5CQTA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
HHLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5cqtA01
3LQHA 5F25A 5BT4A 4NYXA 4LC2A 5LJ2A 4XY9A 4YC9A 5EGUA 5HRWA 4QEWA 4ZQLA 4O7BA 2DKWA 4LDFA 4QR4A 5F61A 4A9JA 5FE5A 2D82A 5C7NA 4QUTA 5A5PA 4O7EA 4UIZA 5KTWA 3UW9A 4HBYA 4YYHA 4QUUA 5D3HA 5I7XA 2RS9B 3QZTA 5FG4A 5ENHA 4LZSA 4TYLA 5ENIA 4BW3A 4UIYA 5C87A 2I7KA 5FE7A 3U5NA 4NR5A 5HLSA 3O33A 5AMFA 5D24A 5I40A 4MR3A 4Q0OA 5ENFA 1EQFA 3GG3A 4PTBA 4O70A 4O77A 2YQDA 5IGLA 5CU8A 4UYEA 5CRMA 4NUEA 4IR3A 4YADA 2R0YA 5CQ4A 1WUMA 4XY8A 4O76A 4XUBA 4NRAA 5EU1A 5CY9A 1F68A 2G4AA 5HFRA 5I80A 5EWWA 5DKCA 5EPBA 4HXMA 4KV4A 5DYCA 5IGKA 3JVLA 5DFCA 3P5OA 5A5SA 4HBXA 4NQMA 5DY7A 2L5EA 2WP1A 5EP7A 4Z6HA 4YAXA 4YYDA 2DATA 4QYDA 4CFLA 2MJVB 5DYXA 4QSXA 5HENA 5HCLA 4N3WA 5J0DA 5FB1A 5EWHA 2YELA 5DLZA 5A5NA 5F2PA 3S92A 3UV4A 1N72A 4LR6A 4YYMA 4HBVA 4TT2A 5EI4A 4IOOA 2NXBA 5FE2A 4NR4A 2LSPB 4CUTA 5CTLA 5D3RA 5CS8A 4QSTA 4YY4A 2OSSA 4NR9A 5HQ6A 4O78A 3MQMA 2GRCA 4UYFA 5DW2A 5HJCA 3UVDA 2RO1A 5FG5A 4LYSA 3MULA 2F6JA 3AADA 2WP2A 3P1FA 5A82A 4RVRA 3LQJA 4TZ2A 4WHUA 1E6IA 5DBMA 5ENBA 5CFWA 2DVQA 5JI8A 1WUGA 4CUSA 4OGJA 4HBWA 4QB3A 5FH7A 4O7CA 5CRZA 4LRGA 5D3TA 5CGPA 5CUGA 3QZSA 4KCXA 4QSRA 4A9FA 5D3PA 3LXJA 5G4SA 4CFKA 5IG6A 2FSAA 3DWYA 5EWCA 5E9YA 2R0VA 5FB0A 4QZSA 5D26A 5H1UA 3P1EA 5A5RA 5F1HA 5ETBA 5KU3A 3QZVA 4ALGA 4NRBA 4UYFB 4UIVA 2YW5A 4PCEA 5LUUA 4LYIA 5D25A 4XYAA 3AQAA 5IIDA 4LYWA 5COIA 5ENCA 4HXRA 5I83A 2I8NA 2H60A 5LVQA 5FBXA 5C85A 2OO1A 4IR5A 3IU6A 5ETDA 4YBTA 5ENJA 4OGIA 4O74A 1X0JA 4A9HA 5E7DA 5BT5A 4PCIA 4NR6A 4Z1SA 4QSSA 5FE0A 4WHWA 5FG6A 4BHWA 5EM3A 4UIXA 2L84A 4KV1A 5D0CA 5HFQA 2D9EA 5ENGA 2KTBB 4O7FA 4CL9A 4N4GA 4YYNA 5KTXA 4CUQA 4Y03A 3SVHA 4XUAA 4IOQA 4YBMA 5KHMA 5D3SA 5F1LA 5E3GA 5DKDA 5TB6A 4A9OA 3HMFA 5L96A 5EA1A 4TT4A 5EQ1A 3HMEA 4N4HA 4MEOA 3ONIA 4UYDA 5HQ5A 2YEMA 5E9IA 5A81A 4Q0NA 5II2A 4TZ8A 4A9KA 4QNSA 3U5MA 5FH6A 5A83A 5FFWA 3U5KA 2RNYA 4J1PA 5CQAA 3RCWA 2OUOA 2RNXA 4C67A 5FFVA 4Z1QA 5D3JA 4QC1A 5DW1A 4YABA 5H85A 5L97A 1JM4B 5DFDA 5EPSA 4A9LA 5FH8A 4CURA 4UIUA 4CLBA 3FKMX 5EPRA 5I88A 4A9NA 4TT6A 4A9IA 4Z6IA 4TU4A 3TLPA 5FE1A 5H1TA 3UVWA 5EVAA 5L8TA 4TU6A 5DKHA 5BT3A 5AD2A 4CUUA 2L85A 4YYKA 4LZRA 5EWVA 5DX4A 4QSPA 5L99A 4QR3A 4DONA 4UIWA 3UV5A 5C8GA 5FE4A 5DYAA 5CUCA 4QC3A 5DFBA 5CQ7A 5F36A 4A9MA 5AD3A 5K29A 2E3KA 5CPEA 3MUKA 4PY6A 4N4IA 5H1VA 4MR5A 5CQ8A 5I1QA 3DAIA 4NR8A 5HQ7A 4BW4A 4YYIA 5IGNA 2R0SA 3K2JA 4TS8A 4PS5A 5I7YA 5AMEA 4HXLA 5CQTA 4TQNA 4IR4A 5A7CA 4IORA 5HELA 4O72A 3MB4A 5FFYA 4NXJA 3U5LA 3P1DA 2DVRA 4UITA 5A5QA 2YDWA 4Z93A 5LVRA 5LKTA 3ZYUA 4YBSA 4HXKA 4GPJA 5IBNA 4YY6A 5FDZA 5EK9A 5F3AA 5HRVA 4HXNA 5L8UA 5L98A 5CQ3A 5E3DA 3O35A 5E9LA 4O71A 4QSQA 5CZGA 4CUPA 3HMHA 3IU5A 4QBMA 5LKZA 4E96A 5LJ0A 4X2IA 4QSUA 5EV9A 4MR4A 4NS5A 4WIVA 4NQNA 5EICA 5HEMA 2YEKA 5F5ZA 4HXOA 3MB3A 5LJ1A 2RFJA 3SVFA 1ZS5A 3NXBA 2DWWA 3LQIA 5A85A 5DYUA 4HXPA 4HXSA 5FE9A 5ENEA 3Q2EA 5JWMA 4QSVA 5A5OA 4A9EA 5CUBA 4O7AA 4ALHA 4QEUA 4TTEA 4YH4A 5E9MA 5LKXA 3P1CA 5FE6A 5I86A 5CP5A 3JVKA 5HM0A 3MXFA 3UVYA 5IGMA 4NR7A 3S91A 5TCMA 4NYWA 3Q2FA 5CUDA 3U5PA 4NUDA 5E9KA 4YATA 5KO4A 2DVVA 4O75A 4YYJA 4BJXA 5CQ5A 3JVJA 4UYGA 3O34A 5E73A 3O37A 4QSWA 5D3NA 2E7NA 3U5JA 3UVXA 3O36A 4MEPA 1JSPB 5I89A 2RI7A 5II1A 4QEVA 5LKUA 4LZ2A 4MENA 5KTUA 4NYVA 4YYGA 5CUEA 3D7CA 5E0RA 3JVMA 5G4RA 5D7XA 5DLXA 4ZW1A 2E7OA 5E74A 5FE3A 4BW1A 5F60A 5FE8A 2R10A 5F63A 4YH3A 2DVSA 4NRCA 3UV2A 4IR6A 4NUCA 5I29A 2N9GA 5D3LA 4PKLA 5EISA 4BW2A 4F3IA 5ACYA 4C66A 5CQ6A 4MEQA 5F62A 4AKNA 2F6NA 5CUAA 4MR6A 3G0JA 3I3JA 5HRXA 4N4FA 3SVGA 2RNWA 4QYLA 5C4QA 4OUFA 4QY4A 5E9VA 2YYNA 4FLPA 5C89A 4J0RA 3G0LA 5EWDA 4ZC9A 3LJWA 4YK0A 4QR5A 4J3IA 4UYHA 3U5OA 4J0SA
chains in the Genus database with same CATH superfamily
3LQHA 5F25A 5BT4A 4NYXA 4LC2A 5LJ2A 4XY9A 4YC9A 5EGUA 5HRWA 4QEWA 4ZQLA 4O7BA 2DKWA 4LDFA 4QR4A 5F61A 4A9JA 5FE5A 2D82A 5C7NA 4QUTA 5A5PA 4O7EA 4UIZA 5KTWA 3UW9A 4HBYA 4YYHA 4QUUA 5D3HA 5I7XA 2RS9B 3QZTA 5FG4A 5ENHA 4LZSA 4TYLA 5ENIA 4BW3A 4UIYA 5C87A 2I7KA 5FE7A 3U5NA 4NR5A 5HLSA 3O33A 5AMFA 5D24A 5I40A 4MR3A 4Q0OA 5ENFA 1EQFA 3GG3A 4PTBA 4O70A 4O77A 2YQDA 5IGLA 5CU8A 4UYEA 5CRMA 4NUEA 4IR3A 4YADA 2R0YA 5CQ4A 1WUMA 4XY8A 4O76A 4XUBA 4NRAA 5EU1A 5CY9A 1F68A 2G4AA 5HFRA 5I80A 5EWWA 5DKCA 5EPBA 4HXMA 4KV4A 5DYCA 5IGKA 3JVLA 5DFCA 3P5OA 5A5SA 4HBXA 4NQMA 5DY7A 2L5EA 2WP1A 5EP7A 4Z6HA 4YAXA 4YYDA 2DATA 4QYDA 4CFLA 2MJVB 5DYXA 4QSXA 5HENA 5HCLA 4N3WA 5J0DA 5FB1A 1PUOA 5EWHA 2YELA 5DLZA 5A5NA 5F2PA 3S92A 3UV4A 1N72A 4LR6A 4YYMA 4HBVA 4TT2A 5EI4A 4IOOA 2NXBA 5FE2A 4NR4A 2LSPB 4CUTA 5CTLA 5D3RA 5CS8A 4QSTA 4YY4A 2OSSA 4NR9A 5HQ6A 4O78A 3MQMA 2GRCA 4UYFA 5DW2A 5HJCA 3UVDA 2RO1A 5FG5A 4LYSA 3MULA 2F6JA 3AADA 2WP2A 3P1FA 5A82A 4RVRA 3LQJA 4TZ2A 4WHUA 1E6IA 5DBMA 5ENBA 5CFWA 2DVQA 5JI8A 1WUGA 4CUSA 4OGJA 4HBWA 4QB3A 5FH7A 4O7CA 5CRZA 4LRGA 5D3TA 5CGPA 5CUGA 3QZSA 4KCXA 4QSRA 4A9FA 5D3PA 3LXJA 5G4SA 4CFKA 5IG6A 2FSAA 3DWYA 5EWCA 5E9YA 2R0VA 5FB0A 4QZSA 4AKIA 5D26A 5H1UA 3P1EA 5A5RA 5F1HA 5ETBA 5KU3A 3QZVA 4ALGA 4NRBA 4UYFB 4UIVA 2YW5A 4PCEA 5LUUA 4LYIA 5D25A 4XYAA 3AQAA 5IIDA 4LYWA 5COIA 5ENCA 4HXRA 4AKHA 4AKGA 5I83A 2I8NA 2H60A 5LVQA 5FBXA 5C85A 2OO1A 4IR5A 3VKHA 3IU6A 5ETDA 4YBTA 5ENJA 4OGIA 4O74A 1X0JA 4A9HA 5E7DA 5BT5A 4PCIA 4NR6A 4Z1SA 4QSSA 5FE0A 4WHWA 5FG6A 4BHWA 5EM3A 4UIXA 2L84A 4KV1A 5D0CA 5HFQA 2D9EA 5ENGA 2KTBB 4O7FA 4CL9A 4N4GA 4YYNA 5KTXA 4CUQA 4Y03A 3ERRA 3SVHA 4XUAA 4IOQA 4YBMA 5KHMA 5D3SA 5F1LA 5E3GA 5DKDA 5TB6A 4A9OA 3HMFA 5L96A 5EA1A 4TT4A 5EQ1A 3HMEA 4N4HA 4MEOA 3ONIA 4UYDA 5HQ5A 2YEMA 5E9IA 5A81A 4Q0NA 5II2A 4TZ8A 4A9KA 4QNSA 3U5MA 5FH6A 5A83A 5FFWA 3U5KA 2RNYA 4J1PA 5CQAA 3RCWA 2OUOA 2RNXA 4C67A 5FFVA 4Z1QA 5D3JA 4QC1A 5DW1A 4YABA 5H85A 5L97A 1JM4B 5DFDA 5EPSA 4A9LA 5FH8A 4CURA 4UIUA 4CLBA 3FKMX 5EPRA 5I88A 4A9NA 4TT6A 3D1BA 4A9IA 4Z6IA 4TU4A 3TLPA 5FE1A 5H1TA 3UVWA 5EVAA 5L8TA 4TU6A 5DKHA 5BT3A 5AD2A 4CUUA 2L85A 4YYKA 4LZRA 5EWVA 5DX4A 4QSPA 5L99A 4QR3A 4DONA 4UIWA 3UV5A 5C8GA 5FE4A 5DYAA 3VKGA 5CUCA 4QC3A 5DFBA 5CQ7A 5F36A 4A9MA 5AD3A 5K29A 2E3KA 5CPEA 3MUKA 4PY6A 4N4IA 5H1VA 4MR5A 5CQ8A 5I1QA 3DAIA 4NR8A 5HQ7A 4BW4A 4YYIA 5IGNA 2R0SA 3K2JA 4TS8A 4PS5A 5I7YA 5AMEA 4HXLA 5CQTA 4TQNA 4IR4A 5A7CA 4IORA 5HELA 4O72A 3MB4A 5FFYA 4NXJA 3U5LA 3P1DA 2DVRA 4UITA 5A5QA 2YDWA 4Z93A 5LVRA 5LKTA 3ZYUA 4YBSA 4HXKA 4GPJA 5IBNA 4YY6A 5FDZA 5EK9A 5F3AA 5HRVA 4HXNA 5L8UA 5L98A 5CQ3A 5E3DA 3O35A 5E9LA 4O71A 4QSQA 5CZGA 4CUPA 3HMHA 3D1DA 3IU5A 4QBMA 5LKZA 4E96A 5LJ0A 4X2IA 4QSUA 5EV9A 4MR4A 4NS5A 4WIVA 4NQNA 5EICA 5HEMA 2YEKA 5F5ZA 4HXOA 3MB3A 5LJ1A 2RFJA 3SVFA 1ZS5A 3NXBA 2DWWA 3LQIA 5A85A 5DYUA 4HXPA 4HXSA 5FE9A 4AI6A 5ENEA 3Q2EA 5JWMA 4QSVA 5A5OA 4A9EA 5CUBA 4O7AA 4ALHA 4QEUA 4TTEA 4YH4A 5E9MA 5LKXA 3P1CA 5FE6A 5I86A 5CP5A 3JVKA 2EJNA 5HM0A 3MXFA 3UVYA 5IGMA 4NR7A 3S91A 5TCMA 4NYWA 3Q2FA 5CUDA 3U5PA 4NUDA 5E9KA 4YATA 5KO4A 2DVVA 4O75A 4YYJA 4BJXA 5CQ5A 3JVJA 4UYGA 3O34A 5E73A 3O37A 4QSWA 5D3NA 2E7NA 3U5JA 3UVXA 3O36A 4MEPA 1JSPB 5I89A 2RI7A 5II1A 4QEVA 5LKUA 4LZ2A 4MENA 5KTUA 4NYVA 4YYGA 5CUEA 3D7CA 5E0RA 3JVMA 5G4RA 5D7XA 5DLXA 4ZW1A 2E7OA 5E74A 5FE3A 4BW1A 5F60A 5FE8A 2R10A 5F63A 4YH3A 2DVSA 4NRCA 3UV2A 4IR6A 4NUCA 5I29A 2N9GA 5D3LA 4PKLA 5EISA 4BW2A 4F3IA 1ZKRA 5ACYA 4C66A 5CQ6A 4MEQA 5F62A 4AKNA 2F6NA 5CUAA 4MR6A 3G0JA 3I3JA 5HRXA 4N4FA 3SVGA 2RNWA 4QYLA 5C4QA 4OUFA 4QY4A 5E9VA 2YYNA 4FLPA 5C89A 4J0RA 3G0LA 5EWDA 4ZC9A 3LJWA 4YK0A 4QR5A 4J3IA 4UYHA 3U5OA 4J0SA
chains in the Genus database with same CATH topology
3LQHA 5F25A 5BT4A 4NYXA 4LC2A 5LJ2A 4XY9A 4YC9A 5EGUA 5HRWA 4QEWA 4ZQLA 4O7BA 2DKWA 4LDFA 4QR4A 5F61A 4A9JA 5FE5A 2D82A 5C7NA 4QUTA 5A5PA 4O7EA 4UIZA 5KTWA 3UW9A 4HBYA 4YYHA 4QUUA 5D3HA 5I7XA 2RS9B 3QZTA 5FG4A 5ENHA 4LZSA 4TYLA 5ENIA 4BW3A 4UIYA 5C87A 2I7KA 5FE7A 3U5NA 4NR5A 5HLSA 3O33A 5AMFA 5D24A 5I40A 4MR3A 4Q0OA 5ENFA 1EQFA 3GG3A 4PTBA 4O70A 4O77A 2YQDA 5IGLA 5CU8A 4UYEA 5CRMA 4NUEA 4IR3A 4YADA 2R0YA 5CQ4A 1WUMA 4XY8A 4O76A 4XUBA 4NRAA 5EU1A 5CY9A 1F68A 2G4AA 5HFRA 5I80A 5EWWA 5DKCA 5EPBA 4HXMA 4KV4A 5DYCA 5IGKA 3JVLA 5DFCA 3P5OA 5A5SA 4HBXA 4NQMA 5DY7A 2L5EA 2WP1A 5EP7A 4Z6HA 4YAXA 4YYDA 2DATA 4QYDA 4CFLA 2MJVB 5DYXA 4QSXA 5HENA 5HCLA 4N3WA 5J0DA 5FB1A 5EWHA 2YELA 5DLZA 5A5NA 5F2PA 3S92A 3UV4A 1N72A 4LR6A 4YYMA 4HBVA 4TT2A 5EI4A 4IOOA 2NXBA 5FE2A 4NR4A 2LSPB 4CUTA 5CTLA 5D3RA 5CS8A 4QSTA 4YY4A 2OSSA 4NR9A 5HQ6A 4O78A 3MQMA 2GRCA 4UYFA 5DW2A 5HJCA 3UVDA 2RO1A 5FG5A 4LYSA 3MULA 2F6JA 3AADA 2WP2A 3P1FA 5A82A 4RVRA 3LQJA 4TZ2A 4WHUA 1E6IA 5DBMA 5ENBA 5CFWA 2DVQA 5JI8A 1WUGA 4CUSA 4OGJA 4HBWA 4QB3A 5FH7A 4O7CA 5CRZA 4LRGA 5D3TA 5CGPA 5CUGA 3QZSA 4KCXA 4QSRA 4A9FA 5D3PA 3LXJA 5G4SA 4CFKA 5IG6A 2FSAA 3DWYA 5EWCA 5E9YA 2R0VA 5FB0A 4QZSA 5D26A 5H1UA 3P1EA 5A5RA 5F1HA 5ETBA 5KU3A 3QZVA 4ALGA 4NRBA 4UYFB 4UIVA 2YW5A 4PCEA 5LUUA 4LYIA 5D25A 4XYAA 3AQAA 5IIDA 4LYWA 5COIA 5ENCA 4HXRA 5I83A 2I8NA 2H60A 5LVQA 5FBXA 5C85A 2OO1A 4IR5A 3IU6A 5ETDA 4YBTA 5ENJA 4OGIA 4O74A 1X0JA 4A9HA 5E7DA 5BT5A 4PCIA 4NR6A 4Z1SA 4QSSA 5FE0A 4WHWA 5FG6A 4BHWA 5EM3A 4UIXA 2L84A 4KV1A 5D0CA 5HFQA 2D9EA 5ENGA 2KTBB 4O7FA 4CL9A 4N4GA 4YYNA 5KTXA 4CUQA 4Y03A 3SVHA 4XUAA 4IOQA 4YBMA 5KHMA 5D3SA 5F1LA 5E3GA 5DKDA 5TB6A 4A9OA 3HMFA 5L96A 5EA1A 4TT4A 5EQ1A 3HMEA 4N4HA 4MEOA 3ONIA 4UYDA 5HQ5A 2YEMA 5E9IA 5A81A 4Q0NA 5II2A 4TZ8A 4A9KA 4QNSA 3U5MA 5FH6A 5A83A 5FFWA 3U5KA 2RNYA 4J1PA 5CQAA 3RCWA 2OUOA 2RNXA 4C67A 5FFVA 4Z1QA 5D3JA 4QC1A 5DW1A 4YABA 5H85A 5L97A 1JM4B 5DFDA 5EPSA 4A9LA 5FH8A 4CURA 4UIUA 4CLBA 3FKMX 5EPRA 5I88A 4A9NA 4TT6A 4A9IA 4Z6IA 4TU4A 3TLPA 5FE1A 5H1TA 3UVWA 5EVAA 5L8TA 4TU6A 5DKHA 5BT3A 5AD2A 4CUUA 2L85A 4YYKA 4LZRA 5EWVA 5DX4A 4QSPA 5L99A 4QR3A 4DONA 4UIWA 3UV5A 5C8GA 5FE4A 5DYAA 5CUCA 4QC3A 5DFBA 5CQ7A 5F36A 4A9MA 5AD3A 5K29A 2E3KA 5CPEA 3MUKA 4PY6A 4N4IA 5H1VA 4MR5A 5CQ8A 5I1QA 3DAIA 4NR8A 5HQ7A 4BW4A 4YYIA 5IGNA 2R0SA 3K2JA 4TS8A 4PS5A 5I7YA 5AMEA 4HXLA 5CQTA 4TQNA 4IR4A 5A7CA 4IORA 5HELA 4O72A 3MB4A 5FFYA 4NXJA 3U5LA 3P1DA 2DVRA 4UITA 5A5QA 2YDWA 4Z93A 5LVRA 5LKTA 3ZYUA 4YBSA 4HXKA 4GPJA 5IBNA 4YY6A 5FDZA 5EK9A 5F3AA 5HRVA 4HXNA 5L8UA 5L98A 5CQ3A 5E3DA 3O35A 5E9LA 4O71A 4QSQA 5CZGA 4CUPA 3HMHA 3IU5A 4QBMA 5LKZA 4E96A 5LJ0A 4X2IA 4QSUA 5EV9A 4MR4A 4NS5A 4WIVA 4NQNA 5EICA 5HEMA 2YEKA 5F5ZA 4HXOA 3MB3A 5LJ1A 2RFJA 3SVFA 1ZS5A 3NXBA 2DWWA 3LQIA 5A85A 5DYUA 4HXPA 4HXSA 5FE9A 5ENEA 3Q2EA 5JWMA 4QSVA 5A5OA 4A9EA 5CUBA 4O7AA 4ALHA 4QEUA 4TTEA 4YH4A 5E9MA 5LKXA 3P1CA 5FE6A 5I86A 5CP5A 3JVKA 5HM0A 3MXFA 3UVYA 5IGMA 4NR7A 3S91A 5TCMA 4NYWA 3Q2FA 5CUDA 3U5PA 4NUDA 5E9KA 4YATA 5KO4A 2DVVA 4O75A 4YYJA 4BJXA 5CQ5A 3JVJA 4UYGA 3O34A 5E73A 3O37A 4QSWA 5D3NA 2E7NA 3U5JA 3UVXA 3O36A 4MEPA 1JSPB 5I89A 2RI7A 5II1A 4QEVA 5LKUA 4LZ2A 4MENA 5KTUA 4NYVA 4YYGA 5CUEA 3D7CA 5E0RA 3JVMA 5G4RA 5D7XA 5DLXA 4ZW1A 2E7OA 5E74A 5FE3A 4BW1A 5F60A 5FE8A 2R10A 5F63A 4YH3A 2DVSA 4NRCA 3UV2A 4IR6A 4NUCA 5I29A 2N9GA 5D3LA 4PKLA 5EISA 4BW2A 4F3IA 5ACYA 4C66A 5CQ6A 4MEQA 5F62A 4AKNA 2F6NA 5CUAA 4MR6A 3G0JA 3I3JA 5HRXA 4N4FA 3SVGA 2RNWA 4QYLA 5C4QA 4OUFA 4QY4A 5E9VA 2YYNA 4FLPA 5C89A 4J0RA 3G0LA 5EWDA 4ZC9A 3LJWA 4YK0A 4QR5A 4J3IA 4UYHA 3U5OA 4J0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQH A;  5F25 A;  5BT4 A;  4NYX A;  4LC2 A;  5LJ2 A;  4XY9 A;  4YC9 A;  5EGU A;  5HRW A;  4QEW A;  4ZQL A;  4O7B A;  2DKW A;  4LDF A;  4QR4 A;  5F61 A;  4A9J A;  5FE5 A;  2D82 A;  5C7N A;  4QUT A;  5A5P A;  4O7E A;  4UIZ A;  5KTW A;  3UW9 A;  4HBY A;  4YYH A;  4QUU A;  5D3H A;  5I7X A;  2RS9 B;  3QZT A;  5FG4 A;  5ENH A;  4LZS A;  4TYL A;  5ENI A;  4BW3 A;  4UIY A;  5C87 A;  2I7K A;  5FE7 A;  3U5N A;  4NR5 A;  5HLS A;  3O33 A;  5AMF A;  5D24 A;  5I40 A;  4MR3 A;  4Q0O A;  5ENF A;  1EQF A;  3GG3 A;  4PTB A;  4O70 A;  4O77 A;  2YQD A;  5IGL A;  5CU8 A;  4UYE A;  5CRM A;  4NUE A;  4IR3 A;  4YAD A;  2R0Y A;  5CQ4 A;  1WUM A;  4XY8 A;  4O76 A;  4XUB A;  4NRA A;  5EU1 A;  5CY9 A;  1F68 A;  2G4A A;  5HFR A;  5I80 A;  5EWW A;  5DKC A;  5EPB A;  4HXM A;  4KV4 A;  5DYC A;  5IGK A;  3JVL A;  5DFC A;  3P5O A;  5A5S A;  4HBX A;  4NQM A;  5DY7 A;  2L5E A;  2WP1 A;  5EP7 A;  4Z6H A;  4YAX A;  4YYD A;  2DAT A;  4QYD A;  4CFL A;  2MJV B;  5DYX A;  4QSX A;  5HEN A;  5HCL A;  4N3W A;  5J0D A;  5FB1 A;  5EWH A;  2YEL A;  5DLZ A;  5A5N A;  5F2P A;  3S92 A;  3UV4 A;  1N72 A;  4LR6 A;  4YYM A;  4HBV A;  4TT2 A;  5EI4 A;  4IOO A;  2NXB A;  5FE2 A;  4NR4 A;  2LSP B;  4CUT A;  5CTL A;  5D3R A;  5CS8 A;  4QST A;  4YY4 A;  2OSS A;  4NR9 A;  5HQ6 A;  4O78 A;  3MQM A;  2GRC A;  4UYF A;  5DW2 A;  5HJC A;  3UVD A;  2RO1 A;  5FG5 A;  4LYS A;  3MUL A;  2F6J A;  3AAD A;  2WP2 A;  3P1F A;  5A82 A;  4RVR A;  3LQJ A;  4TZ2 A;  4WHU A;  1E6I A;  5DBM A;  5ENB A;  5CFW A;  2DVQ A;  5JI8 A;  1WUG A;  4CUS A;  4OGJ A;  4HBW A;  4QB3 A;  5FH7 A;  4O7C A;  5CRZ A;  4LRG A;  5D3T A;  5CGP A;  5CUG A;  3QZS A;  4KCX A;  4QSR A;  4A9F A;  5D3P A;  3LXJ A;  5G4S A;  4CFK A;  5IG6 A;  2FSA A;  3DWY A;  5EWC A;  5E9Y A;  2R0V A;  5FB0 A;  4QZS A;  5D26 A;  5H1U A;  3P1E A;  5A5R A;  5F1H A;  5ETB A;  5KU3 A;  3QZV A;  4ALG A;  4NRB A;  4UYF B;  4UIV A;  2YW5 A;  4PCE A;  5LUU A;  4LYI A;  5D25 A;  4XYA A;  3AQA A;  5IID A;  4LYW A;  5COI A;  5ENC A;  4HXR A;  5I83 A;  2I8N A;  2H60 A;  5LVQ A;  5FBX A;  5C85 A;  2OO1 A;  4IR5 A;  3IU6 A;  5ETD A;  4YBT A;  5ENJ A;  4OGI A;  4O74 A;  1X0J A;  4A9H A;  5E7D A;  5BT5 A;  4PCI A;  4NR6 A;  4Z1S A;  4QSS A;  5FE0 A;  4WHW A;  5FG6 A;  4BHW A;  5EM3 A;  4UIX A;  2L84 A;  4KV1 A;  5D0C A;  5HFQ A;  2D9E A;  5ENG A;  2KTB B;  4O7F A;  4CL9 A;  4N4G A;  4YYN A;  5KTX A;  4CUQ A;  4Y03 A;  3SVH A;  4XUA A;  4IOQ A;  4YBM A;  5KHM A;  5D3S A;  5F1L A;  5E3G A;  5DKD A;  5TB6 A;  4A9O A;  3HMF A;  5L96 A;  5EA1 A;  4TT4 A;  5EQ1 A;  3HME A;  4N4H A;  4MEO A;  3ONI A;  4UYD A;  5HQ5 A;  2YEM A;  5E9I A;  5A81 A;  4Q0N A;  5II2 A;  4TZ8 A;  4A9K A;  4QNS A;  3U5M A;  5FH6 A;  5A83 A;  5FFW A;  3U5K A;  2RNY A;  4J1P A;  5CQA A;  3RCW A;  2OUO A;  2RNX A;  4C67 A;  5FFV A;  4Z1Q A;  5D3J A;  4QC1 A;  5DW1 A;  4YAB A;  5H85 A;  5L97 A;  1JM4 B;  5DFD A;  5EPS A;  4A9L A;  5FH8 A;  4CUR A;  4UIU A;  4CLB A;  3FKM X;  5EPR A;  5I88 A;  4A9N A;  4TT6 A;  4A9I A;  4Z6I A;  4TU4 A;  3TLP A;  5FE1 A;  5H1T A;  3UVW A;  5EVA A;  5L8T A;  4TU6 A;  5DKH A;  5BT3 A;  5AD2 A;  4CUU A;  2L85 A;  4YYK A;  4LZR A;  5EWV A;  5DX4 A;  4QSP A;  5L99 A;  4QR3 A;  4DON A;  4UIW A;  3UV5 A;  5C8G A;  5FE4 A;  5DYA A;  5CUC A;  4QC3 A;  5DFB A;  5CQ7 A;  5F36 A;  4A9M A;  5AD3 A;  5K29 A;  2E3K A;  5CPE A;  3MUK A;  4PY6 A;  4N4I A;  5H1V A;  4MR5 A;  5CQ8 A;  5I1Q A;  3DAI A;  4NR8 A;  5HQ7 A;  4BW4 A;  4YYI A;  5IGN A;  2R0S A;  3K2J A;  4TS8 A;  4PS5 A;  5I7Y A;  5AME A;  4HXL A;  5CQT A;  4TQN A;  4IR4 A;  5A7C A;  4IOR A;  5HEL A;  4O72 A;  3MB4 A;  5FFY A;  4NXJ A;  3U5L A;  3P1D A;  2DVR A;  4UIT A;  5A5Q A;  2YDW A;  4Z93 A;  5LVR A;  5LKT A;  3ZYU A;  4YBS A;  4HXK A;  4GPJ A;  5IBN A;  4YY6 A;  5FDZ A;  5EK9 A;  5F3A A;  5HRV A;  4HXN A;  5L8U A;  5L98 A;  5CQ3 A;  5E3D A;  3O35 A;  5E9L A;  4O71 A;  4QSQ A;  5CZG A;  4CUP A;  3HMH A;  3IU5 A;  4QBM A;  5LKZ A;  4E96 A;  5LJ0 A;  4X2I A;  4QSU A;  5EV9 A;  4MR4 A;  4NS5 A;  4WIV A;  4NQN A;  5EIC A;  5HEM A;  2YEK A;  5F5Z A;  4HXO A;  3MB3 A;  5LJ1 A;  2RFJ A;  3SVF A;  1ZS5 A;  3NXB A;  2DWW A;  3LQI A;  5A85 A;  5DYU A;  4HXP A;  4HXS A;  5FE9 A;  5ENE A;  3Q2E A;  5JWM A;  4QSV A;  5A5O A;  4A9E A;  5CUB A;  4O7A A;  4ALH A;  4QEU A;  4TTE A;  4YH4 A;  5E9M A;  5LKX A;  3P1C A;  5FE6 A;  5I86 A;  5CP5 A;  3JVK A;  5HM0 A;  3MXF A;  3UVY A;  5IGM A;  4NR7 A;  3S91 A;  5TCM A;  4NYW A;  3Q2F A;  5CUD A;  3U5P A;  4NUD A;  5E9K A;  4YAT A;  5KO4 A;  2DVV A;  4O75 A;  4YYJ A;  4BJX A;  5CQ5 A;  3JVJ A;  4UYG A;  3O34 A;  5E73 A;  3O37 A;  4QSW A;  5D3N A;  2E7N A;  3U5J A;  3UVX A;  3O36 A;  4MEP A;  1JSP B;  5I89 A;  2RI7 A;  5II1 A;  4QEV A;  5LKU A;  4LZ2 A;  4MEN A;  5KTU A;  4NYV A;  4YYG A;  5CUE A;  3D7C A;  5E0R A;  3JVM A;  5G4R A;  5D7X A;  5DLX A;  4ZW1 A;  2E7O A;  5E74 A;  5FE3 A;  4BW1 A;  5F60 A;  5FE8 A;  2R10 A;  5F63 A;  4YH3 A;  2DVS A;  4NRC A;  3UV2 A;  4IR6 A;  4NUC A;  5I29 A;  2N9G A;  5D3L A;  4PKL A;  5EIS A;  4BW2 A;  4F3I A;  5ACY A;  4C66 A;  5CQ6 A;  4MEQ A;  5F62 A;  4AKN A;  2F6N A;  5CUA A;  4MR6 A;  3G0J A;  3I3J A;  5HRX A;  4N4F A;  3SVG A;  2RNW A;  4QYL A;  5C4Q A;  4OUF A;  4QY4 A;  5E9V A;  2YYN A;  4FLP A;  5C89 A;  4J0R A;  3G0L A;  5EWD A;  4ZC9 A;  3LJW A;  4YK0 A;  4QR5 A;  4J3I A;  4UYH A;  3U5O A;  4J0S A; 
#chains in the Genus database with same CATH topology
 3LQH A;  5F25 A;  5BT4 A;  4NYX A;  4LC2 A;  5LJ2 A;  4XY9 A;  4YC9 A;  5EGU A;  5HRW A;  4QEW A;  4ZQL A;  4O7B A;  2DKW A;  4LDF A;  4QR4 A;  5F61 A;  4A9J A;  5FE5 A;  2D82 A;  5C7N A;  4QUT A;  5A5P A;  4O7E A;  4UIZ A;  5KTW A;  3UW9 A;  4HBY A;  4YYH A;  4QUU A;  5D3H A;  5I7X A;  2RS9 B;  3QZT A;  5FG4 A;  5ENH A;  4LZS A;  4TYL A;  5ENI A;  4BW3 A;  4UIY A;  5C87 A;  2I7K A;  5FE7 A;  3U5N A;  4NR5 A;  5HLS A;  3O33 A;  5AMF A;  5D24 A;  5I40 A;  4MR3 A;  4Q0O A;  5ENF A;  1EQF A;  3GG3 A;  4PTB A;  4O70 A;  4O77 A;  2YQD A;  5IGL A;  5CU8 A;  4UYE A;  5CRM A;  4NUE A;  4IR3 A;  4YAD A;  2R0Y A;  5CQ4 A;  1WUM A;  4XY8 A;  4O76 A;  4XUB A;  4NRA A;  5EU1 A;  5CY9 A;  1F68 A;  2G4A A;  5HFR A;  5I80 A;  5EWW A;  5DKC A;  5EPB A;  4HXM A;  4KV4 A;  5DYC A;  5IGK A;  3JVL A;  5DFC A;  3P5O A;  5A5S A;  4HBX A;  4NQM A;  5DY7 A;  2L5E A;  2WP1 A;  5EP7 A;  4Z6H A;  4YAX A;  4YYD A;  2DAT A;  4QYD A;  4CFL A;  2MJV B;  5DYX A;  4QSX A;  5HEN A;  5HCL A;  4N3W A;  5J0D A;  5FB1 A;  1PUO A;  5EWH A;  2YEL A;  5DLZ A;  5A5N A;  5F2P A;  3S92 A;  3UV4 A;  1N72 A;  4LR6 A;  4YYM A;  4HBV A;  4TT2 A;  5EI4 A;  4IOO A;  2NXB A;  5FE2 A;  4NR4 A;  2LSP B;  4CUT A;  5CTL A;  5D3R A;  5CS8 A;  4QST A;  4YY4 A;  2OSS A;  4NR9 A;  5HQ6 A;  4O78 A;  3MQM A;  2GRC A;  4UYF A;  5DW2 A;  5HJC A;  3UVD A;  2RO1 A;  5FG5 A;  4LYS A;  3MUL A;  2F6J A;  3AAD A;  2WP2 A;  3P1F A;  5A82 A;  4RVR A;  3LQJ A;  4TZ2 A;  4WHU A;  1E6I A;  5DBM A;  5ENB A;  5CFW A;  2DVQ A;  5JI8 A;  1WUG A;  4CUS A;  4OGJ A;  4HBW A;  4QB3 A;  5FH7 A;  4O7C A;  5CRZ A;  4LRG A;  5D3T A;  5CGP A;  5CUG A;  3QZS A;  4KCX A;  4QSR A;  4A9F A;  5D3P A;  3LXJ A;  5G4S A;  4CFK A;  5IG6 A;  2FSA A;  3DWY A;  5EWC A;  5E9Y A;  2R0V A;  5FB0 A;  4QZS A;  4AKI A;  5D26 A;  5H1U A;  3P1E A;  5A5R A;  5F1H A;  5ETB A;  5KU3 A;  3QZV A;  4ALG A;  4NRB A;  4UYF B;  4UIV A;  2YW5 A;  4PCE A;  5LUU A;  4LYI A;  5D25 A;  4XYA A;  3AQA A;  5IID A;  4LYW A;  5COI A;  5ENC A;  4HXR A;  4AKH A;  4AKG A;  5I83 A;  2I8N A;  2H60 A;  5LVQ A;  5FBX A;  5C85 A;  2OO1 A;  4IR5 A;  3VKH A;  3IU6 A;  5ETD A;  4YBT A;  5ENJ A;  4OGI A;  4O74 A;  1X0J A;  4A9H A;  5E7D A;  5BT5 A;  4PCI A;  4NR6 A;  4Z1S A;  4QSS A;  5FE0 A;  4WHW A;  5FG6 A;  4BHW A;  5EM3 A;  4UIX A;  2L84 A;  4KV1 A;  5D0C A;  5HFQ A;  2D9E A;  5ENG A;  2KTB B;  4O7F A;  4CL9 A;  4N4G A;  4YYN A;  5KTX A;  4CUQ A;  4Y03 A;  3ERR A;  3SVH A;  4XUA A;  4IOQ A;  4YBM A;  5KHM A;  5D3S A;  5F1L A;  5E3G A;  5DKD A;  5TB6 A;  4A9O A;  3HMF A;  5L96 A;  5EA1 A;  4TT4 A;  5EQ1 A;  3HME A;  4N4H A;  4MEO A;  3ONI A;  4UYD A;  5HQ5 A;  2YEM A;  5E9I A;  5A81 A;  4Q0N A;  5II2 A;  4TZ8 A;  4A9K A;  4QNS A;  3U5M A;  5FH6 A;  5A83 A;  5FFW A;  3U5K A;  2RNY A;  4J1P A;  5CQA A;  3RCW A;  2OUO A;  2RNX A;  4C67 A;  5FFV A;  4Z1Q A;  5D3J A;  4QC1 A;  5DW1 A;  4YAB A;  5H85 A;  5L97 A;  1JM4 B;  5DFD A;  5EPS A;  4A9L A;  5FH8 A;  4CUR A;  4UIU A;  4CLB A;  3FKM X;  5EPR A;  5I88 A;  4A9N A;  4TT6 A;  3D1B A;  4A9I A;  4Z6I A;  4TU4 A;  3TLP A;  5FE1 A;  5H1T A;  3UVW A;  5EVA A;  5L8T A;  4TU6 A;  5DKH A;  5BT3 A;  5AD2 A;  4CUU A;  2L85 A;  4YYK A;  4LZR A;  5EWV A;  5DX4 A;  4QSP A;  5L99 A;  4QR3 A;  4DON A;  4UIW A;  3UV5 A;  5C8G A;  5FE4 A;  5DYA A;  3VKG A;  5CUC A;  4QC3 A;  5DFB A;  5CQ7 A;  5F36 A;  4A9M A;  5AD3 A;  5K29 A;  2E3K A;  5CPE A;  3MUK A;  4PY6 A;  4N4I A;  5H1V A;  4MR5 A;  5CQ8 A;  5I1Q A;  3DAI A;  4NR8 A;  5HQ7 A;  4BW4 A;  4YYI A;  5IGN A;  2R0S A;  3K2J A;  4TS8 A;  4PS5 A;  5I7Y A;  5AME A;  4HXL A;  5CQT A;  4TQN A;  4IR4 A;  5A7C A;  4IOR A;  5HEL A;  4O72 A;  3MB4 A;  5FFY A;  4NXJ A;  3U5L A;  3P1D A;  2DVR A;  4UIT A;  5A5Q A;  2YDW A;  4Z93 A;  5LVR A;  5LKT A;  3ZYU A;  4YBS A;  4HXK A;  4GPJ A;  5IBN A;  4YY6 A;  5FDZ A;  5EK9 A;  5F3A A;  5HRV A;  4HXN A;  5L8U A;  5L98 A;  5CQ3 A;  5E3D A;  3O35 A;  5E9L A;  4O71 A;  4QSQ A;  5CZG A;  4CUP A;  3HMH A;  3D1D A;  3IU5 A;  4QBM A;  5LKZ A;  4E96 A;  5LJ0 A;  4X2I A;  4QSU A;  5EV9 A;  4MR4 A;  4NS5 A;  4WIV A;  4NQN A;  5EIC A;  5HEM A;  2YEK A;  5F5Z A;  4HXO A;  3MB3 A;  5LJ1 A;  2RFJ A;  3SVF A;  1ZS5 A;  3NXB A;  2DWW A;  3LQI A;  5A85 A;  5DYU A;  4HXP A;  4HXS A;  5FE9 A;  4AI6 A;  5ENE A;  3Q2E A;  5JWM A;  4QSV A;  5A5O A;  4A9E A;  5CUB A;  4O7A A;  4ALH A;  4QEU A;  4TTE A;  4YH4 A;  5E9M A;  5LKX A;  3P1C A;  5FE6 A;  5I86 A;  5CP5 A;  3JVK A;  2EJN A;  5HM0 A;  3MXF A;  3UVY A;  5IGM A;  4NR7 A;  3S91 A;  5TCM A;  4NYW A;  3Q2F A;  5CUD A;  3U5P A;  4NUD A;  5E9K A;  4YAT A;  5KO4 A;  2DVV A;  4O75 A;  4YYJ A;  4BJX A;  5CQ5 A;  3JVJ A;  4UYG A;  3O34 A;  5E73 A;  3O37 A;  4QSW A;  5D3N A;  2E7N A;  3U5J A;  3UVX A;  3O36 A;  4MEP A;  1JSP B;  5I89 A;  2RI7 A;  5II1 A;  4QEV A;  5LKU A;  4LZ2 A;  4MEN A;  5KTU A;  4NYV A;  4YYG A;  5CUE A;  3D7C A;  5E0R A;  3JVM A;  5G4R A;  5D7X A;  5DLX A;  4ZW1 A;  2E7O A;  5E74 A;  5FE3 A;  4BW1 A;  5F60 A;  5FE8 A;  2R10 A;  5F63 A;  4YH3 A;  2DVS A;  4NRC A;  3UV2 A;  4IR6 A;  4NUC A;  5I29 A;  2N9G A;  5D3L A;  4PKL A;  5EIS A;  4BW2 A;  4F3I A;  1ZKR A;  5ACY A;  4C66 A;  5CQ6 A;  4MEQ A;  5F62 A;  4AKN A;  2F6N A;  5CUA A;  4MR6 A;  3G0J A;  3I3J A;  5HRX A;  4N4F A;  3SVG A;  2RNW A;  4QYL A;  5C4Q A;  4OUF A;  4QY4 A;  5E9V A;  2YYN A;  4FLP A;  5C89 A;  4J0R A;  3G0L A;  5EWD A;  4ZC9 A;  3LJW A;  4YK0 A;  4QR5 A;  4J3I A;  4UYH A;  3U5O A;  4J0S A; 
#chains in the Genus database with same CATH homology
 3LQH A;  5F25 A;  5BT4 A;  4NYX A;  4LC2 A;  5LJ2 A;  4XY9 A;  4YC9 A;  5EGU A;  5HRW A;  4QEW A;  4ZQL A;  4O7B A;  2DKW A;  4LDF A;  4QR4 A;  5F61 A;  4A9J A;  5FE5 A;  2D82 A;  5C7N A;  4QUT A;  5A5P A;  4O7E A;  4UIZ A;  5KTW A;  3UW9 A;  4HBY A;  4YYH A;  4QUU A;  5D3H A;  5I7X A;  2RS9 B;  3QZT A;  5FG4 A;  5ENH A;  4LZS A;  4TYL A;  5ENI A;  4BW3 A;  4UIY A;  5C87 A;  2I7K A;  5FE7 A;  3U5N A;  4NR5 A;  5HLS A;  3O33 A;  5AMF A;  5D24 A;  5I40 A;  4MR3 A;  4Q0O A;  5ENF A;  1EQF A;  3GG3 A;  4PTB A;  4O70 A;  4O77 A;  2YQD A;  5IGL A;  5CU8 A;  4UYE A;  5CRM A;  4NUE A;  4IR3 A;  4YAD A;  2R0Y A;  5CQ4 A;  1WUM A;  4XY8 A;  4O76 A;  4XUB A;  4NRA A;  5EU1 A;  5CY9 A;  1F68 A;  2G4A A;  5HFR A;  5I80 A;  5EWW A;  5DKC A;  5EPB A;  4HXM A;  4KV4 A;  5DYC A;  5IGK A;  3JVL A;  5DFC A;  3P5O A;  5A5S A;  4HBX A;  4NQM A;  5DY7 A;  2L5E A;  2WP1 A;  5EP7 A;  4Z6H A;  4YAX A;  4YYD A;  2DAT A;  4QYD A;  4CFL A;  2MJV B;  5DYX A;  4QSX A;  5HEN A;  5HCL A;  4N3W A;  5J0D A;  5FB1 A;  5EWH A;  2YEL A;  5DLZ A;  5A5N A;  5F2P A;  3S92 A;  3UV4 A;  1N72 A;  4LR6 A;  4YYM A;  4HBV A;  4TT2 A;  5EI4 A;  4IOO A;  2NXB A;  5FE2 A;  4NR4 A;  2LSP B;  4CUT A;  5CTL A;  5D3R A;  5CS8 A;  4QST A;  4YY4 A;  2OSS A;  4NR9 A;  5HQ6 A;  4O78 A;  3MQM A;  2GRC A;  4UYF A;  5DW2 A;  5HJC A;  3UVD A;  2RO1 A;  5FG5 A;  4LYS A;  3MUL A;  2F6J A;  3AAD A;  2WP2 A;  3P1F A;  5A82 A;  4RVR A;  3LQJ A;  4TZ2 A;  4WHU A;  1E6I A;  5DBM A;  5ENB A;  5CFW A;  2DVQ A;  5JI8 A;  1WUG A;  4CUS A;  4OGJ A;  4HBW A;  4QB3 A;  5FH7 A;  4O7C A;  5CRZ A;  4LRG A;  5D3T A;  5CGP A;  5CUG A;  3QZS A;  4KCX A;  4QSR A;  4A9F A;  5D3P A;  3LXJ A;  5G4S A;  4CFK A;  5IG6 A;  2FSA A;  3DWY A;  5EWC A;  5E9Y A;  2R0V A;  5FB0 A;  4QZS A;  5D26 A;  5H1U A;  3P1E A;  5A5R A;  5F1H A;  5ETB A;  5KU3 A;  3QZV A;  4ALG A;  4NRB A;  4UYF B;  4UIV A;  2YW5 A;  4PCE A;  5LUU A;  4LYI A;  5D25 A;  4XYA A;  3AQA A;  5IID A;  4LYW A;  5COI A;  5ENC A;  4HXR A;  5I83 A;  2I8N A;  2H60 A;  5LVQ A;  5FBX A;  5C85 A;  2OO1 A;  4IR5 A;  3IU6 A;  5ETD A;  4YBT A;  5ENJ A;  4OGI A;  4O74 A;  1X0J A;  4A9H A;  5E7D A;  5BT5 A;  4PCI A;  4NR6 A;  4Z1S A;  4QSS A;  5FE0 A;  4WHW A;  5FG6 A;  4BHW A;  5EM3 A;  4UIX A;  2L84 A;  4KV1 A;  5D0C A;  5HFQ A;  2D9E A;  5ENG A;  2KTB B;  4O7F A;  4CL9 A;  4N4G A;  4YYN A;  5KTX A;  4CUQ A;  4Y03 A;  3SVH A;  4XUA A;  4IOQ A;  4YBM A;  5KHM A;  5D3S A;  5F1L A;  5E3G A;  5DKD A;  5TB6 A;  4A9O A;  3HMF A;  5L96 A;  5EA1 A;  4TT4 A;  5EQ1 A;  3HME A;  4N4H A;  4MEO A;  3ONI A;  4UYD A;  5HQ5 A;  2YEM A;  5E9I A;  5A81 A;  4Q0N A;  5II2 A;  4TZ8 A;  4A9K A;  4QNS A;  3U5M A;  5FH6 A;  5A83 A;  5FFW A;  3U5K A;  2RNY A;  4J1P A;  5CQA A;  3RCW A;  2OUO A;  2RNX A;  4C67 A;  5FFV A;  4Z1Q A;  5D3J A;  4QC1 A;  5DW1 A;  4YAB A;  5H85 A;  5L97 A;  1JM4 B;  5DFD A;  5EPS A;  4A9L A;  5FH8 A;  4CUR A;  4UIU A;  4CLB A;  3FKM X;  5EPR A;  5I88 A;  4A9N A;  4TT6 A;  4A9I A;  4Z6I A;  4TU4 A;  3TLP A;  5FE1 A;  5H1T A;  3UVW A;  5EVA A;  5L8T A;  4TU6 A;  5DKH A;  5BT3 A;  5AD2 A;  4CUU A;  2L85 A;  4YYK A;  4LZR A;  5EWV A;  5DX4 A;  4QSP A;  5L99 A;  4QR3 A;  4DON A;  4UIW A;  3UV5 A;  5C8G A;  5FE4 A;  5DYA A;  5CUC A;  4QC3 A;  5DFB A;  5CQ7 A;  5F36 A;  4A9M A;  5AD3 A;  5K29 A;  2E3K A;  5CPE A;  3MUK A;  4PY6 A;  4N4I A;  5H1V A;  4MR5 A;  5CQ8 A;  5I1Q A;  3DAI A;  4NR8 A;  5HQ7 A;  4BW4 A;  4YYI A;  5IGN A;  2R0S A;  3K2J A;  4TS8 A;  4PS5 A;  5I7Y A;  5AME A;  4HXL A;  5CQT A;  4TQN A;  4IR4 A;  5A7C A;  4IOR A;  5HEL A;  4O72 A;  3MB4 A;  5FFY A;  4NXJ A;  3U5L A;  3P1D A;  2DVR A;  4UIT A;  5A5Q A;  2YDW A;  4Z93 A;  5LVR A;  5LKT A;  3ZYU A;  4YBS A;  4HXK A;  4GPJ A;  5IBN A;  4YY6 A;  5FDZ A;  5EK9 A;  5F3A A;  5HRV A;  4HXN A;  5L8U A;  5L98 A;  5CQ3 A;  5E3D A;  3O35 A;  5E9L A;  4O71 A;  4QSQ A;  5CZG A;  4CUP A;  3HMH A;  3IU5 A;  4QBM A;  5LKZ A;  4E96 A;  5LJ0 A;  4X2I A;  4QSU A;  5EV9 A;  4MR4 A;  4NS5 A;  4WIV A;  4NQN A;  5EIC A;  5HEM A;  2YEK A;  5F5Z A;  4HXO A;  3MB3 A;  5LJ1 A;  2RFJ A;  3SVF A;  1ZS5 A;  3NXB A;  2DWW A;  3LQI A;  5A85 A;  5DYU A;  4HXP A;  4HXS A;  5FE9 A;  5ENE A;  3Q2E A;  5JWM A;  4QSV A;  5A5O A;  4A9E A;  5CUB A;  4O7A A;  4ALH A;  4QEU A;  4TTE A;  4YH4 A;  5E9M A;  5LKX A;  3P1C A;  5FE6 A;  5I86 A;  5CP5 A;  3JVK A;  5HM0 A;  3MXF A;  3UVY A;  5IGM A;  4NR7 A;  3S91 A;  5TCM A;  4NYW A;  3Q2F A;  5CUD A;  3U5P A;  4NUD A;  5E9K A;  4YAT A;  5KO4 A;  2DVV A;  4O75 A;  4YYJ A;  4BJX A;  5CQ5 A;  3JVJ A;  4UYG A;  3O34 A;  5E73 A;  3O37 A;  4QSW A;  5D3N A;  2E7N A;  3U5J A;  3UVX A;  3O36 A;  4MEP A;  1JSP B;  5I89 A;  2RI7 A;  5II1 A;  4QEV A;  5LKU A;  4LZ2 A;  4MEN A;  5KTU A;  4NYV A;  4YYG A;  5CUE A;  3D7C A;  5E0R A;  3JVM A;  5G4R A;  5D7X A;  5DLX A;  4ZW1 A;  2E7O A;  5E74 A;  5FE3 A;  4BW1 A;  5F60 A;  5FE8 A;  2R10 A;  5F63 A;  4YH3 A;  2DVS A;  4NRC A;  3UV2 A;  4IR6 A;  4NUC A;  5I29 A;  2N9G A;  5D3L A;  4PKL A;  5EIS A;  4BW2 A;  4F3I A;  5ACY A;  4C66 A;  5CQ6 A;  4MEQ A;  5F62 A;  4AKN A;  2F6N A;  5CUA A;  4MR6 A;  3G0J A;  3I3J A;  5HRX A;  4N4F A;  3SVG A;  2RNW A;  4QYL A;  5C4Q A;  4OUF A;  4QY4 A;  5E9V A;  2YYN A;  4FLP A;  5C89 A;  4J0R A;  3G0L A;  5EWD A;  4ZC9 A;  3LJW A;  4YK0 A;  4QR5 A;  4J3I A;  4UYH A;  3U5O A;  4J0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...