5CQTA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
HHLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 42
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5cqtA01
5FH7A 5II1A 5A5OA 5JI8A 2YDWA 4IR6A 5EU1A 5KO4A 4QSRA 5DYAA 5DBMA 5A5PA 2DVVA 4Q0NA 5FH6A 2YW5A 4LYIA 4NUCA 4XUAA 4A9EA 5ENFA 5KTXA 3DAIA 4CL9A 4A9KA 5EPBA 1EQFA 4HXMA 2R10A 4OGJA 5II2A 5FG4A 4BW4A 4TT2A 1WUMA 2NXBA 4QSWA 4A9LA 5D3HA 4PKLA 5FE3A 4Q0OA 4O71A 3O35A 4O74A 3JVJA 4NYWA 2GRCA 4NR6A 5E7DA 3I3JA 3P1FA 3UVXA 3UVYA 5KU3A 5CQ4A 5KHMA 3UV5A 2H60A 4NYXA 4UIWA 4N4FA 5HEMA 3P1DA 5CPEA 1WUGA 5EI4A 5ETBA 2KTBB 5D3TA 4NR8A 4MENA 5EICA 4YYDA 3MUKA 3LQJA 5FE7A 5A82A 4QUUA 5G4SA 5DYCA 4IR5A 3UV2A 5I29A 5AD3A 5TCMA 3JVMA 5L97A 5H1VA 4UIZA 4C66A 4XUBA 4NQNA 5FB0A 5E9IA 3U5NA 5E9YA 3LJWA 5F61A 5EWCA 5DFBA 1F68A 5IBNA 5ENBA 5DX4A 4WIVA 4PCEA 5EWWA 4UYGA 3SVFA 2L5EA 5CU8A 5I86A 4MEQA 4TZ2A 5FE0A 5ENIA 4J3IA 5CTLA 4O7CA 5LJ1A 5EA1A 2FSAA 5F62A 5A5QA 4NRAA 3AQAA 4TT4A 2DATA 5DW1A 4O78A 5E3DA 3D7CA 4CUPA 5EISA 4O77A 5I83A 4GPJA 4A9FA 4UIXA 3JVKA 3QZVA 2DVSA 4ZC9A 5FFYA 5LKTA 4J1PA 5EVAA 4PTBA 5E0RA 5EM3A 5A83A 4NR5A 5CUEA 3O34A 5I40A 2WP2A 4MR6A 4A9JA 5D3RA 4HBWA 5ENCA 5A85A 2OSSA 4YATA 3UV4A 2RO1A 3MXFA 4NYVA 5LUUA 4YK0A 3DWYA 5ENGA 2WP1A 5EPSA 4QSTA 4TU4A 4DONA 4CURA 5HM0A 4RVRA 5CRZA 5DY7A 4N4GA 5H1TA 4O72A 4QYDA 3UVWA 4YH4A 5KTUA 5CUBA 5BT5A 2OUOA 5LKUA 4UYEA 5DLXA 5L96A 4OUFA 5HRVA 4QUTA 5D3NA 3HMEA 2RNYA 5CQ5A 5IGNA 4N3WA 2DWWA 5LJ2A 4Z93A 3UVDA 2L84A 5L8UA 5J0DA 4YADA 4O76A 5IIDA 4UITA 5EPRA 4HXSA 4TYLA 5CP5A 5EWDA 3U5KA 5DFCA 3JVLA 4QZSA 4NQMA 4YYGA 4NS5A 2R0SA 5DYXA 4LZSA 3S91A 4HXLA 4NRBA 5CUDA 2YEKA 4QR5A 5HCLA 5G4RA 3RCWA 4E96A 5HENA 4PY6A 4CUQA 3O36A 2I7KA 5LVQA 4YYKA 4YYJA 2E3KA 5LKXA 3QZTA 5IGMA 4ZW1A 4XY8A 3G0LA 1ZS5A 4QB3A 4UYFA 4A9HA 4CFKA 5A5NA 3NXBA 5CQ7A 4MEOA 4YYMA 5CS8A 5E9KA 4YYNA 5F5ZA 5HJCA 3GG3A 4LR6A 5AMEA 4AKNA 2F6NA 4UIUA 5CZGA 4QR4A 5CQ6A 5I1QA 3MQMA 4Z6IA 4MR4A 4KV1A 4ZQLA 4O70A 3U5JA 4O7BA 5D24A 5CFWA 5D26A 5HRWA 4ALHA 5L99A 5FBXA 5ENJA 5ENEA 5AD2A 4TQNA 3MB4A 5DLZA 4PS5A 5D7XA 2OO1A 5HLSA 5F1LA 3U5LA 2DVRA 4QSQA 5EV9A 5FE6A 4A9NA 4A9MA 5D3JA 5L98A 5FH8A 5C85A 5EGUA 1E6IA 5ENHA 4QY4A 5ACYA 5C4QA 5E74A 5EWVA 5HQ7A 5EWHA 4TS8A 4HXNA 5BT4A 4CUTA 5JWMA 2RNXA 5DKHA 1N72A 5IG6A 5A5RA 3S92A 5D0CA 3SVHA 4YYHA 4O75A 4BW3A 5FE4A 1JSPB 3K2JA 4NXJA 3LXJA 4J0RA 5DKCA 2L85A 4YBMA 5C89A 4IOQA 4CFLA 3TLPA 4CUSA 4HXRA 4X2IA 4NR9A 4LRGA 4KV4A 5DW2A 3SVGA 3P1EA 3FKMX 5CUCA 4Y03A 5FB1A 4O7FA 5K29A 4NR7A 5FE1A 5DYUA 5EK9A 5FFWA 4HBVA 5FG5A 3LQHA 4Z1SA 4BHWA 4LC2A 5F63A 5D25A 5FE9A 5CGPA 2R0VA 3O33A 4QSXA 3Q2EA 4YABA 4QSSA 4MR5A 2G4AA 4HXPA 4QEWA 5HELA 5IGLA 4XY9A 5F60A 4NUDA 1JM4B 3U5PA 4O7AA 4IR4A 5CY9A 2YELA 4O7EA 4HXKA 5C87A 3U5MA 4NR4A 2E7NA 5E9LA 4QC3A 2YYNA 3ONIA 2RNWA 4QC1A 2DKWA 2YEMA 4OGIA 5EP7A 4YY4A 5DKDA 3AADA 3MB3A 4YYIA 4LZRA 5FDZA 5A81A 5TB6A 3IU6A 5LVRA 4HBXA 4YH3A 4YAXA 5L8TA 5H1UA 4CLBA 5KTWA 3ZYUA 4HBYA 5HFRA 5CQ8A 4MEPA 3HMHA 5F36A 4WHWA 5CQ3A 2MJVB 4N4HA 4CUUA 2RS9B 5A7CA 4QEVA 4TZ8A 4C67A 4QEUA 5F3AA 5H85A 5E3GA 5ETDA 5HRXA 3O37A 5DFDA 4Z1QA 5IGKA 4IOOA 4YBTA 4LDFA 5CQAA 4QNSA 2DVQA 5I80A 4LYSA 5CUGA 5EQ1A 5AMFA 5FG6A 3P1CA 4QR3A 4ALGA 4IR3A 2E7OA 5CQTA 5F25A 5I7XA 4F3IA 4PCIA 2RI7A 5D3LA 4NUEA 5F1HA 5C7NA 5I89A 5I88A 2YQDA 4QSPA 2I8NA 4Z6HA 5FE2A 4QBMA 4QYLA 5LJ0A 5I7YA 5HQ5A 3MULA 5CRMA 4TT6A 3G0JA 5COIA 5FE8A 4UYFB 4YC9A 4QSUA 3UW9A 2F6JA 5CUAA 4MR3A 4UIYA 5D3SA 3IU5A 3HMFA 3LQIA 5E9MA 2R0YA 5F2PA 5LKZA 5FE5A 3P5OA 4XYAA 4TTEA 3U5OA 4KCXA 4A9IA 5C8GA 3Q2FA 5E73A 4LYWA 5BT3A 5A5SA 3QZSA 4IORA 5FFVA 2LSPB 4BW1A 4FLPA 4N4IA 4NRCA 4LZ2A 4UYHA 2D82A 2N9GA 5HFQA 4TU6A 4UYDA 4YY6A 4HXOA 4BJXA 4WHUA 2RFJA 4J0SA 4A9OA 4QSVA 4UIVA 5E9VA 1X0JA 2D9EA 5HQ6A 5D3PA 4BW2A 4YBSA
chains in the Genus database with same CATH superfamily
5FH7A 4AKGA 5II1A 5A5OA 5JI8A 2YDWA 4IR6A 5EU1A 5KO4A 4QSRA 3ERRA 5DYAA 5DBMA 5A5PA 2DVVA 4Q0NA 5FH6A 2YW5A 4LYIA 4NUCA 4XUAA 4A9EA 5ENFA 5KTXA 3DAIA 4CL9A 4A9KA 5EPBA 1EQFA 4HXMA 2R10A 4OGJA 5II2A 5FG4A 4BW4A 4TT2A 1WUMA 2NXBA 4QSWA 4A9LA 5D3HA 4PKLA 5FE3A 4Q0OA 4O71A 3O35A 4O74A 3JVJA 4NYWA 2GRCA 4NR6A 5E7DA 3I3JA 3P1FA 3UVXA 3UVYA 5KU3A 5CQ4A 5KHMA 3UV5A 2H60A 4NYXA 4UIWA 4N4FA 5HEMA 3P1DA 5CPEA 1WUGA 5EI4A 5ETBA 2KTBB 5D3TA 4NR8A 4MENA 5EICA 4YYDA 3MUKA 3LQJA 5FE7A 5A82A 4QUUA 5G4SA 5DYCA 4IR5A 3UV2A 5I29A 5AD3A 5TCMA 3JVMA 5L97A 5H1VA 4AKHA 4UIZA 4C66A 4XUBA 4NQNA 5FB0A 5E9IA 3U5NA 5E9YA 3LJWA 5F61A 5EWCA 5DFBA 1F68A 5IBNA 5ENBA 5DX4A 4WIVA 4PCEA 5EWWA 4UYGA 3VKHA 3SVFA 2L5EA 5CU8A 5I86A 4MEQA 4TZ2A 5FE0A 5ENIA 4J3IA 5CTLA 4O7CA 5LJ1A 5EA1A 2FSAA 5F62A 5A5QA 4NRAA 3AQAA 4TT4A 2DATA 5DW1A 4O78A 5E3DA 3D7CA 4CUPA 5EISA 4O77A 5I83A 4GPJA 4A9FA 4UIXA 3JVKA 3QZVA 2DVSA 4ZC9A 5FFYA 5LKTA 4J1PA 5EVAA 4PTBA 5E0RA 5EM3A 5A83A 4NR5A 5CUEA 3O34A 5I40A 2WP2A 4MR6A 4A9JA 5D3RA 4HBWA 5ENCA 5A85A 2OSSA 4YATA 3UV4A 2RO1A 3MXFA 4NYVA 5LUUA 4YK0A 3DWYA 5ENGA 2WP1A 5EPSA 4QSTA 4TU4A 4DONA 4CURA 5HM0A 4RVRA 5CRZA 5DY7A 4N4GA 5H1TA 4O72A 4QYDA 3UVWA 4YH4A 5KTUA 5CUBA 5BT5A 2OUOA 5LKUA 4UYEA 5DLXA 5L96A 4OUFA 5HRVA 4QUTA 2EJNA 5D3NA 3HMEA 2RNYA 5CQ5A 5IGNA 4N3WA 2DWWA 5LJ2A 4Z93A 3UVDA 2L84A 5L8UA 5J0DA 4YADA 4O76A 5IIDA 4UITA 5EPRA 4HXSA 1ZKRA 4TYLA 5CP5A 5EWDA 3U5KA 5DFCA 3JVLA 4QZSA 4NQMA 4YYGA 4NS5A 2R0SA 5DYXA 4LZSA 3S91A 4HXLA 4NRBA 5CUDA 2YEKA 4QR5A 5HCLA 5G4RA 3RCWA 4E96A 5HENA 4PY6A 4CUQA 3O36A 2I7KA 5LVQA 4YYKA 4YYJA 2E3KA 5LKXA 3QZTA 5IGMA 4ZW1A 4XY8A 3G0LA 1ZS5A 4QB3A 4UYFA 4A9HA 4CFKA 5A5NA 3NXBA 5CQ7A 4MEOA 4YYMA 5CS8A 5E9KA 4YYNA 5F5ZA 5HJCA 3GG3A 4LR6A 5AMEA 4AKNA 2F6NA 4UIUA 5CZGA 4QR4A 5CQ6A 5I1QA 3MQMA 4Z6IA 4MR4A 4KV1A 4ZQLA 4O70A 3U5JA 4O7BA 5D24A 5CFWA 5D26A 5HRWA 4ALHA 5L99A 5FBXA 5ENJA 5ENEA 5AD2A 4TQNA 3MB4A 5DLZA 4PS5A 5D7XA 2OO1A 5HLSA 5F1LA 3U5LA 2DVRA 4QSQA 5EV9A 5FE6A 4A9NA 4A9MA 5D3JA 5L98A 5FH8A 5C85A 5EGUA 1E6IA 5ENHA 4QY4A 5ACYA 5C4QA 5E74A 5EWVA 5HQ7A 5EWHA 4TS8A 4HXNA 5BT4A 4CUTA 5JWMA 2RNXA 5DKHA 1N72A 5IG6A 5A5RA 3S92A 5D0CA 3SVHA 4YYHA 4O75A 4BW3A 5FE4A 1JSPB 3K2JA 3D1BA 4NXJA 3LXJA 4J0RA 5DKCA 2L85A 4YBMA 5C89A 4IOQA 4CFLA 3TLPA 4CUSA 4HXRA 4X2IA 4NR9A 4LRGA 4KV4A 5DW2A 3SVGA 3P1EA 3FKMX 5CUCA 4Y03A 5FB1A 4O7FA 5K29A 4NR7A 5FE1A 4AKIA 5DYUA 5EK9A 5FFWA 4HBVA 5FG5A 3LQHA 4Z1SA 4AI6A 4BHWA 4LC2A 5F63A 5D25A 5FE9A 5CGPA 2R0VA 3O33A 4QSXA 3Q2EA 4YABA 4QSSA 4MR5A 2G4AA 4HXPA 4QEWA 5HELA 5IGLA 4XY9A 5F60A 1PUOA 4NUDA 1JM4B 3U5PA 4O7AA 4IR4A 5CY9A 2YELA 4O7EA 4HXKA 5C87A 3U5MA 4NR4A 2E7NA 5E9LA 4QC3A 2YYNA 3ONIA 2RNWA 4QC1A 2DKWA 2YEMA 4OGIA 5EP7A 4YY4A 5DKDA 3AADA 3MB3A 4YYIA 4LZRA 5FDZA 5A81A 5TB6A 3IU6A 5LVRA 4HBXA 4YH3A 4YAXA 5L8TA 5H1UA 4CLBA 5KTWA 3ZYUA 4HBYA 5HFRA 5CQ8A 4MEPA 3HMHA 5F36A 4WHWA 5CQ3A 2MJVB 4N4HA 4CUUA 2RS9B 5A7CA 4QEVA 4TZ8A 4C67A 4QEUA 5F3AA 5H85A 5E3GA 5ETDA 5HRXA 3O37A 5DFDA 4Z1QA 5IGKA 4IOOA 4YBTA 4LDFA 5CQAA 4QNSA 2DVQA 5I80A 4LYSA 5CUGA 5EQ1A 5AMFA 5FG6A 3P1CA 4QR3A 4ALGA 4IR3A 2E7OA 5CQTA 5F25A 5I7XA 4F3IA 4PCIA 2RI7A 5D3LA 3VKGA 4NUEA 5F1HA 5C7NA 5I89A 5I88A 2YQDA 4QSPA 2I8NA 4Z6HA 5FE2A 4QBMA 4QYLA 5LJ0A 5I7YA 5HQ5A 3MULA 5CRMA 4TT6A 3G0JA 5COIA 5FE8A 4UYFB 4YC9A 4QSUA 3UW9A 2F6JA 5CUAA 4MR3A 4UIYA 5D3SA 3IU5A 3HMFA 3LQIA 5E9MA 2R0YA 5F2PA 5LKZA 5FE5A 3P5OA 4XYAA 4TTEA 3U5OA 4KCXA 4A9IA 5C8GA 3Q2FA 5E73A 4LYWA 3D1DA 5BT3A 5A5SA 3QZSA 4IORA 5FFVA 2LSPB 4BW1A 4FLPA 4N4IA 4NRCA 4LZ2A 4UYHA 2D82A 2N9GA 5HFQA 4TU6A 4UYDA 4YY6A 4HXOA 4BJXA 4WHUA 2RFJA 4J0SA 4A9OA 4QSVA 4UIVA 5E9VA 1X0JA 2D9EA 5HQ6A 5D3PA 4BW2A 4YBSA
chains in the Genus database with same CATH topology
5FH7A 5II1A 5A5OA 5JI8A 2YDWA 4IR6A 5EU1A 5KO4A 4QSRA 5DYAA 5DBMA 5A5PA 2DVVA 4Q0NA 5FH6A 2YW5A 4LYIA 4NUCA 4XUAA 4A9EA 5ENFA 5KTXA 3DAIA 4CL9A 4A9KA 5EPBA 1EQFA 4HXMA 2R10A 4OGJA 5II2A 5FG4A 4BW4A 4TT2A 1WUMA 2NXBA 4QSWA 4A9LA 5D3HA 4PKLA 5FE3A 4Q0OA 4O71A 3O35A 4O74A 3JVJA 4NYWA 2GRCA 4NR6A 5E7DA 3I3JA 3P1FA 3UVXA 3UVYA 5KU3A 5CQ4A 5KHMA 3UV5A 2H60A 4NYXA 4UIWA 4N4FA 5HEMA 3P1DA 5CPEA 1WUGA 5EI4A 5ETBA 2KTBB 5D3TA 4NR8A 4MENA 5EICA 4YYDA 3MUKA 3LQJA 5FE7A 5A82A 4QUUA 5G4SA 5DYCA 4IR5A 3UV2A 5I29A 5AD3A 5TCMA 3JVMA 5L97A 5H1VA 4UIZA 4C66A 4XUBA 4NQNA 5FB0A 5E9IA 3U5NA 5E9YA 3LJWA 5F61A 5EWCA 5DFBA 1F68A 5IBNA 5ENBA 5DX4A 4WIVA 4PCEA 5EWWA 4UYGA 3SVFA 2L5EA 5CU8A 5I86A 4MEQA 4TZ2A 5FE0A 5ENIA 4J3IA 5CTLA 4O7CA 5LJ1A 5EA1A 2FSAA 5F62A 5A5QA 4NRAA 3AQAA 4TT4A 2DATA 5DW1A 4O78A 5E3DA 3D7CA 4CUPA 5EISA 4O77A 5I83A 4GPJA 4A9FA 4UIXA 3JVKA 3QZVA 2DVSA 4ZC9A 5FFYA 5LKTA 4J1PA 5EVAA 4PTBA 5E0RA 5EM3A 5A83A 4NR5A 5CUEA 3O34A 5I40A 2WP2A 4MR6A 4A9JA 5D3RA 4HBWA 5ENCA 5A85A 2OSSA 4YATA 3UV4A 2RO1A 3MXFA 4NYVA 5LUUA 4YK0A 3DWYA 5ENGA 2WP1A 5EPSA 4QSTA 4TU4A 4DONA 4CURA 5HM0A 4RVRA 5CRZA 5DY7A 4N4GA 5H1TA 4O72A 4QYDA 3UVWA 4YH4A 5KTUA 5CUBA 5BT5A 2OUOA 5LKUA 4UYEA 5DLXA 5L96A 4OUFA 5HRVA 4QUTA 5D3NA 3HMEA 2RNYA 5CQ5A 5IGNA 4N3WA 2DWWA 5LJ2A 4Z93A 3UVDA 2L84A 5L8UA 5J0DA 4YADA 4O76A 5IIDA 4UITA 5EPRA 4HXSA 4TYLA 5CP5A 5EWDA 3U5KA 5DFCA 3JVLA 4QZSA 4NQMA 4YYGA 4NS5A 2R0SA 5DYXA 4LZSA 3S91A 4HXLA 4NRBA 5CUDA 2YEKA 4QR5A 5HCLA 5G4RA 3RCWA 4E96A 5HENA 4PY6A 4CUQA 3O36A 2I7KA 5LVQA 4YYKA 4YYJA 2E3KA 5LKXA 3QZTA 5IGMA 4ZW1A 4XY8A 3G0LA 1ZS5A 4QB3A 4UYFA 4A9HA 4CFKA 5A5NA 3NXBA 5CQ7A 4MEOA 4YYMA 5CS8A 5E9KA 4YYNA 5F5ZA 5HJCA 3GG3A 4LR6A 5AMEA 4AKNA 2F6NA 4UIUA 5CZGA 4QR4A 5CQ6A 5I1QA 3MQMA 4Z6IA 4MR4A 4KV1A 4ZQLA 4O70A 3U5JA 4O7BA 5D24A 5CFWA 5D26A 5HRWA 4ALHA 5L99A 5FBXA 5ENJA 5ENEA 5AD2A 4TQNA 3MB4A 5DLZA 4PS5A 5D7XA 2OO1A 5HLSA 5F1LA 3U5LA 2DVRA 4QSQA 5EV9A 5FE6A 4A9NA 4A9MA 5D3JA 5L98A 5FH8A 5C85A 5EGUA 1E6IA 5ENHA 4QY4A 5ACYA 5C4QA 5E74A 5EWVA 5HQ7A 5EWHA 4TS8A 4HXNA 5BT4A 4CUTA 5JWMA 2RNXA 5DKHA 1N72A 5IG6A 5A5RA 3S92A 5D0CA 3SVHA 4YYHA 4O75A 4BW3A 5FE4A 1JSPB 3K2JA 4NXJA 3LXJA 4J0RA 5DKCA 2L85A 4YBMA 5C89A 4IOQA 4CFLA 3TLPA 4CUSA 4HXRA 4X2IA 4NR9A 4LRGA 4KV4A 5DW2A 3SVGA 3P1EA 3FKMX 5CUCA 4Y03A 5FB1A 4O7FA 5K29A 4NR7A 5FE1A 5DYUA 5EK9A 5FFWA 4HBVA 5FG5A 3LQHA 4Z1SA 4BHWA 4LC2A 5F63A 5D25A 5FE9A 5CGPA 2R0VA 3O33A 4QSXA 3Q2EA 4YABA 4QSSA 4MR5A 2G4AA 4HXPA 4QEWA 5HELA 5IGLA 4XY9A 5F60A 4NUDA 1JM4B 3U5PA 4O7AA 4IR4A 5CY9A 2YELA 4O7EA 4HXKA 5C87A 3U5MA 4NR4A 2E7NA 5E9LA 4QC3A 2YYNA 3ONIA 2RNWA 4QC1A 2DKWA 2YEMA 4OGIA 5EP7A 4YY4A 5DKDA 3AADA 3MB3A 4YYIA 4LZRA 5FDZA 5A81A 5TB6A 3IU6A 5LVRA 4HBXA 4YH3A 4YAXA 5L8TA 5H1UA 4CLBA 5KTWA 3ZYUA 4HBYA 5HFRA 5CQ8A 4MEPA 3HMHA 5F36A 4WHWA 5CQ3A 2MJVB 4N4HA 4CUUA 2RS9B 5A7CA 4QEVA 4TZ8A 4C67A 4QEUA 5F3AA 5H85A 5E3GA 5ETDA 5HRXA 3O37A 5DFDA 4Z1QA 5IGKA 4IOOA 4YBTA 4LDFA 5CQAA 4QNSA 2DVQA 5I80A 4LYSA 5CUGA 5EQ1A 5AMFA 5FG6A 3P1CA 4QR3A 4ALGA 4IR3A 2E7OA 5CQTA 5F25A 5I7XA 4F3IA 4PCIA 2RI7A 5D3LA 4NUEA 5F1HA 5C7NA 5I89A 5I88A 2YQDA 4QSPA 2I8NA 4Z6HA 5FE2A 4QBMA 4QYLA 5LJ0A 5I7YA 5HQ5A 3MULA 5CRMA 4TT6A 3G0JA 5COIA 5FE8A 4UYFB 4YC9A 4QSUA 3UW9A 2F6JA 5CUAA 4MR3A 4UIYA 5D3SA 3IU5A 3HMFA 3LQIA 5E9MA 2R0YA 5F2PA 5LKZA 5FE5A 3P5OA 4XYAA 4TTEA 3U5OA 4KCXA 4A9IA 5C8GA 3Q2FA 5E73A 4LYWA 5BT3A 5A5SA 3QZSA 4IORA 5FFVA 2LSPB 4BW1A 4FLPA 4N4IA 4NRCA 4LZ2A 4UYHA 2D82A 2N9GA 5HFQA 4TU6A 4UYDA 4YY6A 4HXOA 4BJXA 4WHUA 2RFJA 4J0SA 4A9OA 4QSVA 4UIVA 5E9VA 1X0JA 2D9EA 5HQ6A 5D3PA 4BW2A 4YBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FH7 A;  5II1 A;  5A5O A;  5JI8 A;  2YDW A;  4IR6 A;  5EU1 A;  5KO4 A;  4QSR A;  5DYA A;  5DBM A;  5A5P A;  2DVV A;  4Q0N A;  5FH6 A;  2YW5 A;  4LYI A;  4NUC A;  4XUA A;  4A9E A;  5ENF A;  5KTX A;  3DAI A;  4CL9 A;  4A9K A;  5EPB A;  1EQF A;  4HXM A;  2R10 A;  4OGJ A;  5II2 A;  5FG4 A;  4BW4 A;  4TT2 A;  1WUM A;  2NXB A;  4QSW A;  4A9L A;  5D3H A;  4PKL A;  5FE3 A;  4Q0O A;  4O71 A;  3O35 A;  4O74 A;  3JVJ A;  4NYW A;  2GRC A;  4NR6 A;  5E7D A;  3I3J A;  3P1F A;  3UVX A;  3UVY A;  5KU3 A;  5CQ4 A;  5KHM A;  3UV5 A;  2H60 A;  4NYX A;  4UIW A;  4N4F A;  5HEM A;  3P1D A;  5CPE A;  1WUG A;  5EI4 A;  5ETB A;  2KTB B;  5D3T A;  4NR8 A;  4MEN A;  5EIC A;  4YYD A;  3MUK A;  3LQJ A;  5FE7 A;  5A82 A;  4QUU A;  5G4S A;  5DYC A;  4IR5 A;  3UV2 A;  5I29 A;  5AD3 A;  5TCM A;  3JVM A;  5L97 A;  5H1V A;  4UIZ A;  4C66 A;  4XUB A;  4NQN A;  5FB0 A;  5E9I A;  3U5N A;  5E9Y A;  3LJW A;  5F61 A;  5EWC A;  5DFB A;  1F68 A;  5IBN A;  5ENB A;  5DX4 A;  4WIV A;  4PCE A;  5EWW A;  4UYG A;  3SVF A;  2L5E A;  5CU8 A;  5I86 A;  4MEQ A;  4TZ2 A;  5FE0 A;  5ENI A;  4J3I A;  5CTL A;  4O7C A;  5LJ1 A;  5EA1 A;  2FSA A;  5F62 A;  5A5Q A;  4NRA A;  3AQA A;  4TT4 A;  2DAT A;  5DW1 A;  4O78 A;  5E3D A;  3D7C A;  4CUP A;  5EIS A;  4O77 A;  5I83 A;  4GPJ A;  4A9F A;  4UIX A;  3JVK A;  3QZV A;  2DVS A;  4ZC9 A;  5FFY A;  5LKT A;  4J1P A;  5EVA A;  4PTB A;  5E0R A;  5EM3 A;  5A83 A;  4NR5 A;  5CUE A;  3O34 A;  5I40 A;  2WP2 A;  4MR6 A;  4A9J A;  5D3R A;  4HBW A;  5ENC A;  5A85 A;  2OSS A;  4YAT A;  3UV4 A;  2RO1 A;  3MXF A;  4NYV A;  5LUU A;  4YK0 A;  3DWY A;  5ENG A;  2WP1 A;  5EPS A;  4QST A;  4TU4 A;  4DON A;  4CUR A;  5HM0 A;  4RVR A;  5CRZ A;  5DY7 A;  4N4G A;  5H1T A;  4O72 A;  4QYD A;  3UVW A;  4YH4 A;  5KTU A;  5CUB A;  5BT5 A;  2OUO A;  5LKU A;  4UYE A;  5DLX A;  5L96 A;  4OUF A;  5HRV A;  4QUT A;  5D3N A;  3HME A;  2RNY A;  5CQ5 A;  5IGN A;  4N3W A;  2DWW A;  5LJ2 A;  4Z93 A;  3UVD A;  2L84 A;  5L8U A;  5J0D A;  4YAD A;  4O76 A;  5IID A;  4UIT A;  5EPR A;  4HXS A;  4TYL A;  5CP5 A;  5EWD A;  3U5K A;  5DFC A;  3JVL A;  4QZS A;  4NQM A;  4YYG A;  4NS5 A;  2R0S A;  5DYX A;  4LZS A;  3S91 A;  4HXL A;  4NRB A;  5CUD A;  2YEK A;  4QR5 A;  5HCL A;  5G4R A;  3RCW A;  4E96 A;  5HEN A;  4PY6 A;  4CUQ A;  3O36 A;  2I7K A;  5LVQ A;  4YYK A;  4YYJ A;  2E3K A;  5LKX A;  3QZT A;  5IGM A;  4ZW1 A;  4XY8 A;  3G0L A;  1ZS5 A;  4QB3 A;  4UYF A;  4A9H A;  4CFK A;  5A5N A;  3NXB A;  5CQ7 A;  4MEO A;  4YYM A;  5CS8 A;  5E9K A;  4YYN A;  5F5Z A;  5HJC A;  3GG3 A;  4LR6 A;  5AME A;  4AKN A;  2F6N A;  4UIU A;  5CZG A;  4QR4 A;  5CQ6 A;  5I1Q A;  3MQM A;  4Z6I A;  4MR4 A;  4KV1 A;  4ZQL A;  4O70 A;  3U5J A;  4O7B A;  5D24 A;  5CFW A;  5D26 A;  5HRW A;  4ALH A;  5L99 A;  5FBX A;  5ENJ A;  5ENE A;  5AD2 A;  4TQN A;  3MB4 A;  5DLZ A;  4PS5 A;  5D7X A;  2OO1 A;  5HLS A;  5F1L A;  3U5L A;  2DVR A;  4QSQ A;  5EV9 A;  5FE6 A;  4A9N A;  4A9M A;  5D3J A;  5L98 A;  5FH8 A;  5C85 A;  5EGU A;  1E6I A;  5ENH A;  4QY4 A;  5ACY A;  5C4Q A;  5E74 A;  5EWV A;  5HQ7 A;  5EWH A;  4TS8 A;  4HXN A;  5BT4 A;  4CUT A;  5JWM A;  2RNX A;  5DKH A;  1N72 A;  5IG6 A;  5A5R A;  3S92 A;  5D0C A;  3SVH A;  4YYH A;  4O75 A;  4BW3 A;  5FE4 A;  1JSP B;  3K2J A;  4NXJ A;  3LXJ A;  4J0R A;  5DKC A;  2L85 A;  4YBM A;  5C89 A;  4IOQ A;  4CFL A;  3TLP A;  4CUS A;  4HXR A;  4X2I A;  4NR9 A;  4LRG A;  4KV4 A;  5DW2 A;  3SVG A;  3P1E A;  3FKM X;  5CUC A;  4Y03 A;  5FB1 A;  4O7F A;  5K29 A;  4NR7 A;  5FE1 A;  5DYU A;  5EK9 A;  5FFW A;  4HBV A;  5FG5 A;  3LQH A;  4Z1S A;  4BHW A;  4LC2 A;  5F63 A;  5D25 A;  5FE9 A;  5CGP A;  2R0V A;  3O33 A;  4QSX A;  3Q2E A;  4YAB A;  4QSS A;  4MR5 A;  2G4A A;  4HXP A;  4QEW A;  5HEL A;  5IGL A;  4XY9 A;  5F60 A;  4NUD A;  1JM4 B;  3U5P A;  4O7A A;  4IR4 A;  5CY9 A;  2YEL A;  4O7E A;  4HXK A;  5C87 A;  3U5M A;  4NR4 A;  2E7N A;  5E9L A;  4QC3 A;  2YYN A;  3ONI A;  2RNW A;  4QC1 A;  2DKW A;  2YEM A;  4OGI A;  5EP7 A;  4YY4 A;  5DKD A;  3AAD A;  3MB3 A;  4YYI A;  4LZR A;  5FDZ A;  5A81 A;  5TB6 A;  3IU6 A;  5LVR A;  4HBX A;  4YH3 A;  4YAX A;  5L8T A;  5H1U A;  4CLB A;  5KTW A;  3ZYU A;  4HBY A;  5HFR A;  5CQ8 A;  4MEP A;  3HMH A;  5F36 A;  4WHW A;  5CQ3 A;  2MJV B;  4N4H A;  4CUU A;  2RS9 B;  5A7C A;  4QEV A;  4TZ8 A;  4C67 A;  4QEU A;  5F3A A;  5H85 A;  5E3G A;  5ETD A;  5HRX A;  3O37 A;  5DFD A;  4Z1Q A;  5IGK A;  4IOO A;  4YBT A;  4LDF A;  5CQA A;  4QNS A;  2DVQ A;  5I80 A;  4LYS A;  5CUG A;  5EQ1 A;  5AMF A;  5FG6 A;  3P1C A;  4QR3 A;  4ALG A;  4IR3 A;  2E7O A;  5CQT A;  5F25 A;  5I7X A;  4F3I A;  4PCI A;  2RI7 A;  5D3L A;  4NUE A;  5F1H A;  5C7N A;  5I89 A;  5I88 A;  2YQD A;  4QSP A;  2I8N A;  4Z6H A;  5FE2 A;  4QBM A;  4QYL A;  5LJ0 A;  5I7Y A;  5HQ5 A;  3MUL A;  5CRM A;  4TT6 A;  3G0J A;  5COI A;  5FE8 A;  4UYF B;  4YC9 A;  4QSU A;  3UW9 A;  2F6J A;  5CUA A;  4MR3 A;  4UIY A;  5D3S A;  3IU5 A;  3HMF A;  3LQI A;  5E9M A;  2R0Y A;  5F2P A;  5LKZ A;  5FE5 A;  3P5O A;  4XYA A;  4TTE A;  3U5O A;  4KCX A;  4A9I A;  5C8G A;  3Q2F A;  5E73 A;  4LYW A;  5BT3 A;  5A5S A;  3QZS A;  4IOR A;  5FFV A;  2LSP B;  4BW1 A;  4FLP A;  4N4I A;  4NRC A;  4LZ2 A;  4UYH A;  2D82 A;  2N9G A;  5HFQ A;  4TU6 A;  4UYD A;  4YY6 A;  4HXO A;  4BJX A;  4WHU A;  2RFJ A;  4J0S A;  4A9O A;  4QSV A;  4UIV A;  5E9V A;  1X0J A;  2D9E A;  5HQ6 A;  5D3P A;  4BW2 A;  4YBS A; 
#chains in the Genus database with same CATH topology
 5FH7 A;  4AKG A;  5II1 A;  5A5O A;  5JI8 A;  2YDW A;  4IR6 A;  5EU1 A;  5KO4 A;  4QSR A;  3ERR A;  5DYA A;  5DBM A;  5A5P A;  2DVV A;  4Q0N A;  5FH6 A;  2YW5 A;  4LYI A;  4NUC A;  4XUA A;  4A9E A;  5ENF A;  5KTX A;  3DAI A;  4CL9 A;  4A9K A;  5EPB A;  1EQF A;  4HXM A;  2R10 A;  4OGJ A;  5II2 A;  5FG4 A;  4BW4 A;  4TT2 A;  1WUM A;  2NXB A;  4QSW A;  4A9L A;  5D3H A;  4PKL A;  5FE3 A;  4Q0O A;  4O71 A;  3O35 A;  4O74 A;  3JVJ A;  4NYW A;  2GRC A;  4NR6 A;  5E7D A;  3I3J A;  3P1F A;  3UVX A;  3UVY A;  5KU3 A;  5CQ4 A;  5KHM A;  3UV5 A;  2H60 A;  4NYX A;  4UIW A;  4N4F A;  5HEM A;  3P1D A;  5CPE A;  1WUG A;  5EI4 A;  5ETB A;  2KTB B;  5D3T A;  4NR8 A;  4MEN A;  5EIC A;  4YYD A;  3MUK A;  3LQJ A;  5FE7 A;  5A82 A;  4QUU A;  5G4S A;  5DYC A;  4IR5 A;  3UV2 A;  5I29 A;  5AD3 A;  5TCM A;  3JVM A;  5L97 A;  5H1V A;  4AKH A;  4UIZ A;  4C66 A;  4XUB A;  4NQN A;  5FB0 A;  5E9I A;  3U5N A;  5E9Y A;  3LJW A;  5F61 A;  5EWC A;  5DFB A;  1F68 A;  5IBN A;  5ENB A;  5DX4 A;  4WIV A;  4PCE A;  5EWW A;  4UYG A;  3VKH A;  3SVF A;  2L5E A;  5CU8 A;  5I86 A;  4MEQ A;  4TZ2 A;  5FE0 A;  5ENI A;  4J3I A;  5CTL A;  4O7C A;  5LJ1 A;  5EA1 A;  2FSA A;  5F62 A;  5A5Q A;  4NRA A;  3AQA A;  4TT4 A;  2DAT A;  5DW1 A;  4O78 A;  5E3D A;  3D7C A;  4CUP A;  5EIS A;  4O77 A;  5I83 A;  4GPJ A;  4A9F A;  4UIX A;  3JVK A;  3QZV A;  2DVS A;  4ZC9 A;  5FFY A;  5LKT A;  4J1P A;  5EVA A;  4PTB A;  5E0R A;  5EM3 A;  5A83 A;  4NR5 A;  5CUE A;  3O34 A;  5I40 A;  2WP2 A;  4MR6 A;  4A9J A;  5D3R A;  4HBW A;  5ENC A;  5A85 A;  2OSS A;  4YAT A;  3UV4 A;  2RO1 A;  3MXF A;  4NYV A;  5LUU A;  4YK0 A;  3DWY A;  5ENG A;  2WP1 A;  5EPS A;  4QST A;  4TU4 A;  4DON A;  4CUR A;  5HM0 A;  4RVR A;  5CRZ A;  5DY7 A;  4N4G A;  5H1T A;  4O72 A;  4QYD A;  3UVW A;  4YH4 A;  5KTU A;  5CUB A;  5BT5 A;  2OUO A;  5LKU A;  4UYE A;  5DLX A;  5L96 A;  4OUF A;  5HRV A;  4QUT A;  2EJN A;  5D3N A;  3HME A;  2RNY A;  5CQ5 A;  5IGN A;  4N3W A;  2DWW A;  5LJ2 A;  4Z93 A;  3UVD A;  2L84 A;  5L8U A;  5J0D A;  4YAD A;  4O76 A;  5IID A;  4UIT A;  5EPR A;  4HXS A;  1ZKR A;  4TYL A;  5CP5 A;  5EWD A;  3U5K A;  5DFC A;  3JVL A;  4QZS A;  4NQM A;  4YYG A;  4NS5 A;  2R0S A;  5DYX A;  4LZS A;  3S91 A;  4HXL A;  4NRB A;  5CUD A;  2YEK A;  4QR5 A;  5HCL A;  5G4R A;  3RCW A;  4E96 A;  5HEN A;  4PY6 A;  4CUQ A;  3O36 A;  2I7K A;  5LVQ A;  4YYK A;  4YYJ A;  2E3K A;  5LKX A;  3QZT A;  5IGM A;  4ZW1 A;  4XY8 A;  3G0L A;  1ZS5 A;  4QB3 A;  4UYF A;  4A9H A;  4CFK A;  5A5N A;  3NXB A;  5CQ7 A;  4MEO A;  4YYM A;  5CS8 A;  5E9K A;  4YYN A;  5F5Z A;  5HJC A;  3GG3 A;  4LR6 A;  5AME A;  4AKN A;  2F6N A;  4UIU A;  5CZG A;  4QR4 A;  5CQ6 A;  5I1Q A;  3MQM A;  4Z6I A;  4MR4 A;  4KV1 A;  4ZQL A;  4O70 A;  3U5J A;  4O7B A;  5D24 A;  5CFW A;  5D26 A;  5HRW A;  4ALH A;  5L99 A;  5FBX A;  5ENJ A;  5ENE A;  5AD2 A;  4TQN A;  3MB4 A;  5DLZ A;  4PS5 A;  5D7X A;  2OO1 A;  5HLS A;  5F1L A;  3U5L A;  2DVR A;  4QSQ A;  5EV9 A;  5FE6 A;  4A9N A;  4A9M A;  5D3J A;  5L98 A;  5FH8 A;  5C85 A;  5EGU A;  1E6I A;  5ENH A;  4QY4 A;  5ACY A;  5C4Q A;  5E74 A;  5EWV A;  5HQ7 A;  5EWH A;  4TS8 A;  4HXN A;  5BT4 A;  4CUT A;  5JWM A;  2RNX A;  5DKH A;  1N72 A;  5IG6 A;  5A5R A;  3S92 A;  5D0C A;  3SVH A;  4YYH A;  4O75 A;  4BW3 A;  5FE4 A;  1JSP B;  3K2J A;  3D1B A;  4NXJ A;  3LXJ A;  4J0R A;  5DKC A;  2L85 A;  4YBM A;  5C89 A;  4IOQ A;  4CFL A;  3TLP A;  4CUS A;  4HXR A;  4X2I A;  4NR9 A;  4LRG A;  4KV4 A;  5DW2 A;  3SVG A;  3P1E A;  3FKM X;  5CUC A;  4Y03 A;  5FB1 A;  4O7F A;  5K29 A;  4NR7 A;  5FE1 A;  4AKI A;  5DYU A;  5EK9 A;  5FFW A;  4HBV A;  5FG5 A;  3LQH A;  4Z1S A;  4AI6 A;  4BHW A;  4LC2 A;  5F63 A;  5D25 A;  5FE9 A;  5CGP A;  2R0V A;  3O33 A;  4QSX A;  3Q2E A;  4YAB A;  4QSS A;  4MR5 A;  2G4A A;  4HXP A;  4QEW A;  5HEL A;  5IGL A;  4XY9 A;  5F60 A;  1PUO A;  4NUD A;  1JM4 B;  3U5P A;  4O7A A;  4IR4 A;  5CY9 A;  2YEL A;  4O7E A;  4HXK A;  5C87 A;  3U5M A;  4NR4 A;  2E7N A;  5E9L A;  4QC3 A;  2YYN A;  3ONI A;  2RNW A;  4QC1 A;  2DKW A;  2YEM A;  4OGI A;  5EP7 A;  4YY4 A;  5DKD A;  3AAD A;  3MB3 A;  4YYI A;  4LZR A;  5FDZ A;  5A81 A;  5TB6 A;  3IU6 A;  5LVR A;  4HBX A;  4YH3 A;  4YAX A;  5L8T A;  5H1U A;  4CLB A;  5KTW A;  3ZYU A;  4HBY A;  5HFR A;  5CQ8 A;  4MEP A;  3HMH A;  5F36 A;  4WHW A;  5CQ3 A;  2MJV B;  4N4H A;  4CUU A;  2RS9 B;  5A7C A;  4QEV A;  4TZ8 A;  4C67 A;  4QEU A;  5F3A A;  5H85 A;  5E3G A;  5ETD A;  5HRX A;  3O37 A;  5DFD A;  4Z1Q A;  5IGK A;  4IOO A;  4YBT A;  4LDF A;  5CQA A;  4QNS A;  2DVQ A;  5I80 A;  4LYS A;  5CUG A;  5EQ1 A;  5AMF A;  5FG6 A;  3P1C A;  4QR3 A;  4ALG A;  4IR3 A;  2E7O A;  5CQT A;  5F25 A;  5I7X A;  4F3I A;  4PCI A;  2RI7 A;  5D3L A;  3VKG A;  4NUE A;  5F1H A;  5C7N A;  5I89 A;  5I88 A;  2YQD A;  4QSP A;  2I8N A;  4Z6H A;  5FE2 A;  4QBM A;  4QYL A;  5LJ0 A;  5I7Y A;  5HQ5 A;  3MUL A;  5CRM A;  4TT6 A;  3G0J A;  5COI A;  5FE8 A;  4UYF B;  4YC9 A;  4QSU A;  3UW9 A;  2F6J A;  5CUA A;  4MR3 A;  4UIY A;  5D3S A;  3IU5 A;  3HMF A;  3LQI A;  5E9M A;  2R0Y A;  5F2P A;  5LKZ A;  5FE5 A;  3P5O A;  4XYA A;  4TTE A;  3U5O A;  4KCX A;  4A9I A;  5C8G A;  3Q2F A;  5E73 A;  4LYW A;  3D1D A;  5BT3 A;  5A5S A;  3QZS A;  4IOR A;  5FFV A;  2LSP B;  4BW1 A;  4FLP A;  4N4I A;  4NRC A;  4LZ2 A;  4UYH A;  2D82 A;  2N9G A;  5HFQ A;  4TU6 A;  4UYD A;  4YY6 A;  4HXO A;  4BJX A;  4WHU A;  2RFJ A;  4J0S A;  4A9O A;  4QSV A;  4UIV A;  5E9V A;  1X0J A;  2D9E A;  5HQ6 A;  5D3P A;  4BW2 A;  4YBS A; 
#chains in the Genus database with same CATH homology
 5FH7 A;  5II1 A;  5A5O A;  5JI8 A;  2YDW A;  4IR6 A;  5EU1 A;  5KO4 A;  4QSR A;  5DYA A;  5DBM A;  5A5P A;  2DVV A;  4Q0N A;  5FH6 A;  2YW5 A;  4LYI A;  4NUC A;  4XUA A;  4A9E A;  5ENF A;  5KTX A;  3DAI A;  4CL9 A;  4A9K A;  5EPB A;  1EQF A;  4HXM A;  2R10 A;  4OGJ A;  5II2 A;  5FG4 A;  4BW4 A;  4TT2 A;  1WUM A;  2NXB A;  4QSW A;  4A9L A;  5D3H A;  4PKL A;  5FE3 A;  4Q0O A;  4O71 A;  3O35 A;  4O74 A;  3JVJ A;  4NYW A;  2GRC A;  4NR6 A;  5E7D A;  3I3J A;  3P1F A;  3UVX A;  3UVY A;  5KU3 A;  5CQ4 A;  5KHM A;  3UV5 A;  2H60 A;  4NYX A;  4UIW A;  4N4F A;  5HEM A;  3P1D A;  5CPE A;  1WUG A;  5EI4 A;  5ETB A;  2KTB B;  5D3T A;  4NR8 A;  4MEN A;  5EIC A;  4YYD A;  3MUK A;  3LQJ A;  5FE7 A;  5A82 A;  4QUU A;  5G4S A;  5DYC A;  4IR5 A;  3UV2 A;  5I29 A;  5AD3 A;  5TCM A;  3JVM A;  5L97 A;  5H1V A;  4UIZ A;  4C66 A;  4XUB A;  4NQN A;  5FB0 A;  5E9I A;  3U5N A;  5E9Y A;  3LJW A;  5F61 A;  5EWC A;  5DFB A;  1F68 A;  5IBN A;  5ENB A;  5DX4 A;  4WIV A;  4PCE A;  5EWW A;  4UYG A;  3SVF A;  2L5E A;  5CU8 A;  5I86 A;  4MEQ A;  4TZ2 A;  5FE0 A;  5ENI A;  4J3I A;  5CTL A;  4O7C A;  5LJ1 A;  5EA1 A;  2FSA A;  5F62 A;  5A5Q A;  4NRA A;  3AQA A;  4TT4 A;  2DAT A;  5DW1 A;  4O78 A;  5E3D A;  3D7C A;  4CUP A;  5EIS A;  4O77 A;  5I83 A;  4GPJ A;  4A9F A;  4UIX A;  3JVK A;  3QZV A;  2DVS A;  4ZC9 A;  5FFY A;  5LKT A;  4J1P A;  5EVA A;  4PTB A;  5E0R A;  5EM3 A;  5A83 A;  4NR5 A;  5CUE A;  3O34 A;  5I40 A;  2WP2 A;  4MR6 A;  4A9J A;  5D3R A;  4HBW A;  5ENC A;  5A85 A;  2OSS A;  4YAT A;  3UV4 A;  2RO1 A;  3MXF A;  4NYV A;  5LUU A;  4YK0 A;  3DWY A;  5ENG A;  2WP1 A;  5EPS A;  4QST A;  4TU4 A;  4DON A;  4CUR A;  5HM0 A;  4RVR A;  5CRZ A;  5DY7 A;  4N4G A;  5H1T A;  4O72 A;  4QYD A;  3UVW A;  4YH4 A;  5KTU A;  5CUB A;  5BT5 A;  2OUO A;  5LKU A;  4UYE A;  5DLX A;  5L96 A;  4OUF A;  5HRV A;  4QUT A;  5D3N A;  3HME A;  2RNY A;  5CQ5 A;  5IGN A;  4N3W A;  2DWW A;  5LJ2 A;  4Z93 A;  3UVD A;  2L84 A;  5L8U A;  5J0D A;  4YAD A;  4O76 A;  5IID A;  4UIT A;  5EPR A;  4HXS A;  4TYL A;  5CP5 A;  5EWD A;  3U5K A;  5DFC A;  3JVL A;  4QZS A;  4NQM A;  4YYG A;  4NS5 A;  2R0S A;  5DYX A;  4LZS A;  3S91 A;  4HXL A;  4NRB A;  5CUD A;  2YEK A;  4QR5 A;  5HCL A;  5G4R A;  3RCW A;  4E96 A;  5HEN A;  4PY6 A;  4CUQ A;  3O36 A;  2I7K A;  5LVQ A;  4YYK A;  4YYJ A;  2E3K A;  5LKX A;  3QZT A;  5IGM A;  4ZW1 A;  4XY8 A;  3G0L A;  1ZS5 A;  4QB3 A;  4UYF A;  4A9H A;  4CFK A;  5A5N A;  3NXB A;  5CQ7 A;  4MEO A;  4YYM A;  5CS8 A;  5E9K A;  4YYN A;  5F5Z A;  5HJC A;  3GG3 A;  4LR6 A;  5AME A;  4AKN A;  2F6N A;  4UIU A;  5CZG A;  4QR4 A;  5CQ6 A;  5I1Q A;  3MQM A;  4Z6I A;  4MR4 A;  4KV1 A;  4ZQL A;  4O70 A;  3U5J A;  4O7B A;  5D24 A;  5CFW A;  5D26 A;  5HRW A;  4ALH A;  5L99 A;  5FBX A;  5ENJ A;  5ENE A;  5AD2 A;  4TQN A;  3MB4 A;  5DLZ A;  4PS5 A;  5D7X A;  2OO1 A;  5HLS A;  5F1L A;  3U5L A;  2DVR A;  4QSQ A;  5EV9 A;  5FE6 A;  4A9N A;  4A9M A;  5D3J A;  5L98 A;  5FH8 A;  5C85 A;  5EGU A;  1E6I A;  5ENH A;  4QY4 A;  5ACY A;  5C4Q A;  5E74 A;  5EWV A;  5HQ7 A;  5EWH A;  4TS8 A;  4HXN A;  5BT4 A;  4CUT A;  5JWM A;  2RNX A;  5DKH A;  1N72 A;  5IG6 A;  5A5R A;  3S92 A;  5D0C A;  3SVH A;  4YYH A;  4O75 A;  4BW3 A;  5FE4 A;  1JSP B;  3K2J A;  4NXJ A;  3LXJ A;  4J0R A;  5DKC A;  2L85 A;  4YBM A;  5C89 A;  4IOQ A;  4CFL A;  3TLP A;  4CUS A;  4HXR A;  4X2I A;  4NR9 A;  4LRG A;  4KV4 A;  5DW2 A;  3SVG A;  3P1E A;  3FKM X;  5CUC A;  4Y03 A;  5FB1 A;  4O7F A;  5K29 A;  4NR7 A;  5FE1 A;  5DYU A;  5EK9 A;  5FFW A;  4HBV A;  5FG5 A;  3LQH A;  4Z1S A;  4BHW A;  4LC2 A;  5F63 A;  5D25 A;  5FE9 A;  5CGP A;  2R0V A;  3O33 A;  4QSX A;  3Q2E A;  4YAB A;  4QSS A;  4MR5 A;  2G4A A;  4HXP A;  4QEW A;  5HEL A;  5IGL A;  4XY9 A;  5F60 A;  4NUD A;  1JM4 B;  3U5P A;  4O7A A;  4IR4 A;  5CY9 A;  2YEL A;  4O7E A;  4HXK A;  5C87 A;  3U5M A;  4NR4 A;  2E7N A;  5E9L A;  4QC3 A;  2YYN A;  3ONI A;  2RNW A;  4QC1 A;  2DKW A;  2YEM A;  4OGI A;  5EP7 A;  4YY4 A;  5DKD A;  3AAD A;  3MB3 A;  4YYI A;  4LZR A;  5FDZ A;  5A81 A;  5TB6 A;  3IU6 A;  5LVR A;  4HBX A;  4YH3 A;  4YAX A;  5L8T A;  5H1U A;  4CLB A;  5KTW A;  3ZYU A;  4HBY A;  5HFR A;  5CQ8 A;  4MEP A;  3HMH A;  5F36 A;  4WHW A;  5CQ3 A;  2MJV B;  4N4H A;  4CUU A;  2RS9 B;  5A7C A;  4QEV A;  4TZ8 A;  4C67 A;  4QEU A;  5F3A A;  5H85 A;  5E3G A;  5ETD A;  5HRX A;  3O37 A;  5DFD A;  4Z1Q A;  5IGK A;  4IOO A;  4YBT A;  4LDF A;  5CQA A;  4QNS A;  2DVQ A;  5I80 A;  4LYS A;  5CUG A;  5EQ1 A;  5AMF A;  5FG6 A;  3P1C A;  4QR3 A;  4ALG A;  4IR3 A;  2E7O A;  5CQT A;  5F25 A;  5I7X A;  4F3I A;  4PCI A;  2RI7 A;  5D3L A;  4NUE A;  5F1H A;  5C7N A;  5I89 A;  5I88 A;  2YQD A;  4QSP A;  2I8N A;  4Z6H A;  5FE2 A;  4QBM A;  4QYL A;  5LJ0 A;  5I7Y A;  5HQ5 A;  3MUL A;  5CRM A;  4TT6 A;  3G0J A;  5COI A;  5FE8 A;  4UYF B;  4YC9 A;  4QSU A;  3UW9 A;  2F6J A;  5CUA A;  4MR3 A;  4UIY A;  5D3S A;  3IU5 A;  3HMF A;  3LQI A;  5E9M A;  2R0Y A;  5F2P A;  5LKZ A;  5FE5 A;  3P5O A;  4XYA A;  4TTE A;  3U5O A;  4KCX A;  4A9I A;  5C8G A;  3Q2F A;  5E73 A;  4LYW A;  5BT3 A;  5A5S A;  3QZS A;  4IOR A;  5FFV A;  2LSP B;  4BW1 A;  4FLP A;  4N4I A;  4NRC A;  4LZ2 A;  4UYH A;  2D82 A;  2N9G A;  5HFQ A;  4TU6 A;  4UYD A;  4YY6 A;  4HXO A;  4BJX A;  4WHU A;  2RFJ A;  4J0S A;  4A9O A;  4QSV A;  4UIV A;  5E9V A;  1X0J A;  2D9E A;  5HQ6 A;  5D3P A;  4BW2 A;  4YBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...