4QSWA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) in complex with 5-methyl uridine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords ATPase family AAA domain-containing protein 2
publication title Structure-based approaches towards identification of fragments for the low-druggability ATAD2 bromodomain
doi rcsb
source organism Homo sapiens
total genus 56
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qswA00
4PCIA 5DY7A 3MXFA 3LXJA 2YDWA 2L84A 4LZ2A 5F36A 2DVRA 5I1QA 4QSWA 5CGPA 5IGNA 4HBVA 5G4SA 5LKZA 4CLBA 4BHWA 3U5OA 5E9VA 3RCWA 5CQ3A 5EISA 4ZC9A 2DVSA 5F2PA 4NR8A 3UVYA 4HBXA 4QR5A 4TU6A 4E96A 5I29A 3LJWA 4FLPA 4QEUA 2OO1A 4HXMA 5BT5A 4HBYA 2L85A 4PY6A 4MEOA 4YBSA 3HMHA 5L98A 4QBMA 4O7CA 4A9OA 5C85A 3QZSA 3AQAA 2WP2A 4HBWA 2RNWA 4ALHA 4KV4A 4IOOA 5LJ1A 4NUEA 4WIVA 4WHUA 5FH6A 4QSVA 1WUGA 3DWYA 5D3PA 2E7NA 2R10A 5CRMA 5E74A 5IG6A 5EWDA 4NQMA 3LQJA 3UV4A 3FKMX 5H85A 4BW3A 3U5KA 5F25A 5L99A 4YYJA 5C8GA 5CUBA 4A9NA 3G0LA 2R0SA 4LYIA 5C87A 5DYAA 5I83A 3O33A 4YAXA 5D3JA 5LVRA 5DYCA 5CRZA 5JI8A 5DW1A 2GRCA 5EICA 4MR4A 4O71A 5G4RA 4TT6A 4OUFA 5CUEA 2FSAA 4ALGA 2G4AA 5ENGA 4QNSA 4UIZA 4O70A 3SVFA 5E73A 3U5PA 5FFVA 3HMFA 2NXBA 5FE5A 3P5OA 2I7KA 5E0RA 4NS5A 4TTEA 4YC9A 3JVJA 5HLSA 2DVVA 3G0JA 5AD2A 5FE9A 5IGLA 5FE0A 5I7YA 5H1TA 2OSSA 3MULA 4X2IA 5EWHA 5IGMA 5L8TA 2RS9B 2D9EA 3QZTA 2DVQA 4A9HA 4QSRA 4NYWA 4UYEA 5FB1A 4J0SA 5EVAA 5FE1A 5JWMA 5D3HA 4UYFB 4OGIA 5A7CA 5HQ6A 4N4IA 3UV5A 5L96A 2MJVB 5EV9A 4NR9A 4IORA 5DKDA 3GG3A 5DYXA 5LKUA 4J1PA 5CQ4A 4HXLA 4O77A 4WHWA 4QSPA 4RVRA 5E9KA 4UYDA 5CUAA 2H60A 5AD3A 5HRWA 4O72A 4IR4A 4A9MA 5DLZA 4NYVA 5CZGA 4QSSA 2RNXA 5EU1A 3D7CA 2YW5A 3U5MA 4IOQA 5EI4A 4A9EA 5H1UA 4NQNA 5FFWA 5H1VA 5CQAA 1F68A 5ENEA 4UIYA 5D26A 3S92A 5BT3A 4UYGA 3P1EA 4NRBA 5HENA 4UYFA 4XUBA 5HQ5A 4N4GA 5F3AA 4XUAA 5F5ZA 4QR3A 5AMEA 5DFDA 3JVMA 5FG6A 4BW2A 4HXOA 3IU6A 4UIXA 4YYMA 4YYGA 5EP7A 4IR3A 3UVXA 4J0RA 3LQIA 4QUUA 5DKHA 1JM4B 5FG4A 4PKLA 4CUUA 5L8UA 4YH4A 2RO1A 4Z1SA 4QUTA 5LKXA 4YBTA 2YQDA 5HEMA 4YY4A 5ACYA 4O74A 5KTXA 1E6IA 3S91A 4IR6A 4O75A 4NXJA 4LR6A 3MB3A 3O34A 5ENBA 3U5JA 4A9FA 5ETBA 5FE8A 2DATA 5A5QA 5A5SA 5DW2A 4MR5A 5E3DA 5C89A 5CUCA 4Z6HA 3DAIA 4QC1A 5A81A 3UVWA 4F3IA 5A85A 5L97A 2F6NA 4CUQA 3O35A 5FE6A 4QY4A 3P1CA 4NUCA 3ONIA 5IGKA 5F63A 3MQMA 5DBMA 5D3RA 3JVLA 4Y03A 5DX4A 5FE4A 2L5EA 3LQHA 4TS8A 5D3NA 5II1A 4QEWA 5II2A 4O7FA 4UIWA 4NR7A 5EPBA 4QSTA 3UVDA 4MEPA 4YABA 4YY6A 1WUMA 3UV2A 5I88A 5EM3A 4NUDA 5A83A 5CUDA 5F1LA 2F6JA 2RFJA 5LVQA 4O76A 5KO4A 3P1DA 3K2JA 4O7BA 5E3GA 5ENCA 3U5NA 5EWWA 4UITA 5I40A 5FG5A 5ENHA 4O7EA 5CS8A 5ENIA 4TYLA 5DFBA 4CL9A 4QC3A 3Q2FA 5CQ8A 5FH8A 3QZVA 2I8NA 4N3WA 5FE2A 5ENJA 5CTLA 2DKWA 5E9LA 4O78A 4HXPA 4LYSA 2RI7A 4LYWA 2D82A 5CPEA 5A5OA 4MENA 4Q0NA 5FDZA 4O7AA 3ZYUA 4NRCA 5D3LA 3JVKA 5K29A 5FBXA 5TB6A 5HELA 4QSUA 4MR6A 1X0JA 3P1FA 5I86A 4PS5A 5EPRA 4YYDA 4IR5A 2OUOA 2KTBB 4TZ8A 2DWWA 4NR6A 4KV1A 4CUPA 4LRGA 4UIUA 5FB0A 4PTBA 5I80A 3O36A 3SVHA 5HFQA 4BW4A 4DONA 2R0YA 4LZRA 4NR5A 5CUGA 5LKTA 4GPJA 4TZ2A 5F62A 5HRXA 3UW9A 4LC2A 3MUKA 5D3SA 5CQ7A 5IBNA 5CY9A 2E7OA 4Q0OA 4TQNA 3NXBA 2YELA 5ETDA 4YYIA 2E3KA 4Z6IA 5HQ7A 3IU5A 4YYKA 5DKCA 4YATA 5E9YA 3TLPA 5J0DA 4QZSA 5CQ5A 4CUSA 5EPSA 4C66A 5LJ0A 5F1HA 3HMEA 4MEQA 3I3JA 5BT4A 4MR3A 4AKNA 4YADA 5C7NA 4YH3A 4QR4A 4TU4A 5IIDA 5C4QA 5TCMA 4Z1QA 5LUUA 4HXKA 4QYLA 5EQ1A 3AADA 5D3TA 2N9GA 4XYAA 4YBMA 4QB3A 4YK0A 5D25A 4CFLA 4CUTA 4CFKA 5HJCA 5HM0A 5COIA 4NR4A 4Z93A 4OGJA 5I89A 2WP1A 5EWCA 4YYNA 2LSPB 4CURA 5F60A 4QEVA 4N4HA 5DFCA 4TT4A 5D7XA 5DLXA 3MB4A 5EK9A 3SVGA 4XY8A 3O37A 5A82A 5ENFA 5FE7A 2YEMA 5AMFA 3Q2EA 4C67A 4HXSA 4A9IA 4HXRA 5D24A 4QSXA 5KTUA 1JSPB 5FH7A 5E7DA 5EA1A 5DYUA 4BJXA 2YYNA 1N72A 4QYDA 4YYHA 4LDFA 4HXNA 5E9MA 5KU3A 2RNYA 4N4FA 5D0CA 5CU8A 4A9KA 5HFRA 5FE3A 4J3IA 5E9IA 4ZW1A 5CQTA 4BW1A 4TT2A 4ZQLA 5EGUA 5CFWA 1ZS5A 1EQFA 4A9LA 5HCLA 4XY9A 5CQ6A 4LZSA 5F61A 5HRVA 3U5LA 4KCXA 4QSQA 5LJ2A 2R0VA 4NYXA 5A5NA 4UYHA 4NRAA 5CP5A 5I7XA 5KHMA 5A5RA 5FFYA 2YEKA 5A5PA 4UIVA 5KTWA 4A9JA 4PCEA 5EWVA
chains in the Genus database with same CATH superfamily
4PCIA 5DY7A 3MXFA 3LXJA 2YDWA 2L84A 4LZ2A 5F36A 1ZKRA 2DVRA 5I1QA 4QSWA 5CGPA 5IGNA 4HBVA 5G4SA 5LKZA 4CLBA 4BHWA 3U5OA 5E9VA 3RCWA 5CQ3A 5EISA 4ZC9A 2DVSA 5F2PA 4NR8A 3UVYA 4HBXA 4QR5A 4TU6A 4E96A 5I29A 3LJWA 4FLPA 4QEUA 2OO1A 4HXMA 5BT5A 4HBYA 2L85A 4PY6A 4MEOA 4YBSA 3HMHA 5L98A 4QBMA 4O7CA 4A9OA 5C85A 3QZSA 3AQAA 2WP2A 4HBWA 2RNWA 4ALHA 4KV4A 4IOOA 5LJ1A 4NUEA 4WIVA 4WHUA 5FH6A 4QSVA 1WUGA 3DWYA 5D3PA 2E7NA 2R10A 5CRMA 5E74A 5IG6A 5EWDA 4NQMA 3LQJA 3UV4A 3FKMX 5H85A 4BW3A 3U5KA 5F25A 5L99A 4YYJA 5C8GA 5CUBA 4A9NA 3G0LA 2R0SA 4LYIA 5C87A 5DYAA 5I83A 3O33A 4YAXA 5D3JA 5LVRA 5DYCA 5CRZA 5JI8A 5DW1A 2GRCA 5EICA 4MR4A 4O71A 5G4RA 4TT6A 4OUFA 5CUEA 2FSAA 4ALGA 2G4AA 5ENGA 4QNSA 4UIZA 4O70A 3SVFA 5E73A 3U5PA 5FFVA 3HMFA 2NXBA 5FE5A 3P5OA 2I7KA 5E0RA 4NS5A 4TTEA 4YC9A 3JVJA 5HLSA 2DVVA 3G0JA 5AD2A 5FE9A 5IGLA 5FE0A 5I7YA 5H1TA 2OSSA 3MULA 4X2IA 5EWHA 5IGMA 5L8TA 2RS9B 2D9EA 3QZTA 2DVQA 4A9HA 4QSRA 4NYWA 4UYEA 5FB1A 4J0SA 5EVAA 5FE1A 5JWMA 5D3HA 4UYFB 4OGIA 5A7CA 5HQ6A 4N4IA 3UV5A 5L96A 2MJVB 5EV9A 4NR9A 4IORA 5DKDA 3GG3A 5DYXA 5LKUA 4J1PA 5CQ4A 4HXLA 4O77A 4WHWA 4QSPA 4RVRA 5E9KA 4UYDA 5CUAA 2H60A 5AD3A 5HRWA 4O72A 4IR4A 4A9MA 5DLZA 4NYVA 5CZGA 4QSSA 2RNXA 5EU1A 3D7CA 2YW5A 3U5MA 4IOQA 5EI4A 4AKHA 4A9EA 5H1UA 4NQNA 5FFWA 5H1VA 5CQAA 1F68A 5ENEA 4UIYA 5D26A 3S92A 5BT3A 4UYGA 3P1EA 4NRBA 5HENA 4UYFA 4XUBA 5HQ5A 4N4GA 5F3AA 4XUAA 5F5ZA 4QR3A 5AMEA 5DFDA 3JVMA 5FG6A 4BW2A 4HXOA 3IU6A 4UIXA 4YYMA 4YYGA 5EP7A 4IR3A 3UVXA 4J0RA 3LQIA 4QUUA 5DKHA 1JM4B 5FG4A 4PKLA 4CUUA 5L8UA 4YH4A 2RO1A 4Z1SA 4QUTA 5LKXA 4YBTA 2YQDA 5HEMA 4YY4A 5ACYA 4O74A 5KTXA 1E6IA 3S91A 4IR6A 4O75A 4NXJA 4LR6A 3MB3A 3O34A 5ENBA 3U5JA 4A9FA 5ETBA 5FE8A 2DATA 5A5QA 5A5SA 5DW2A 4MR5A 5E3DA 5C89A 5CUCA 4Z6HA 3DAIA 4QC1A 5A81A 3UVWA 4F3IA 3ERRA 5A85A 5L97A 2F6NA 4CUQA 3O35A 5FE6A 4QY4A 3P1CA 4AI6A 4NUCA 3ONIA 5IGKA 5F63A 3MQMA 5DBMA 5D3RA 3JVLA 4Y03A 5DX4A 5FE4A 2L5EA 3LQHA 4TS8A 2EJNA 5D3NA 5II1A 4QEWA 5II2A 4O7FA 4UIWA 4NR7A 5EPBA 4QSTA 3UVDA 4MEPA 4YABA 4YY6A 1WUMA 3UV2A 5I88A 5EM3A 4NUDA 5A83A 5CUDA 5F1LA 2F6JA 4AKIA 2RFJA 5LVQA 4O76A 5KO4A 3P1DA 3K2JA 4O7BA 5E3GA 5ENCA 3U5NA 5EWWA 4UITA 3VKGA 5I40A 5FG5A 5ENHA 4O7EA 5CS8A 5ENIA 4TYLA 5DFBA 4CL9A 4QC3A 3Q2FA 5CQ8A 5FH8A 3QZVA 2I8NA 4N3WA 5FE2A 4AKGA 5ENJA 5CTLA 2DKWA 5E9LA 4O78A 4HXPA 4LYSA 2RI7A 4LYWA 2D82A 5CPEA 5A5OA 4MENA 4Q0NA 5FDZA 4O7AA 3ZYUA 4NRCA 5D3LA 3JVKA 5K29A 5FBXA 5TB6A 5HELA 4QSUA 4MR6A 1X0JA 3P1FA 5I86A 4PS5A 5EPRA 4YYDA 4IR5A 2OUOA 2KTBB 4TZ8A 2DWWA 4NR6A 4KV1A 4CUPA 4LRGA 4UIUA 5FB0A 4PTBA 5I80A 3O36A 3SVHA 5HFQA 4BW4A 4DONA 2R0YA 4LZRA 4NR5A 5CUGA 5LKTA 4GPJA 4TZ2A 5F62A 5HRXA 3UW9A 4LC2A 3MUKA 5D3SA 5CQ7A 5IBNA 5CY9A 2E7OA 4Q0OA 3D1BA 4TQNA 3VKHA 3NXBA 2YELA 5ETDA 4YYIA 2E3KA 4Z6IA 5HQ7A 3IU5A 4YYKA 5DKCA 4YATA 5E9YA 3TLPA 5J0DA 4QZSA 5CQ5A 4CUSA 5EPSA 4C66A 5LJ0A 5F1HA 3HMEA 4MEQA 3I3JA 5BT4A 4MR3A 4AKNA 4YADA 5C7NA 4YH3A 4QR4A 4TU4A 5IIDA 5C4QA 5TCMA 4Z1QA 5LUUA 4HXKA 4QYLA 5EQ1A 3AADA 5D3TA 2N9GA 4XYAA 4YBMA 4QB3A 4YK0A 5D25A 4CFLA 4CUTA 4CFKA 5HJCA 5HM0A 5COIA 4NR4A 4Z93A 4OGJA 5I89A 2WP1A 5EWCA 4YYNA 2LSPB 4CURA 5F60A 4QEVA 4N4HA 5DFCA 4TT4A 5D7XA 5DLXA 1PUOA 3MB4A 5EK9A 3SVGA 4XY8A 3O37A 5A82A 5ENFA 5FE7A 2YEMA 5AMFA 3Q2EA 4C67A 4HXSA 4A9IA 4HXRA 5D24A 4QSXA 5KTUA 1JSPB 5FH7A 5E7DA 5EA1A 5DYUA 4BJXA 2YYNA 1N72A 4QYDA 4YYHA 4LDFA 4HXNA 5E9MA 5KU3A 2RNYA 4N4FA 5D0CA 5CU8A 4A9KA 5HFRA 5FE3A 4J3IA 5E9IA 4ZW1A 5CQTA 4BW1A 4TT2A 4ZQLA 5EGUA 5CFWA 1ZS5A 1EQFA 4A9LA 5HCLA 4XY9A 5CQ6A 4LZSA 5F61A 5HRVA 3D1DA 3U5LA 4KCXA 4QSQA 5LJ2A 2R0VA 4NYXA 5A5NA 4UYHA 4NRAA 5CP5A 5I7XA 5KHMA 5A5RA 5FFYA 2YEKA 5A5PA 4UIVA 5KTWA 4A9JA 4PCEA 5EWVA
chains in the Genus database with same CATH topology
4PCIA 5DY7A 3MXFA 3LXJA 2YDWA 2L84A 4LZ2A 5F36A 2DVRA 5I1QA 4QSWA 5CGPA 5IGNA 4HBVA 5G4SA 5LKZA 4CLBA 4BHWA 3U5OA 5E9VA 3RCWA 5CQ3A 5EISA 4ZC9A 2DVSA 5F2PA 4NR8A 3UVYA 4HBXA 4QR5A 4TU6A 4E96A 5I29A 3LJWA 4FLPA 4QEUA 2OO1A 4HXMA 5BT5A 4HBYA 2L85A 4PY6A 4MEOA 4YBSA 3HMHA 5L98A 4QBMA 4O7CA 4A9OA 5C85A 3QZSA 3AQAA 2WP2A 4HBWA 2RNWA 4ALHA 4KV4A 4IOOA 5LJ1A 4NUEA 4WIVA 4WHUA 5FH6A 4QSVA 1WUGA 3DWYA 5D3PA 2E7NA 2R10A 5CRMA 5E74A 5IG6A 5EWDA 4NQMA 3LQJA 3UV4A 3FKMX 5H85A 4BW3A 3U5KA 5F25A 5L99A 4YYJA 5C8GA 5CUBA 4A9NA 3G0LA 2R0SA 4LYIA 5C87A 5DYAA 5I83A 3O33A 4YAXA 5D3JA 5LVRA 5DYCA 5CRZA 5JI8A 5DW1A 2GRCA 5EICA 4MR4A 4O71A 5G4RA 4TT6A 4OUFA 5CUEA 2FSAA 4ALGA 2G4AA 5ENGA 4QNSA 4UIZA 4O70A 3SVFA 5E73A 3U5PA 5FFVA 3HMFA 2NXBA 5FE5A 3P5OA 2I7KA 5E0RA 4NS5A 4TTEA 4YC9A 3JVJA 5HLSA 2DVVA 3G0JA 5AD2A 5FE9A 5IGLA 5FE0A 5I7YA 5H1TA 2OSSA 3MULA 4X2IA 5EWHA 5IGMA 5L8TA 2RS9B 2D9EA 3QZTA 2DVQA 4A9HA 4QSRA 4NYWA 4UYEA 5FB1A 4J0SA 5EVAA 5FE1A 5JWMA 5D3HA 4UYFB 4OGIA 5A7CA 5HQ6A 4N4IA 3UV5A 5L96A 2MJVB 5EV9A 4NR9A 4IORA 5DKDA 3GG3A 5DYXA 5LKUA 4J1PA 5CQ4A 4HXLA 4O77A 4WHWA 4QSPA 4RVRA 5E9KA 4UYDA 5CUAA 2H60A 5AD3A 5HRWA 4O72A 4IR4A 4A9MA 5DLZA 4NYVA 5CZGA 4QSSA 2RNXA 5EU1A 3D7CA 2YW5A 3U5MA 4IOQA 5EI4A 4A9EA 5H1UA 4NQNA 5FFWA 5H1VA 5CQAA 1F68A 5ENEA 4UIYA 5D26A 3S92A 5BT3A 4UYGA 3P1EA 4NRBA 5HENA 4UYFA 4XUBA 5HQ5A 4N4GA 5F3AA 4XUAA 5F5ZA 4QR3A 5AMEA 5DFDA 3JVMA 5FG6A 4BW2A 4HXOA 3IU6A 4UIXA 4YYMA 4YYGA 5EP7A 4IR3A 3UVXA 4J0RA 3LQIA 4QUUA 5DKHA 1JM4B 5FG4A 4PKLA 4CUUA 5L8UA 4YH4A 2RO1A 4Z1SA 4QUTA 5LKXA 4YBTA 2YQDA 5HEMA 4YY4A 5ACYA 4O74A 5KTXA 1E6IA 3S91A 4IR6A 4O75A 4NXJA 4LR6A 3MB3A 3O34A 5ENBA 3U5JA 4A9FA 5ETBA 5FE8A 2DATA 5A5QA 5A5SA 5DW2A 4MR5A 5E3DA 5C89A 5CUCA 4Z6HA 3DAIA 4QC1A 5A81A 3UVWA 4F3IA 5A85A 5L97A 2F6NA 4CUQA 3O35A 5FE6A 4QY4A 3P1CA 4NUCA 3ONIA 5IGKA 5F63A 3MQMA 5DBMA 5D3RA 3JVLA 4Y03A 5DX4A 5FE4A 2L5EA 3LQHA 4TS8A 5D3NA 5II1A 4QEWA 5II2A 4O7FA 4UIWA 4NR7A 5EPBA 4QSTA 3UVDA 4MEPA 4YABA 4YY6A 1WUMA 3UV2A 5I88A 5EM3A 4NUDA 5A83A 5CUDA 5F1LA 2F6JA 2RFJA 5LVQA 4O76A 5KO4A 3P1DA 3K2JA 4O7BA 5E3GA 5ENCA 3U5NA 5EWWA 4UITA 5I40A 5FG5A 5ENHA 4O7EA 5CS8A 5ENIA 4TYLA 5DFBA 4CL9A 4QC3A 3Q2FA 5CQ8A 5FH8A 3QZVA 2I8NA 4N3WA 5FE2A 5ENJA 5CTLA 2DKWA 5E9LA 4O78A 4HXPA 4LYSA 2RI7A 4LYWA 2D82A 5CPEA 5A5OA 4MENA 4Q0NA 5FDZA 4O7AA 3ZYUA 4NRCA 5D3LA 3JVKA 5K29A 5FBXA 5TB6A 5HELA 4QSUA 4MR6A 1X0JA 3P1FA 5I86A 4PS5A 5EPRA 4YYDA 4IR5A 2OUOA 2KTBB 4TZ8A 2DWWA 4NR6A 4KV1A 4CUPA 4LRGA 4UIUA 5FB0A 4PTBA 5I80A 3O36A 3SVHA 5HFQA 4BW4A 4DONA 2R0YA 4LZRA 4NR5A 5CUGA 5LKTA 4GPJA 4TZ2A 5F62A 5HRXA 3UW9A 4LC2A 3MUKA 5D3SA 5CQ7A 5IBNA 5CY9A 2E7OA 4Q0OA 4TQNA 3NXBA 2YELA 5ETDA 4YYIA 2E3KA 4Z6IA 5HQ7A 3IU5A 4YYKA 5DKCA 4YATA 5E9YA 3TLPA 5J0DA 4QZSA 5CQ5A 4CUSA 5EPSA 4C66A 5LJ0A 5F1HA 3HMEA 4MEQA 3I3JA 5BT4A 4MR3A 4AKNA 4YADA 5C7NA 4YH3A 4QR4A 4TU4A 5IIDA 5C4QA 5TCMA 4Z1QA 5LUUA 4HXKA 4QYLA 5EQ1A 3AADA 5D3TA 2N9GA 4XYAA 4YBMA 4QB3A 4YK0A 5D25A 4CFLA 4CUTA 4CFKA 5HJCA 5HM0A 5COIA 4NR4A 4Z93A 4OGJA 5I89A 2WP1A 5EWCA 4YYNA 2LSPB 4CURA 5F60A 4QEVA 4N4HA 5DFCA 4TT4A 5D7XA 5DLXA 3MB4A 5EK9A 3SVGA 4XY8A 3O37A 5A82A 5ENFA 5FE7A 2YEMA 5AMFA 3Q2EA 4C67A 4HXSA 4A9IA 4HXRA 5D24A 4QSXA 5KTUA 1JSPB 5FH7A 5E7DA 5EA1A 5DYUA 4BJXA 2YYNA 1N72A 4QYDA 4YYHA 4LDFA 4HXNA 5E9MA 5KU3A 2RNYA 4N4FA 5D0CA 5CU8A 4A9KA 5HFRA 5FE3A 4J3IA 5E9IA 4ZW1A 5CQTA 4BW1A 4TT2A 4ZQLA 5EGUA 5CFWA 1ZS5A 1EQFA 4A9LA 5HCLA 4XY9A 5CQ6A 4LZSA 5F61A 5HRVA 3U5LA 4KCXA 4QSQA 5LJ2A 2R0VA 4NYXA 5A5NA 4UYHA 4NRAA 5CP5A 5I7XA 5KHMA 5A5RA 5FFYA 2YEKA 5A5PA 4UIVA 5KTWA 4A9JA 4PCEA 5EWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PCI A;  5DY7 A;  3MXF A;  3LXJ A;  2YDW A;  2L84 A;  4LZ2 A;  5F36 A;  2DVR A;  5I1Q A;  4QSW A;  5CGP A;  5IGN A;  4HBV A;  5G4S A;  5LKZ A;  4CLB A;  4BHW A;  3U5O A;  5E9V A;  3RCW A;  5CQ3 A;  5EIS A;  4ZC9 A;  2DVS A;  5F2P A;  4NR8 A;  3UVY A;  4HBX A;  4QR5 A;  4TU6 A;  4E96 A;  5I29 A;  3LJW A;  4FLP A;  4QEU A;  2OO1 A;  4HXM A;  5BT5 A;  4HBY A;  2L85 A;  4PY6 A;  4MEO A;  4YBS A;  3HMH A;  5L98 A;  4QBM A;  4O7C A;  4A9O A;  5C85 A;  3QZS A;  3AQA A;  2WP2 A;  4HBW A;  2RNW A;  4ALH A;  4KV4 A;  4IOO A;  5LJ1 A;  4NUE A;  4WIV A;  4WHU A;  5FH6 A;  4QSV A;  1WUG A;  3DWY A;  5D3P A;  2E7N A;  2R10 A;  5CRM A;  5E74 A;  5IG6 A;  5EWD A;  4NQM A;  3LQJ A;  3UV4 A;  3FKM X;  5H85 A;  4BW3 A;  3U5K A;  5F25 A;  5L99 A;  4YYJ A;  5C8G A;  5CUB A;  4A9N A;  3G0L A;  2R0S A;  4LYI A;  5C87 A;  5DYA A;  5I83 A;  3O33 A;  4YAX A;  5D3J A;  5LVR A;  5DYC A;  5CRZ A;  5JI8 A;  5DW1 A;  2GRC A;  5EIC A;  4MR4 A;  4O71 A;  5G4R A;  4TT6 A;  4OUF A;  5CUE A;  2FSA A;  4ALG A;  2G4A A;  5ENG A;  4QNS A;  4UIZ A;  4O70 A;  3SVF A;  5E73 A;  3U5P A;  5FFV A;  3HMF A;  2NXB A;  5FE5 A;  3P5O A;  2I7K A;  5E0R A;  4NS5 A;  4TTE A;  4YC9 A;  3JVJ A;  5HLS A;  2DVV A;  3G0J A;  5AD2 A;  5FE9 A;  5IGL A;  5FE0 A;  5I7Y A;  5H1T A;  2OSS A;  3MUL A;  4X2I A;  5EWH A;  5IGM A;  5L8T A;  2RS9 B;  2D9E A;  3QZT A;  2DVQ A;  4A9H A;  4QSR A;  4NYW A;  4UYE A;  5FB1 A;  4J0S A;  5EVA A;  5FE1 A;  5JWM A;  5D3H A;  4UYF B;  4OGI A;  5A7C A;  5HQ6 A;  4N4I A;  3UV5 A;  5L96 A;  2MJV B;  5EV9 A;  4NR9 A;  4IOR A;  5DKD A;  3GG3 A;  5DYX A;  5LKU A;  4J1P A;  5CQ4 A;  4HXL A;  4O77 A;  4WHW A;  4QSP A;  4RVR A;  5E9K A;  4UYD A;  5CUA A;  2H60 A;  5AD3 A;  5HRW A;  4O72 A;  4IR4 A;  4A9M A;  5DLZ A;  4NYV A;  5CZG A;  4QSS A;  2RNX A;  5EU1 A;  3D7C A;  2YW5 A;  3U5M A;  4IOQ A;  5EI4 A;  4A9E A;  5H1U A;  4NQN A;  5FFW A;  5H1V A;  5CQA A;  1F68 A;  5ENE A;  4UIY A;  5D26 A;  3S92 A;  5BT3 A;  4UYG A;  3P1E A;  4NRB A;  5HEN A;  4UYF A;  4XUB A;  5HQ5 A;  4N4G A;  5F3A A;  4XUA A;  5F5Z A;  4QR3 A;  5AME A;  5DFD A;  3JVM A;  5FG6 A;  4BW2 A;  4HXO A;  3IU6 A;  4UIX A;  4YYM A;  4YYG A;  5EP7 A;  4IR3 A;  3UVX A;  4J0R A;  3LQI A;  4QUU A;  5DKH A;  1JM4 B;  5FG4 A;  4PKL A;  4CUU A;  5L8U A;  4YH4 A;  2RO1 A;  4Z1S A;  4QUT A;  5LKX A;  4YBT A;  2YQD A;  5HEM A;  4YY4 A;  5ACY A;  4O74 A;  5KTX A;  1E6I A;  3S91 A;  4IR6 A;  4O75 A;  4NXJ A;  4LR6 A;  3MB3 A;  3O34 A;  5ENB A;  3U5J A;  4A9F A;  5ETB A;  5FE8 A;  2DAT A;  5A5Q A;  5A5S A;  5DW2 A;  4MR5 A;  5E3D A;  5C89 A;  5CUC A;  4Z6H A;  3DAI A;  4QC1 A;  5A81 A;  3UVW A;  4F3I A;  5A85 A;  5L97 A;  2F6N A;  4CUQ A;  3O35 A;  5FE6 A;  4QY4 A;  3P1C A;  4NUC A;  3ONI A;  5IGK A;  5F63 A;  3MQM A;  5DBM A;  5D3R A;  3JVL A;  4Y03 A;  5DX4 A;  5FE4 A;  2L5E A;  3LQH A;  4TS8 A;  5D3N A;  5II1 A;  4QEW A;  5II2 A;  4O7F A;  4UIW A;  4NR7 A;  5EPB A;  4QST A;  3UVD A;  4MEP A;  4YAB A;  4YY6 A;  1WUM A;  3UV2 A;  5I88 A;  5EM3 A;  4NUD A;  5A83 A;  5CUD A;  5F1L A;  2F6J A;  2RFJ A;  5LVQ A;  4O76 A;  5KO4 A;  3P1D A;  3K2J A;  4O7B A;  5E3G A;  5ENC A;  3U5N A;  5EWW A;  4UIT A;  5I40 A;  5FG5 A;  5ENH A;  4O7E A;  5CS8 A;  5ENI A;  4TYL A;  5DFB A;  4CL9 A;  4QC3 A;  3Q2F A;  5CQ8 A;  5FH8 A;  3QZV A;  2I8N A;  4N3W A;  5FE2 A;  5ENJ A;  5CTL A;  2DKW A;  5E9L A;  4O78 A;  4HXP A;  4LYS A;  2RI7 A;  4LYW A;  2D82 A;  5CPE A;  5A5O A;  4MEN A;  4Q0N A;  5FDZ A;  4O7A A;  3ZYU A;  4NRC A;  5D3L A;  3JVK A;  5K29 A;  5FBX A;  5TB6 A;  5HEL A;  4QSU A;  4MR6 A;  1X0J A;  3P1F A;  5I86 A;  4PS5 A;  5EPR A;  4YYD A;  4IR5 A;  2OUO A;  2KTB B;  4TZ8 A;  2DWW A;  4NR6 A;  4KV1 A;  4CUP A;  4LRG A;  4UIU A;  5FB0 A;  4PTB A;  5I80 A;  3O36 A;  3SVH A;  5HFQ A;  4BW4 A;  4DON A;  2R0Y A;  4LZR A;  4NR5 A;  5CUG A;  5LKT A;  4GPJ A;  4TZ2 A;  5F62 A;  5HRX A;  3UW9 A;  4LC2 A;  3MUK A;  5D3S A;  5CQ7 A;  5IBN A;  5CY9 A;  2E7O A;  4Q0O A;  4TQN A;  3NXB A;  2YEL A;  5ETD A;  4YYI A;  2E3K A;  4Z6I A;  5HQ7 A;  3IU5 A;  4YYK A;  5DKC A;  4YAT A;  5E9Y A;  3TLP A;  5J0D A;  4QZS A;  5CQ5 A;  4CUS A;  5EPS A;  4C66 A;  5LJ0 A;  5F1H A;  3HME A;  4MEQ A;  3I3J A;  5BT4 A;  4MR3 A;  4AKN A;  4YAD A;  5C7N A;  4YH3 A;  4QR4 A;  4TU4 A;  5IID A;  5C4Q A;  5TCM A;  4Z1Q A;  5LUU A;  4HXK A;  4QYL A;  5EQ1 A;  3AAD A;  5D3T A;  2N9G A;  4XYA A;  4YBM A;  4QB3 A;  4YK0 A;  5D25 A;  4CFL A;  4CUT A;  4CFK A;  5HJC A;  5HM0 A;  5COI A;  4NR4 A;  4Z93 A;  4OGJ A;  5I89 A;  2WP1 A;  5EWC A;  4YYN A;  2LSP B;  4CUR A;  5F60 A;  4QEV A;  4N4H A;  5DFC A;  4TT4 A;  5D7X A;  5DLX A;  3MB4 A;  5EK9 A;  3SVG A;  4XY8 A;  3O37 A;  5A82 A;  5ENF A;  5FE7 A;  2YEM A;  5AMF A;  3Q2E A;  4C67 A;  4HXS A;  4A9I A;  4HXR A;  5D24 A;  4QSX A;  5KTU A;  1JSP B;  5FH7 A;  5E7D A;  5EA1 A;  5DYU A;  4BJX A;  2YYN A;  1N72 A;  4QYD A;  4YYH A;  4LDF A;  4HXN A;  5E9M A;  5KU3 A;  2RNY A;  4N4F A;  5D0C A;  5CU8 A;  4A9K A;  5HFR A;  5FE3 A;  4J3I A;  5E9I A;  4ZW1 A;  5CQT A;  4BW1 A;  4TT2 A;  4ZQL A;  5EGU A;  5CFW A;  1ZS5 A;  1EQF A;  4A9L A;  5HCL A;  4XY9 A;  5CQ6 A;  4LZS A;  5F61 A;  5HRV A;  3U5L A;  4KCX A;  4QSQ A;  5LJ2 A;  2R0V A;  4NYX A;  5A5N A;  4UYH A;  4NRA A;  5CP5 A;  5I7X A;  5KHM A;  5A5R A;  5FFY A;  2YEK A;  5A5P A;  4UIV A;  5KTW A;  4A9J A;  4PCE A;  5EWV A; 
#chains in the Genus database with same CATH topology
 4PCI A;  5DY7 A;  3MXF A;  3LXJ A;  2YDW A;  2L84 A;  4LZ2 A;  5F36 A;  1ZKR A;  2DVR A;  5I1Q A;  4QSW A;  5CGP A;  5IGN A;  4HBV A;  5G4S A;  5LKZ A;  4CLB A;  4BHW A;  3U5O A;  5E9V A;  3RCW A;  5CQ3 A;  5EIS A;  4ZC9 A;  2DVS A;  5F2P A;  4NR8 A;  3UVY A;  4HBX A;  4QR5 A;  4TU6 A;  4E96 A;  5I29 A;  3LJW A;  4FLP A;  4QEU A;  2OO1 A;  4HXM A;  5BT5 A;  4HBY A;  2L85 A;  4PY6 A;  4MEO A;  4YBS A;  3HMH A;  5L98 A;  4QBM A;  4O7C A;  4A9O A;  5C85 A;  3QZS A;  3AQA A;  2WP2 A;  4HBW A;  2RNW A;  4ALH A;  4KV4 A;  4IOO A;  5LJ1 A;  4NUE A;  4WIV A;  4WHU A;  5FH6 A;  4QSV A;  1WUG A;  3DWY A;  5D3P A;  2E7N A;  2R10 A;  5CRM A;  5E74 A;  5IG6 A;  5EWD A;  4NQM A;  3LQJ A;  3UV4 A;  3FKM X;  5H85 A;  4BW3 A;  3U5K A;  5F25 A;  5L99 A;  4YYJ A;  5C8G A;  5CUB A;  4A9N A;  3G0L A;  2R0S A;  4LYI A;  5C87 A;  5DYA A;  5I83 A;  3O33 A;  4YAX A;  5D3J A;  5LVR A;  5DYC A;  5CRZ A;  5JI8 A;  5DW1 A;  2GRC A;  5EIC A;  4MR4 A;  4O71 A;  5G4R A;  4TT6 A;  4OUF A;  5CUE A;  2FSA A;  4ALG A;  2G4A A;  5ENG A;  4QNS A;  4UIZ A;  4O70 A;  3SVF A;  5E73 A;  3U5P A;  5FFV A;  3HMF A;  2NXB A;  5FE5 A;  3P5O A;  2I7K A;  5E0R A;  4NS5 A;  4TTE A;  4YC9 A;  3JVJ A;  5HLS A;  2DVV A;  3G0J A;  5AD2 A;  5FE9 A;  5IGL A;  5FE0 A;  5I7Y A;  5H1T A;  2OSS A;  3MUL A;  4X2I A;  5EWH A;  5IGM A;  5L8T A;  2RS9 B;  2D9E A;  3QZT A;  2DVQ A;  4A9H A;  4QSR A;  4NYW A;  4UYE A;  5FB1 A;  4J0S A;  5EVA A;  5FE1 A;  5JWM A;  5D3H A;  4UYF B;  4OGI A;  5A7C A;  5HQ6 A;  4N4I A;  3UV5 A;  5L96 A;  2MJV B;  5EV9 A;  4NR9 A;  4IOR A;  5DKD A;  3GG3 A;  5DYX A;  5LKU A;  4J1P A;  5CQ4 A;  4HXL A;  4O77 A;  4WHW A;  4QSP A;  4RVR A;  5E9K A;  4UYD A;  5CUA A;  2H60 A;  5AD3 A;  5HRW A;  4O72 A;  4IR4 A;  4A9M A;  5DLZ A;  4NYV A;  5CZG A;  4QSS A;  2RNX A;  5EU1 A;  3D7C A;  2YW5 A;  3U5M A;  4IOQ A;  5EI4 A;  4AKH A;  4A9E A;  5H1U A;  4NQN A;  5FFW A;  5H1V A;  5CQA A;  1F68 A;  5ENE A;  4UIY A;  5D26 A;  3S92 A;  5BT3 A;  4UYG A;  3P1E A;  4NRB A;  5HEN A;  4UYF A;  4XUB A;  5HQ5 A;  4N4G A;  5F3A A;  4XUA A;  5F5Z A;  4QR3 A;  5AME A;  5DFD A;  3JVM A;  5FG6 A;  4BW2 A;  4HXO A;  3IU6 A;  4UIX A;  4YYM A;  4YYG A;  5EP7 A;  4IR3 A;  3UVX A;  4J0R A;  3LQI A;  4QUU A;  5DKH A;  1JM4 B;  5FG4 A;  4PKL A;  4CUU A;  5L8U A;  4YH4 A;  2RO1 A;  4Z1S A;  4QUT A;  5LKX A;  4YBT A;  2YQD A;  5HEM A;  4YY4 A;  5ACY A;  4O74 A;  5KTX A;  1E6I A;  3S91 A;  4IR6 A;  4O75 A;  4NXJ A;  4LR6 A;  3MB3 A;  3O34 A;  5ENB A;  3U5J A;  4A9F A;  5ETB A;  5FE8 A;  2DAT A;  5A5Q A;  5A5S A;  5DW2 A;  4MR5 A;  5E3D A;  5C89 A;  5CUC A;  4Z6H A;  3DAI A;  4QC1 A;  5A81 A;  3UVW A;  4F3I A;  3ERR A;  5A85 A;  5L97 A;  2F6N A;  4CUQ A;  3O35 A;  5FE6 A;  4QY4 A;  3P1C A;  4AI6 A;  4NUC A;  3ONI A;  5IGK A;  5F63 A;  3MQM A;  5DBM A;  5D3R A;  3JVL A;  4Y03 A;  5DX4 A;  5FE4 A;  2L5E A;  3LQH A;  4TS8 A;  2EJN A;  5D3N A;  5II1 A;  4QEW A;  5II2 A;  4O7F A;  4UIW A;  4NR7 A;  5EPB A;  4QST A;  3UVD A;  4MEP A;  4YAB A;  4YY6 A;  1WUM A;  3UV2 A;  5I88 A;  5EM3 A;  4NUD A;  5A83 A;  5CUD A;  5F1L A;  2F6J A;  4AKI A;  2RFJ A;  5LVQ A;  4O76 A;  5KO4 A;  3P1D A;  3K2J A;  4O7B A;  5E3G A;  5ENC A;  3U5N A;  5EWW A;  4UIT A;  3VKG A;  5I40 A;  5FG5 A;  5ENH A;  4O7E A;  5CS8 A;  5ENI A;  4TYL A;  5DFB A;  4CL9 A;  4QC3 A;  3Q2F A;  5CQ8 A;  5FH8 A;  3QZV A;  2I8N A;  4N3W A;  5FE2 A;  4AKG A;  5ENJ A;  5CTL A;  2DKW A;  5E9L A;  4O78 A;  4HXP A;  4LYS A;  2RI7 A;  4LYW A;  2D82 A;  5CPE A;  5A5O A;  4MEN A;  4Q0N A;  5FDZ A;  4O7A A;  3ZYU A;  4NRC A;  5D3L A;  3JVK A;  5K29 A;  5FBX A;  5TB6 A;  5HEL A;  4QSU A;  4MR6 A;  1X0J A;  3P1F A;  5I86 A;  4PS5 A;  5EPR A;  4YYD A;  4IR5 A;  2OUO A;  2KTB B;  4TZ8 A;  2DWW A;  4NR6 A;  4KV1 A;  4CUP A;  4LRG A;  4UIU A;  5FB0 A;  4PTB A;  5I80 A;  3O36 A;  3SVH A;  5HFQ A;  4BW4 A;  4DON A;  2R0Y A;  4LZR A;  4NR5 A;  5CUG A;  5LKT A;  4GPJ A;  4TZ2 A;  5F62 A;  5HRX A;  3UW9 A;  4LC2 A;  3MUK A;  5D3S A;  5CQ7 A;  5IBN A;  5CY9 A;  2E7O A;  4Q0O A;  3D1B A;  4TQN A;  3VKH A;  3NXB A;  2YEL A;  5ETD A;  4YYI A;  2E3K A;  4Z6I A;  5HQ7 A;  3IU5 A;  4YYK A;  5DKC A;  4YAT A;  5E9Y A;  3TLP A;  5J0D A;  4QZS A;  5CQ5 A;  4CUS A;  5EPS A;  4C66 A;  5LJ0 A;  5F1H A;  3HME A;  4MEQ A;  3I3J A;  5BT4 A;  4MR3 A;  4AKN A;  4YAD A;  5C7N A;  4YH3 A;  4QR4 A;  4TU4 A;  5IID A;  5C4Q A;  5TCM A;  4Z1Q A;  5LUU A;  4HXK A;  4QYL A;  5EQ1 A;  3AAD A;  5D3T A;  2N9G A;  4XYA A;  4YBM A;  4QB3 A;  4YK0 A;  5D25 A;  4CFL A;  4CUT A;  4CFK A;  5HJC A;  5HM0 A;  5COI A;  4NR4 A;  4Z93 A;  4OGJ A;  5I89 A;  2WP1 A;  5EWC A;  4YYN A;  2LSP B;  4CUR A;  5F60 A;  4QEV A;  4N4H A;  5DFC A;  4TT4 A;  5D7X A;  5DLX A;  1PUO A;  3MB4 A;  5EK9 A;  3SVG A;  4XY8 A;  3O37 A;  5A82 A;  5ENF A;  5FE7 A;  2YEM A;  5AMF A;  3Q2E A;  4C67 A;  4HXS A;  4A9I A;  4HXR A;  5D24 A;  4QSX A;  5KTU A;  1JSP B;  5FH7 A;  5E7D A;  5EA1 A;  5DYU A;  4BJX A;  2YYN A;  1N72 A;  4QYD A;  4YYH A;  4LDF A;  4HXN A;  5E9M A;  5KU3 A;  2RNY A;  4N4F A;  5D0C A;  5CU8 A;  4A9K A;  5HFR A;  5FE3 A;  4J3I A;  5E9I A;  4ZW1 A;  5CQT A;  4BW1 A;  4TT2 A;  4ZQL A;  5EGU A;  5CFW A;  1ZS5 A;  1EQF A;  4A9L A;  5HCL A;  4XY9 A;  5CQ6 A;  4LZS A;  5F61 A;  5HRV A;  3D1D A;  3U5L A;  4KCX A;  4QSQ A;  5LJ2 A;  2R0V A;  4NYX A;  5A5N A;  4UYH A;  4NRA A;  5CP5 A;  5I7X A;  5KHM A;  5A5R A;  5FFY A;  2YEK A;  5A5P A;  4UIV A;  5KTW A;  4A9J A;  4PCE A;  5EWV A; 
#chains in the Genus database with same CATH homology
 4PCI A;  5DY7 A;  3MXF A;  3LXJ A;  2YDW A;  2L84 A;  4LZ2 A;  5F36 A;  2DVR A;  5I1Q A;  4QSW A;  5CGP A;  5IGN A;  4HBV A;  5G4S A;  5LKZ A;  4CLB A;  4BHW A;  3U5O A;  5E9V A;  3RCW A;  5CQ3 A;  5EIS A;  4ZC9 A;  2DVS A;  5F2P A;  4NR8 A;  3UVY A;  4HBX A;  4QR5 A;  4TU6 A;  4E96 A;  5I29 A;  3LJW A;  4FLP A;  4QEU A;  2OO1 A;  4HXM A;  5BT5 A;  4HBY A;  2L85 A;  4PY6 A;  4MEO A;  4YBS A;  3HMH A;  5L98 A;  4QBM A;  4O7C A;  4A9O A;  5C85 A;  3QZS A;  3AQA A;  2WP2 A;  4HBW A;  2RNW A;  4ALH A;  4KV4 A;  4IOO A;  5LJ1 A;  4NUE A;  4WIV A;  4WHU A;  5FH6 A;  4QSV A;  1WUG A;  3DWY A;  5D3P A;  2E7N A;  2R10 A;  5CRM A;  5E74 A;  5IG6 A;  5EWD A;  4NQM A;  3LQJ A;  3UV4 A;  3FKM X;  5H85 A;  4BW3 A;  3U5K A;  5F25 A;  5L99 A;  4YYJ A;  5C8G A;  5CUB A;  4A9N A;  3G0L A;  2R0S A;  4LYI A;  5C87 A;  5DYA A;  5I83 A;  3O33 A;  4YAX A;  5D3J A;  5LVR A;  5DYC A;  5CRZ A;  5JI8 A;  5DW1 A;  2GRC A;  5EIC A;  4MR4 A;  4O71 A;  5G4R A;  4TT6 A;  4OUF A;  5CUE A;  2FSA A;  4ALG A;  2G4A A;  5ENG A;  4QNS A;  4UIZ A;  4O70 A;  3SVF A;  5E73 A;  3U5P A;  5FFV A;  3HMF A;  2NXB A;  5FE5 A;  3P5O A;  2I7K A;  5E0R A;  4NS5 A;  4TTE A;  4YC9 A;  3JVJ A;  5HLS A;  2DVV A;  3G0J A;  5AD2 A;  5FE9 A;  5IGL A;  5FE0 A;  5I7Y A;  5H1T A;  2OSS A;  3MUL A;  4X2I A;  5EWH A;  5IGM A;  5L8T A;  2RS9 B;  2D9E A;  3QZT A;  2DVQ A;  4A9H A;  4QSR A;  4NYW A;  4UYE A;  5FB1 A;  4J0S A;  5EVA A;  5FE1 A;  5JWM A;  5D3H A;  4UYF B;  4OGI A;  5A7C A;  5HQ6 A;  4N4I A;  3UV5 A;  5L96 A;  2MJV B;  5EV9 A;  4NR9 A;  4IOR A;  5DKD A;  3GG3 A;  5DYX A;  5LKU A;  4J1P A;  5CQ4 A;  4HXL A;  4O77 A;  4WHW A;  4QSP A;  4RVR A;  5E9K A;  4UYD A;  5CUA A;  2H60 A;  5AD3 A;  5HRW A;  4O72 A;  4IR4 A;  4A9M A;  5DLZ A;  4NYV A;  5CZG A;  4QSS A;  2RNX A;  5EU1 A;  3D7C A;  2YW5 A;  3U5M A;  4IOQ A;  5EI4 A;  4A9E A;  5H1U A;  4NQN A;  5FFW A;  5H1V A;  5CQA A;  1F68 A;  5ENE A;  4UIY A;  5D26 A;  3S92 A;  5BT3 A;  4UYG A;  3P1E A;  4NRB A;  5HEN A;  4UYF A;  4XUB A;  5HQ5 A;  4N4G A;  5F3A A;  4XUA A;  5F5Z A;  4QR3 A;  5AME A;  5DFD A;  3JVM A;  5FG6 A;  4BW2 A;  4HXO A;  3IU6 A;  4UIX A;  4YYM A;  4YYG A;  5EP7 A;  4IR3 A;  3UVX A;  4J0R A;  3LQI A;  4QUU A;  5DKH A;  1JM4 B;  5FG4 A;  4PKL A;  4CUU A;  5L8U A;  4YH4 A;  2RO1 A;  4Z1S A;  4QUT A;  5LKX A;  4YBT A;  2YQD A;  5HEM A;  4YY4 A;  5ACY A;  4O74 A;  5KTX A;  1E6I A;  3S91 A;  4IR6 A;  4O75 A;  4NXJ A;  4LR6 A;  3MB3 A;  3O34 A;  5ENB A;  3U5J A;  4A9F A;  5ETB A;  5FE8 A;  2DAT A;  5A5Q A;  5A5S A;  5DW2 A;  4MR5 A;  5E3D A;  5C89 A;  5CUC A;  4Z6H A;  3DAI A;  4QC1 A;  5A81 A;  3UVW A;  4F3I A;  5A85 A;  5L97 A;  2F6N A;  4CUQ A;  3O35 A;  5FE6 A;  4QY4 A;  3P1C A;  4NUC A;  3ONI A;  5IGK A;  5F63 A;  3MQM A;  5DBM A;  5D3R A;  3JVL A;  4Y03 A;  5DX4 A;  5FE4 A;  2L5E A;  3LQH A;  4TS8 A;  5D3N A;  5II1 A;  4QEW A;  5II2 A;  4O7F A;  4UIW A;  4NR7 A;  5EPB A;  4QST A;  3UVD A;  4MEP A;  4YAB A;  4YY6 A;  1WUM A;  3UV2 A;  5I88 A;  5EM3 A;  4NUD A;  5A83 A;  5CUD A;  5F1L A;  2F6J A;  2RFJ A;  5LVQ A;  4O76 A;  5KO4 A;  3P1D A;  3K2J A;  4O7B A;  5E3G A;  5ENC A;  3U5N A;  5EWW A;  4UIT A;  5I40 A;  5FG5 A;  5ENH A;  4O7E A;  5CS8 A;  5ENI A;  4TYL A;  5DFB A;  4CL9 A;  4QC3 A;  3Q2F A;  5CQ8 A;  5FH8 A;  3QZV A;  2I8N A;  4N3W A;  5FE2 A;  5ENJ A;  5CTL A;  2DKW A;  5E9L A;  4O78 A;  4HXP A;  4LYS A;  2RI7 A;  4LYW A;  2D82 A;  5CPE A;  5A5O A;  4MEN A;  4Q0N A;  5FDZ A;  4O7A A;  3ZYU A;  4NRC A;  5D3L A;  3JVK A;  5K29 A;  5FBX A;  5TB6 A;  5HEL A;  4QSU A;  4MR6 A;  1X0J A;  3P1F A;  5I86 A;  4PS5 A;  5EPR A;  4YYD A;  4IR5 A;  2OUO A;  2KTB B;  4TZ8 A;  2DWW A;  4NR6 A;  4KV1 A;  4CUP A;  4LRG A;  4UIU A;  5FB0 A;  4PTB A;  5I80 A;  3O36 A;  3SVH A;  5HFQ A;  4BW4 A;  4DON A;  2R0Y A;  4LZR A;  4NR5 A;  5CUG A;  5LKT A;  4GPJ A;  4TZ2 A;  5F62 A;  5HRX A;  3UW9 A;  4LC2 A;  3MUK A;  5D3S A;  5CQ7 A;  5IBN A;  5CY9 A;  2E7O A;  4Q0O A;  4TQN A;  3NXB A;  2YEL A;  5ETD A;  4YYI A;  2E3K A;  4Z6I A;  5HQ7 A;  3IU5 A;  4YYK A;  5DKC A;  4YAT A;  5E9Y A;  3TLP A;  5J0D A;  4QZS A;  5CQ5 A;  4CUS A;  5EPS A;  4C66 A;  5LJ0 A;  5F1H A;  3HME A;  4MEQ A;  3I3J A;  5BT4 A;  4MR3 A;  4AKN A;  4YAD A;  5C7N A;  4YH3 A;  4QR4 A;  4TU4 A;  5IID A;  5C4Q A;  5TCM A;  4Z1Q A;  5LUU A;  4HXK A;  4QYL A;  5EQ1 A;  3AAD A;  5D3T A;  2N9G A;  4XYA A;  4YBM A;  4QB3 A;  4YK0 A;  5D25 A;  4CFL A;  4CUT A;  4CFK A;  5HJC A;  5HM0 A;  5COI A;  4NR4 A;  4Z93 A;  4OGJ A;  5I89 A;  2WP1 A;  5EWC A;  4YYN A;  2LSP B;  4CUR A;  5F60 A;  4QEV A;  4N4H A;  5DFC A;  4TT4 A;  5D7X A;  5DLX A;  3MB4 A;  5EK9 A;  3SVG A;  4XY8 A;  3O37 A;  5A82 A;  5ENF A;  5FE7 A;  2YEM A;  5AMF A;  3Q2E A;  4C67 A;  4HXS A;  4A9I A;  4HXR A;  5D24 A;  4QSX A;  5KTU A;  1JSP B;  5FH7 A;  5E7D A;  5EA1 A;  5DYU A;  4BJX A;  2YYN A;  1N72 A;  4QYD A;  4YYH A;  4LDF A;  4HXN A;  5E9M A;  5KU3 A;  2RNY A;  4N4F A;  5D0C A;  5CU8 A;  4A9K A;  5HFR A;  5FE3 A;  4J3I A;  5E9I A;  4ZW1 A;  5CQT A;  4BW1 A;  4TT2 A;  4ZQL A;  5EGU A;  5CFW A;  1ZS5 A;  1EQF A;  4A9L A;  5HCL A;  4XY9 A;  5CQ6 A;  4LZS A;  5F61 A;  5HRV A;  3U5L A;  4KCX A;  4QSQ A;  5LJ2 A;  2R0V A;  4NYX A;  5A5N A;  4UYH A;  4NRA A;  5CP5 A;  5I7X A;  5KHM A;  5A5R A;  5FFY A;  2YEK A;  5A5P A;  4UIV A;  5KTW A;  4A9J A;  4PCE A;  5EWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...