA 4QC3A 2F6JA 2DKWA 4CUUA 5F60A 3QZTA 5FB0A 4QSSA 5D3LA 5FFWA 4NR7A 4UYEA 4IORA 2OO1A 4O72A 4QY4A 3MB3A 4YH4A 3UV5A 5D26A 3U5JA 4NR9A 3ONIA 2DVRA 4QEVA 2R0VA 4QC1A 4C66A 5FH7A 2DATA 4KCXA 4HXMA 5ENHA 5I7YA 2YW5A 3MQMA 4LYIA 5C7NA 5FB1A 4TQNA 4YYGA 5DYUA 5ACYA 4XY9A 3ZYUA 3GG3A 4J1PA 5EWCA 4YYKA 4J3IA 4UIXA 4NQMA 5A81A 4IOOA 5CQTA 5BT5A 2L85A 3DWYA 4O74A 4NRAA 4ZQLA 1ZS5A 5CUBA 4UYFB 5CUDA 5II2A 5LKZA 5E3GA 2YEKA 4UIZA 4QUTA 5EISA 4QYLA 4Z1SA 5EK9A 5L8TA 4NS5A 5C8GA 4A9HA 4QR5A 5L8UA 4HXKA 5II1A 4YYIA 4QYDA 5CQ3A 5I80A 3NXBA 4QSWA 4PCIA 3O35A 4O7FA 2R0SA 5D0CA 4YATA 5EQ1A 5FG5A 5D3NA 4LZ2A 3K2JA 2E3KA 4J0RA 5A5RA 5D3HA 4O77A 4Y03A 4MEOA 5I40A 2YDWA 2KTBB 5I86A 4CUPA 4PKLA 5LJ1A 5LVQA 5DFCA 4XUAA 3UVWA 4A9NA 4A9IA 5L98A 3U5MA 2R0YA 5DLZA 5DKCA 5A85A 3O33A 4NR4A 4HXSA 5EICA 3U5OA 4ZW1A 4TZ2A 4Q0OA 5F25A 5KTXA 2D9EA 4BJXA 3UW9A 3P1DA 5K29A 4BW2A 4Z1QA 4TT2A 4QB3A 4LZSA 5CZGA 5ETDA 2I7KA 5FE9A 4YH3A 3SVFA 4N4GA 4Z6IA 4TU6A 3P1FA 5CUAA 5KHMA 4O7EA 5DLXA 5LKXA 4HXNA 4NR8A 4YYDA 5A5PA 5EA1A 3U5LA 4YAXA 4QSXA 4UIWA 5L97A 5CRZA 5D3PA 4PY6A 3AADA 4NR6A 4CL9A 5TB6A 3JVMA 4YBTA 5LUUA 4QEUA 5CP5A 5CTLA 5E9VA 5I7XA 5F1HA 4BHWA 5H1UA 4YK0A 3O37A 2D82A 5IGLA 4XUBA 2DWWA 4O76A 3UVDA 5FFVA 4A9OA 5HFQA 4HBYA 5CQ7A 5CQAA 5CU8A 4TZ8A 5LJ2A 4J0SA 4O71A 5EWHA 4BW4A 4Z93A 2L5EA 1WUGA 2FSAA 5I1QA 5ENGA 3U5NA 5FE1A 4LYSA 4O78A 4QSPA 5AMFA 4UIYA 2OUOA 5KO4A 3MULA 2I8NA 4QUUA 5KTWA 4QR4A 5HM0A 2YQDA 4TU4A 4C67A 4KV4A 5F62A 3SVHA 4QBMA 4PCEA 4IOQA 3LQJA 4NXJA 3JVJA 5FE3A 4N4IA 4HXPA 5COIA 4NUDA 2YEMA 4O7BA 4QZSA 2G4AA 4UYGA 4F3IA 3U5PA 2WP2A 4WHWA 2L84A 4XY8A 5DY7A 5E9YA 5FG4A 3MXFA 4NRCA 4PTBA 3UV4A 4LRGA 1EQFA 3LXJA 4QEWA 4IR6A 5D25A 4MR5A 5IIDA 4MR4A 5DYCA 4NYVA 2NXBA 5F63A 4LZRA 4UYDA 2GRCA 5D3TA 5FE7A 4YBSA 2DVVA 4N3WA 4YBMA 4OGJA 5CPEA 5ENEA 5E9MA 5EGUA 4ALHA 4A9JA 2WP1A 4Q0NA 3P1EA 4RVRA 5EPBA 2H60A 5EWWA 5DX4A 5E9KA 5D3JA 5E73A 4HBWA 3QZSA 5I88A 3HMEA 5FBXA 5CQ4A 4YY6A 2RNWA 4N4HA 2LSPB 5HRWA 5FH6A 1WUMA 4CFKA 4YYHA 5HJCA 5E3DA 5F36A 4TTEA 4YYMA 4IR3A 5HEMA 4NUCA 5L99A 5F3AA 3LQHA 4HXRA 5CQ6A 5A83A 4X2IA 5CUEA 5I89A 5DYAA 4O7CA 5D7XA 5H1VA 4YC9A 4O75A 5L96A 4UIVA 4DONA 2RO1A 5C85A 5IGKA 5ENJA 5E9LA 4NUEA 4LR6A 5HELA 4TT4A 4HXOA 2E7OA 5JI8A 3G0JA 5ETBA 2DVQA 5EPRA 5C89A 3S91A 4UIUA 5A82A 4LC2A 3HMFA 4A9LA 5EPSA 5IBNA 4CUTA 4LDFA 5A5NA 5H85A 5J0DA 4AKNA 4NR5A 5LJ0A 3DAIA 5DYXA 4QNSA 4LYWA 4MEQA 2YELA 4UITA 5D24A 5CGPA 5CY9A 5I83A 5LVRA 3JVKA 3MB4A 1JM4B 5KTUA 4MENA 4YY4A 1JSPB 3SVGA 4Z6HA 5AD3A 2OSSA 4QSQA 5HCLA 5DKHA 4IR4A 5TCMA 5EM3A 4QR3A 5EWVA 4TS8A 5G4RA 2RI7A 5FE0A 3Q2FA 3D7CA 5D3RA 4TT6A 5C4QA 3Q2EA 4FLPA 5D3SA 3S92A 3AQAA 4YABA 4NYXA 5ENCA 5FE6A 5FE5A 4OGIA 2MJVB 1X0JA 5HRVA 5DBMA 3FKMX 5FDZA 5AD2A 5IGNA 4QSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9E A;  5HFR A;  5E0R A;  3G0L A;  4CUR A;  2N9G A;  4MR3 A;  5FG6 A;  4WHU A;  5FFY A;  4GPJ A;  3LQI A;  5BT4 A;  5FE8 A;  5ENB A;  3TLP A;  2RS9 B;  5FH8 A;  5EU1 A;  5E74 A;  4CLB A;  4BW1 A;  3JVL A;  2DVS A;  5E7D A;  5EVA A;  5C87 A;  5A5O A;  1N72 A;  5AME A;  3IU5 A;  4KV1 A;  4ZC9 A;  3IU6 A;  2R10 A;  5HQ5 A;  5H1T A;  5CUG A;  4QST A;  4UYH A;  5E9I A;  4HBV A;  3QZV A;  5BT3 A;  5KU3 A;  3UV2 A;  4YYN A;  3MUK A;  5DW1 A;  4A9K A;  4O7A A;  4UYF A;  5DKD A;  4NYW A;  4YAD A;  3O34 A;  5A5S A;  4A9F A;  4CFL A;  4WIV A;  5CUC A;  4QSR A;  4TYL A;  5ENF A;  4NQN A;  1F68 A;  5DFB A;  2RNX A;  4YYJ A;  4MR6 A;  2F6N A;  3P1C A;  5F2P A;  5F5Z A;  5FE4 A;  3LJW A;  2RNY A;  5LKU A;  5LKT A;  5A5Q A;  4E96 A;  4NRB A;  5EV9 A;  4CUS A;  5F61 A;  5DW2 A;  5A7C A;  5FE2 A;  3O36 A;  3RCW A;  4BW3 A;  5HQ6 A;  2YYN A;  5CQ5 A;  4A9M A;  4ALG A;  4OUF A;  3U5K A;  3HMH A;  4CUQ A;  2RFJ A;  5IGM A;  5CS8 A;  4O70 A;  5CFW A;  5IG6 A;  5JWM A;  3P5O A;  5EWD A;  4N4F A;  5ENI A;  5CRM A;  3I3J A;  2E7N A;  5G4S A;  3UVY A;  4XYA A;  5I29 A;  5HLS A;  5HRX A;  5EI4 A;  5CQ8 A;  5HEN A;  4IR5 A;  5DFD A;  1E6I A;  4PS5 A;  4MEP A;  4HBX A;  4HXL A;  5EP7 A;  5HQ7 A;  3UVX A;  5F1L A;  4QSV A;  4QC3 A;  2F6J A;  2DKW A;  4CUU A;  5F60 A;  3QZT A;  5FB0 A;  4QSS A;  5D3L A;  5FFW A;  4NR7 A;  4UYE A;  4IOR A;  2OO1 A;  4O72 A;  4QY4 A;  3MB3 A;  4YH4 A;  3UV5 A;  5D26 A;  3U5J A;  4NR9 A;  3ONI A;  2DVR A;  4QEV A;  2R0V A;  4QC1 A;  4C66 A;  5FH7 A;  2DAT A;  4KCX A;  4HXM A;  5ENH A;  5I7Y A;  2YW5 A;  3MQM A;  4LYI A;  5C7N A;  5FB1 A;  4TQN A;  4YYG A;  5DYU A;  5ACY A;  4XY9 A;  3ZYU A;  3GG3 A;  4J1P A;  5EWC A;  4YYK A;  4J3I A;  4UIX A;  4NQM A;  5A81 A;  4IOO A;  5CQT A;  5BT5 A;  2L85 A;  3DWY A;  4O74 A;  4NRA A;  4ZQL A;  1ZS5 A;  5CUB A;  4UYF B;  5CUD A;  5II2 A;  5LKZ A;  5E3G A;  2YEK A;  4UIZ A;  4QUT A;  5EIS A;  4QYL A;  4Z1S A;  5EK9 A;  5L8T A;  4NS5 A;  5C8G A;  4A9H A;  4QR5 A;  5L8U A;  4HXK A;  5II1 A;  4YYI A;  4QYD A;  5CQ3 A;  5I80 A;  3NXB A;  4QSW A;  4PCI A;  3O35 A;  4O7F A;  2R0S A;  5D0C A;  4YAT A;  5EQ1 A;  5FG5 A;  5D3N A;  4LZ2 A;  3K2J A;  2E3K A;  4J0R A;  5A5R A;  5D3H A;  4O77 A;  4Y03 A;  4MEO A;  5I40 A;  2YDW A;  2KTB B;  5I86 A;  4CUP A;  4PKL A;  5LJ1 A;  5LVQ A;  5DFC A;  4XUA A;  3UVW A;  4A9N A;  4A9I A;  5L98 A;  3U5M A;  2R0Y A;  5DLZ A;  5DKC A;  5A85 A;  3O33 A;  4NR4 A;  4HXS A;  5EIC A;  3U5O A;  4ZW1 A;  4TZ2 A;  4Q0O A;  5F25 A;  5KTX A;  2D9E A;  4BJX A;  3UW9 A;  3P1D A;  5K29 A;  4BW2 A;  4Z1Q A;  4TT2 A;  4QB3 A;  4LZS A;  5CZG A;  5ETD A;  2I7K A;  5FE9 A;  4YH3 A;  3SVF A;  4N4G A;  4Z6I A;  4TU6 A;  3P1F A;  5CUA A;  5KHM A;  4O7E A;  5DLX A;  5LKX A;  4HXN A;  4NR8 A;  4YYD A;  5A5P A;  5EA1 A;  3U5L A;  4YAX A;  4QSX A;  4UIW A;  5L97 A;  5CRZ A;  5D3P A;  4PY6 A;  3AAD A;  4NR6 A;  4CL9 A;  5TB6 A;  3JVM A;  4YBT A;  5LUU A;  4QEU A;  5CP5 A;  5CTL A;  5E9V A;  5I7X A;  5F1H A;  4BHW A;  5H1U A;  4YK0 A;  3O37 A;  2D82 A;  5IGL A;  4XUB A;  2DWW A;  4O76 A;  3UVD A;  5FFV A;  4A9O A;  5HFQ A;  4HBY A;  5CQ7 A;  5CQA A;  5CU8 A;  4TZ8 A;  5LJ2 A;  4J0S A;  4O71 A;  5EWH A;  4BW4 A;  4Z93 A;  2L5E A;  1WUG A;  2FSA A;  5I1Q A;  5ENG A;  3U5N A;  5FE1 A;  4LYS A;  4O78 A;  4QSP A;  5AMF A;  4UIY A;  2OUO A;  5KO4 A;  3MUL A;  2I8N A;  4QUU A;  5KTW A;  4QR4 A;  5HM0 A;  2YQD A;  4TU4 A;  4C67 A;  4KV4 A;  5F62 A;  3SVH A;  4QBM A;  4PCE A;  4IOQ A;  3LQJ A;  4NXJ A;  3JVJ A;  5FE3 A;  4N4I A;  4HXP A;  5COI A;  4NUD A;  2YEM A;  4O7B A;  4QZS A;  2G4A A;  4UYG A;  4F3I A;  3U5P A;  2WP2 A;  4WHW A;  2L84 A;  4XY8 A;  5DY7 A;  5E9Y A;  5FG4 A;  3MXF A;  4NRC A;  4PTB A;  3UV4 A;  4LRG A;  1EQF A;  3LXJ A;  4QEW A;  4IR6 A;  5D25 A;  4MR5 A;  5IID A;  4MR4 A;  5DYC A;  4NYV A;  2NXB A;  5F63 A;  4LZR A;  4UYD A;  2GRC A;  5D3T A;  5FE7 A;  4YBS A;  2DVV A;  4N3W A;  4YBM A;  4OGJ A;  5CPE A;  5ENE A;  5E9M A;  5EGU A;  4ALH A;  4A9J A;  2WP1 A;  4Q0N A;  3P1E A;  4RVR A;  5EPB A;  2H60 A;  5EWW A;  5DX4 A;  5E9K A;  5D3J A;  5E73 A;  4HBW A;  3QZS A;  5I88 A;  3HME A;  5FBX A;  5CQ4 A;  4YY6 A;  2RNW A;  4N4H A;  2LSP B;  5HRW A;  5FH6 A;  1WUM A;  4CFK A;  4YYH A;  5HJC A;  5E3D A;  5F36 A;  4TTE A;  4YYM A;  4IR3 A;  5HEM A;  4NUC A;  5L99 A;  5F3A A;  3LQH A;  4HXR A;  5CQ6 A;  5A83 A;  4X2I A;  5CUE A;  5I89 A;  5DYA A;  4O7C A;  5D7X A;  5H1V A;  4YC9 A;  4O75 A;  5L96 A;  4UIV A;  4DON A;  2RO1 A;  5C85 A;  5IGK A;  5ENJ A;  5E9L A;  4NUE A;  4LR6 A;  5HEL A;  4TT4 A;  4HXO A;  2E7O A;  5JI8 A;  3G0J A;  5ETB A;  2DVQ A;  5EPR A;  5C89 A;  3S91 A;  4UIU A;  5A82 A;  4LC2 A;  3HMF A;  4A9L A;  5EPS A;  5IBN A;  4CUT A;  4LDF A;  5A5N A;  5H85 A;  5J0D A;  4AKN A;  4NR5 A;  5LJ0 A;  3DAI A;  5DYX A;  4QNS A;  4LYW A;  4MEQ A;  2YEL A;  4UIT A;  5D24 A;  5CGP A;  5CY9 A;  5I83 A;  5LVR A;  3JVK A;  3MB4 A;  1JM4 B;  5KTU A;  4MEN A;  4YY4 A;  1JSP B;  3SVG A;  4Z6H A;  5AD3 A;  2OSS A;  4QSQ A;  5HCL A;  5DKH A;  4IR4 A;  5TCM A;  5EM3 A;  4QR3 A;  5EWV A;  4TS8 A;  5G4R A;  2RI7 A;  5FE0 A;  3Q2F A;  3D7C A;  5D3R A;  4TT6 A;  5C4Q A;  3Q2E A;  4FLP A;  5D3S A;  3S92 A;  3AQA A;  4YAB A;  4NYX A;  5ENC A;  5FE6 A;  5FE5 A;  4OGI A;  2MJV B;  1X0J A;  5HRV A;  5DBM A;  3FKM X;  5FDZ A;  5AD2 A;  5IGN A;  4QSU A; 
#chains in the Genus database with same CATH topology
 4A9E A;  5HFR A;  5E0R A;  3G0L A;  1PUO A;  4CUR A;  2N9G A;  3ERR A;  4MR3 A;  5FG6 A;  4WHU A;  5FFY A;  4GPJ A;  3LQI A;  5BT4 A;  5FE8 A;  5ENB A;  3TLP A;  2RS9 B;  5FH8 A;  5EU1 A;  5E74 A;  4CLB A;  4BW1 A;  3JVL A;  2DVS A;  5E7D A;  5EVA A;  5C87 A;  5A5O A;  1N72 A;  5AME A;  3IU5 A;  4KV1 A;  4ZC9 A;  3IU6 A;  2R10 A;  3D1D A;  5HQ5 A;  5H1T A;  5CUG A;  4QST A;  4UYH A;  5E9I A;  4HBV A;  3QZV A;  5BT3 A;  5KU3 A;  3UV2 A;  4YYN A;  3MUK A;  5DW1 A;  4A9K A;  4O7A A;  4UYF A;  5DKD A;  4NYW A;  4YAD A;  3O34 A;  5A5S A;  4A9F A;  4CFL A;  4WIV A;  5CUC A;  4QSR A;  4TYL A;  5ENF A;  4NQN A;  1F68 A;  5DFB A;  2RNX A;  4YYJ A;  4MR6 A;  2F6N A;  3P1C A;  5F2P A;  5F5Z A;  5FE4 A;  3LJW A;  2RNY A;  5LKU A;  5LKT A;  5A5Q A;  4E96 A;  4NRB A;  5EV9 A;  4CUS A;  5F61 A;  5DW2 A;  5A7C A;  5FE2 A;  3O36 A;  3RCW A;  4BW3 A;  5HQ6 A;  2YYN A;  5CQ5 A;  4A9M A;  4ALG A;  4OUF A;  3U5K A;  3HMH A;  4CUQ A;  2RFJ A;  5IGM A;  5CS8 A;  4O70 A;  5CFW A;  5IG6 A;  5JWM A;  3P5O A;  5EWD A;  4N4F A;  5ENI A;  5CRM A;  3I3J A;  2E7N A;  5G4S A;  3UVY A;  4XYA A;  5I29 A;  5HLS A;  5HRX A;  5EI4 A;  5CQ8 A;  5HEN A;  4IR5 A;  5DFD A;  1E6I A;  4PS5 A;  4MEP A;  4HBX A;  4HXL A;  5EP7 A;  5HQ7 A;  3UVX A;  5F1L A;  4QSV A;  4QC3 A;  2F6J A;  2DKW A;  4CUU A;  5F60 A;  3QZT A;  5FB0 A;  4QSS A;  5D3L A;  5FFW A;  4NR7 A;  4UYE A;  4IOR A;  2OO1 A;  4O72 A;  4QY4 A;  3MB3 A;  4YH4 A;  3UV5 A;  5D26 A;  3U5J A;  4NR9 A;  3ONI A;  2DVR A;  4QEV A;  2R0V A;  4QC1 A;  4C66 A;  5FH7 A;  2DAT A;  4KCX A;  4HXM A;  3D1B A;  5ENH A;  5I7Y A;  2YW5 A;  3MQM A;  4LYI A;  5C7N A;  5FB1 A;  4TQN A;  4YYG A;  5DYU A;  4AKI A;  5ACY A;  4XY9 A;  3ZYU A;  3GG3 A;  4J1P A;  5EWC A;  4YYK A;  4J3I A;  4UIX A;  4NQM A;  5A81 A;  4IOO A;  5CQT A;  5BT5 A;  4AKG A;  2L85 A;  3DWY A;  4O74 A;  4NRA A;  4ZQL A;  1ZS5 A;  5CUB A;  4UYF B;  5CUD A;  5II2 A;  5LKZ A;  5E3G A;  2YEK A;  4UIZ A;  4QUT A;  5EIS A;  4QYL A;  4Z1S A;  5EK9 A;  5L8T A;  4NS5 A;  5C8G A;  4A9H A;  4QR5 A;  5L8U A;  4HXK A;  5II1 A;  4YYI A;  4QYD A;  5CQ3 A;  5I80 A;  3NXB A;  4QSW A;  4PCI A;  3O35 A;  4O7F A;  2R0S A;  5D0C A;  4YAT A;  5EQ1 A;  5FG5 A;  5D3N A;  4LZ2 A;  3K2J A;  2E3K A;  4J0R A;  5A5R A;  5D3H A;  4O77 A;  4Y03 A;  4MEO A;  5I40 A;  2YDW A;  2KTB B;  5I86 A;  4CUP A;  4PKL A;  5LJ1 A;  5LVQ A;  5DFC A;  4XUA A;  3UVW A;  4A9N A;  4A9I A;  5L98 A;  3U5M A;  2R0Y A;  5DLZ A;  5DKC A;  5A85 A;  3O33 A;  4NR4 A;  4HXS A;  5EIC A;  3U5O A;  4ZW1 A;  4TZ2 A;  4Q0O A;  5F25 A;  5KTX A;  2D9E A;  4BJX A;  3UW9 A;  3P1D A;  5K29 A;  4BW2 A;  4Z1Q A;  4TT2 A;  4QB3 A;  4LZS A;  5CZG A;  5ETD A;  2I7K A;  5FE9 A;  4YH3 A;  3SVF A;  4N4G A;  4Z6I A;  4TU6 A;  3P1F A;  5CUA A;  5KHM A;  4O7E A;  5DLX A;  5LKX A;  4HXN A;  4NR8 A;  4YYD A;  5A5P A;  5EA1 A;  3U5L A;  4YAX A;  4QSX A;  4UIW A;  5L97 A;  5CRZ A;  5D3P A;  4PY6 A;  3AAD A;  4NR6 A;  4CL9 A;  4AI6 A;  5TB6 A;  3JVM A;  4YBT A;  5LUU A;  4QEU A;  5CP5 A;  5CTL A;  5E9V A;  5I7X A;  5F1H A;  4BHW A;  5H1U A;  4YK0 A;  3O37 A;  2D82 A;  5IGL A;  4XUB A;  2DWW A;  4O76 A;  3UVD A;  5FFV A;  4A9O A;  5HFQ A;  4HBY A;  5CQ7 A;  5CQA A;  5CU8 A;  4TZ8 A;  5LJ2 A;  4J0S A;  4O71 A;  5EWH A;  4BW4 A;  4Z93 A;  2L5E A;  1WUG A;  2FSA A;  5I1Q A;  5ENG A;  3U5N A;  5FE1 A;  4LYS A;  4O78 A;  4QSP A;  5AMF A;  4UIY A;  2OUO A;  5KO4 A;  3MUL A;  2I8N A;  4QUU A;  5KTW A;  4QR4 A;  4AKH A;  5HM0 A;  2YQD A;  4TU4 A;  4C67 A;  4KV4 A;  5F62 A;  3SVH A;  4QBM A;  4PCE A;  4IOQ A;  3LQJ A;  4NXJ A;  3JVJ A;  5FE3 A;  4N4I A;  4HXP A;  5COI A;  4NUD A;  2YEM A;  4O7B A;  4QZS A;  2G4A A;  4UYG A;  4F3I A;  3U5P A;  2WP2 A;  4WHW A;  2L84 A;  4XY8 A;  5DY7 A;  5E9Y A;  5FG4 A;  3MXF A;  4NRC A;  4PTB A;  3UV4 A;  4LRG A;  3VKH A;  1EQF A;  3LXJ A;  4QEW A;  4IR6 A;  5D25 A;  4MR5 A;  5IID A;  4MR4 A;  5DYC A;  4NYV A;  2NXB A;  5F63 A;  4LZR A;  4UYD A;  2GRC A;  5D3T A;  5FE7 A;  4YBS A;  2DVV A;  4N3W A;  4YBM A;  4OGJ A;  5CPE A;  5ENE A;  5E9M A;  5EGU A;  4ALH A;  4A9J A;  2WP1 A;  4Q0N A;  3P1E A;  4RVR A;  5EPB A;  2H60 A;  5EWW A;  5DX4 A;  5E9K A;  5D3J A;  5E73 A;  4HBW A;  3QZS A;  5I88 A;  3HME A;  5FBX A;  5CQ4 A;  4YY6 A;  2RNW A;  4N4H A;  2LSP B;  5HRW A;  5FH6 A;  1WUM A;  4CFK A;  4YYH A;  5HJC A;  5E3D A;  5F36 A;  4TTE A;  4YYM A;  4IR3 A;  5HEM A;  4NUC A;  5L99 A;  5F3A A;  3LQH A;  4HXR A;  5CQ6 A;  5A83 A;  4X2I A;  5CUE A;  5I89 A;  5DYA A;  4O7C A;  5D7X A;  5H1V A;  4YC9 A;  4O75 A;  5L96 A;  4UIV A;  4DON A;  2RO1 A;  5C85 A;  5IGK A;  5ENJ A;  5E9L A;  4NUE A;  4LR6 A;  5HEL A;  4TT4 A;  4HXO A;  2E7O A;  5JI8 A;  3G0J A;  5ETB A;  2DVQ A;  5EPR A;  5C89 A;  3S91 A;  4UIU A;  5A82 A;  4LC2 A;  3HMF A;  4A9L A;  5EPS A;  5IBN A;  4CUT A;  4LDF A;  5A5N A;  5H85 A;  5J0D A;  4AKN A;  4NR5 A;  5LJ0 A;  3DAI A;  5DYX A;  4QNS A;  4LYW A;  4MEQ A;  2YEL A;  4UIT A;  5D24 A;  5CGP A;  5CY9 A;  5I83 A;  5LVR A;  3JVK A;  3MB4 A;  1JM4 B;  5KTU A;  4MEN A;  4YY4 A;  1JSP B;  3SVG A;  4Z6H A;  5AD3 A;  2OSS A;  1ZKR A;  4QSQ A;  5HCL A;  5DKH A;  4IR4 A;  5TCM A;  5EM3 A;  4QR3 A;  5EWV A;  4TS8 A;  5G4R A;  2RI7 A;  5FE0 A;  3Q2F A;  3D7C A;  5D3R A;  4TT6 A;  5C4Q A;  3Q2E A;  4FLP A;  5D3S A;  3S92 A;  3AQA A;  4YAB A;  4NYX A;  5ENC A;  5FE6 A;  2EJN A;  5FE5 A;  4OGI A;  2MJV B;  1X0J A;  5HRV A;  5DBM A;  3FKM X;  5FDZ A;  5AD2 A;  5IGN A;  3VKG A;  4QSU A; 
#chains in the Genus database with same CATH homology
 4A9E A;  5HFR A;  5E0R A;  3G0L A;  4CUR A;  2N9G A;  4MR3 A;  5FG6 A;  4WHU A;  5FFY A;  4GPJ A;  3LQI A;  5BT4 A;  5FE8 A;  5ENB A;  3TLP A;  2RS9 B;  5FH8 A;  5EU1 A;  5E74 A;  4CLB A;  4BW1 A;  3JVL A;  2DVS A;  5E7D A;  5EVA A;  5C87 A;  5A5O A;  1N72 A;  5AME A;  3IU5 A;  4KV1 A;  4ZC9 A;  3IU6 A;  2R10 A;  5HQ5 A;  5H1T A;  5CUG A;  4QST A;  4UYH A;  5E9I A;  4HBV A;  3QZV A;  5BT3 A;  5KU3 A;  3UV2 A;  4YYN A;  3MUK A;  5DW1 A;  4A9K A;  4O7A A;  4UYF A;  5DKD A;  4NYW A;  4YAD A;  3O34 A;  5A5S A;  4A9F A;  4CFL A;  4WIV A;  5CUC A;  4QSR A;  4TYL A;  5ENF A;  4NQN A;  1F68 A;  5DFB A;  2RNX A;  4YYJ A;  4MR6 A;  2F6N A;  3P1C A;  5F2P A;  5F5Z A;  5FE4 A;  3LJW A;  2RNY A;  5LKU A;  5LKT A;  5A5Q A;  4E96 A;  4NRB A;  5EV9 A;  4CUS A;  5F61 A;  5DW2 A;  5A7C A;  5FE2 A;  3O36 A;  3RCW A;  4BW3 A;  5HQ6 A;  2YYN A;  5CQ5 A;  4A9M A;  4ALG A;  4OUF A;  3U5K A;  3HMH A;  4CUQ A;  2RFJ A;  5IGM A;  5CS8 A;  4O70 A;  5CFW A;  5IG6 A;  5JWM A;  3P5O A;  5EWD A;  4N4F A;  5ENI A;  5CRM A;  3I3J A;  2E7N A;  5G4S A;  3UVY A;  4XYA A;  5I29 A;  5HLS A;  5HRX A;  5EI4 A;  5CQ8 A;  5HEN A;  4IR5 A;  5DFD A;  1E6I A;  4PS5 A;  4MEP A;  4HBX A;  4HXL A;  5EP7 A;  5HQ7 A;  3UVX A;  5F1L A;  4QSV A;  4QC3 A;  2F6J A;  2DKW A;  4CUU A;  5F60 A;  3QZT A;  5FB0 A;  4QSS A;  5D3L A;  5FFW A;  4NR7 A;  4UYE A;  4IOR A;  2OO1 A;  4O72 A;  4QY4 A;  3MB3 A;  4YH4 A;  3UV5 A;  5D26 A;  3U5J A;  4NR9 A;  3ONI A;  2DVR A;  4QEV A;  2R0V A;  4QC1 A;  4C66 A;  5FH7 A;  2DAT A;  4KCX A;  4HXM A;  5ENH A;  5I7Y A;  2YW5 A;  3MQM A;  4LYI A;  5C7N A;  5FB1 A;  4TQN A;  4YYG A;  5DYU A;  5ACY A;  4XY9 A;  3ZYU A;  3GG3 A;  4J1P A;  5EWC A;  4YYK A;  4J3I A;  4UIX A;  4NQM A;  5A81 A;  4IOO A;  5CQT A;  5BT5 A;  2L85 A;  3DWY A;  4O74 A;  4NRA A;  4ZQL A;  1ZS5 A;  5CUB A;  4UYF B;  5CUD A;  5II2 A;  5LKZ A;  5E3G A;  2YEK A;  4UIZ A;  4QUT A;  5EIS A;  4QYL A;  4Z1S A;  5EK9 A;  5L8T A;  4NS5 A;  5C8G A;  4A9H A;  4QR5 A;  5L8U A;  4HXK A;  5II1 A;  4YYI A;  4QYD A;  5CQ3 A;  5I80 A;  3NXB A;  4QSW A;  4PCI A;  3O35 A;  4O7F A;  2R0S A;  5D0C A;  4YAT A;  5EQ1 A;  5FG5 A;  5D3N A;  4LZ2 A;  3K2J A;  2E3K A;  4J0R A;  5A5R A;  5D3H A;  4O77 A;  4Y03 A;  4MEO A;  5I40 A;  2YDW A;  2KTB B;  5I86 A;  4CUP A;  4PKL A;  5LJ1 A;  5LVQ A;  5DFC A;  4XUA A;  3UVW A;  4A9N A;  4A9I A;  5L98 A;  3U5M A;  2R0Y A;  5DLZ A;  5DKC A;  5A85 A;  3O33 A;  4NR4 A;  4HXS A;  5EIC A;  3U5O A;  4ZW1 A;  4TZ2 A;  4Q0O A;  5F25 A;  5KTX A;  2D9E A;  4BJX A;  3UW9 A;  3P1D A;  5K29 A;  4BW2 A;  4Z1Q A;  4TT2 A;  4QB3 A;  4LZS A;  5CZG A;  5ETD A;  2I7K A;  5FE9 A;  4YH3 A;  3SVF A;  4N4G A;  4Z6I A;  4TU6 A;  3P1F A;  5CUA A;  5KHM A;  4O7E A;  5DLX A;  5LKX A;  4HXN A;  4NR8 A;  4YYD A;  5A5P A;  5EA1 A;  3U5L A;  4YAX A;  4QSX A;  4UIW A;  5L97 A;  5CRZ A;  5D3P A;  4PY6 A;  3AAD A;  4NR6 A;  4CL9 A;  5TB6 A;  3JVM A;  4YBT A;  5LUU A;  4QEU A;  5CP5 A;  5CTL A;  5E9V A;  5I7X A;  5F1H A;  4BHW A;  5H1U A;  4YK0 A;  3O37 A;  2D82 A;  5IGL A;  4XUB A;  2DWW A;  4O76 A;  3UVD A;  5FFV A;  4A9O A;  5HFQ A;  4HBY A;  5CQ7 A;  5CQA A;  5CU8 A;  4TZ8 A;  5LJ2 A;  4J0S A;  4O71 A;  5EWH A;  4BW4 A;  4Z93 A;  2L5E A;  1WUG A;  2FSA A;  5I1Q A;  5ENG A;  3U5N A;  5FE1 A;  4LYS A;  4O78 A;  4QSP A;  5AMF A;  4UIY A;  2OUO A;  5KO4 A;  3MUL A;  2I8N A;  4QUU A;  5KTW A;  4QR4 A;  5HM0 A;  2YQD A;  4TU4 A;  4C67 A;  4KV4 A;  5F62 A;  3SVH A;  4QBM A;  4PCE A;  4IOQ A;  3LQJ A;  4NXJ A;  3JVJ A;  5FE3 A;  4N4I A;  4HXP A;  5COI A;  4NUD A;  2YEM A;  4O7B A;  4QZS A;  2G4A A;  4UYG A;  4F3I A;  3U5P A;  2WP2 A;  4WHW A;  2L84 A;  4XY8 A;  5DY7 A;  5E9Y A;  5FG4 A;  3MXF A;  4NRC A;  4PTB A;  3UV4 A;  4LRG A;  1EQF A;  3LXJ A;  4QEW A;  4IR6 A;  5D25 A;  4MR5 A;  5IID A;  4MR4 A;  5DYC A;  4NYV A;  2NXB A;  5F63 A;  4LZR A;  4UYD A;  2GRC A;  5D3T A;  5FE7 A;  4YBS A;  2DVV A;  4N3W A;  4YBM A;  4OGJ A;  5CPE A;  5ENE A;  5E9M A;  5EGU A;  4ALH A;  4A9J A;  2WP1 A;  4Q0N A;  3P1E A;  4RVR A;  5EPB A;  2H60 A;  5EWW A;  5DX4 A;  5E9K A;  5D3J A;  5E73 A;  4HBW A;  3QZS A;  5I88 A;  3HME A;  5FBX A;  5CQ4 A;  4YY6 A;  2RNW A;  4N4H A;  2LSP B;  5HRW A;  5FH6 A;  1WUM A;  4CFK A;  4YYH A;  5HJC A;  5E3D A;  5F36 A;  4TTE A;  4YYM A;  4IR3 A;  5HEM A;  4NUC A;  5L99 A;  5F3A A;  3LQH A;  4HXR A;  5CQ6 A;  5A83 A;  4X2I A;  5CUE A;  5I89 A;  5DYA A;  4O7C A;  5D7X A;  5H1V A;  4YC9 A;  4O75 A;  5L96 A;  4UIV A;  4DON A;  2RO1 A;  5C85 A;  5IGK A;  5ENJ A;  5E9L A;  4NUE A;  4LR6 A;  5HEL A;  4TT4 A;  4HXO A;  2E7O A;  5JI8 A;  3G0J A;  5ETB A;  2DVQ A;  5EPR A;  5C89 A;  3S91 A;  4UIU A;  5A82 A;  4LC2 A;  3HMF A;  4A9L A;  5EPS A;  5IBN A;  4CUT A;  4LDF A;  5A5N A;  5H85 A;  5J0D A;  4AKN A;  4NR5 A;  5LJ0 A;  3DAI A;  5DYX A;  4QNS A;  4LYW A;  4MEQ A;  2YEL A;  4UIT A;  5D24 A;  5CGP A;  5CY9 A;  5I83 A;  5LVR A;  3JVK A;  3MB4 A;  1JM4 B;  5KTU A;  4MEN A;  4YY4 A;  1JSP B;  3SVG A;  4Z6H A;  5AD3 A;  2OSS A;  4QSQ A;  5HCL A;  5DKH A;  4IR4 A;  5TCM A;  5EM3 A;  4QR3 A;  5EWV A;  4TS8 A;  5G4R A;  2RI7 A;  5FE0 A;  3Q2F A;  3D7C A;  5D3R A;  4TT6 A;  5C4Q A;  3Q2E A;  4FLP A;  5D3S A;  3S92 A;  3AQA A;  4YAB A;  4NYX A;  5ENC A;  5FE6 A;  5FE5 A;  4OGI A;  2MJV B;  1X0J A;  5HRV A;  5DBM A;  3FKM X;  5FDZ A;  5AD2 A;  5IGN A;  4QSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...