4YYKA

Crystal structure of brd9 bromodomain bound to a crotonyllysine peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Bromodomain-containing protein 9
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 101
sequence length 101
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yykA00
4IR3A 3QZSA 4HBVA 4YBTA 4MR5A 4A9NA 4QSQA 3ONIA 4QYDA 4FLPA 4A9JA 4NQMA 4QUUA 5CFWA 2YYNA 4OGJA 4NUEA 1JM4B 4MEQA 3LQIA 3O35A 5D0CA 3U5PA 4YC9A 5FE6A 4ALHA 5ENBA 4YYNA 3SVHA 5A85A 5DYCA 5FE7A 5EQ1A 3RCWA 4Q0OA 4BW2A 4BJXA 1X0JA 4HBYA 3AQAA 5HEMA 5H1UA 5FBXA 4QYLA 5LVRA 4A9OA 4ZQLA 1F68A 4PCIA 4HXNA 4YK0A 4YYKA 5CY9A 4LRGA 5F63A 5HJCA 4QR4A 4O7BA 5LJ0A 5HFQA 2H60A 5EI4A 4UYFA 5II1A 5DY7A 5D3NA 5DFCA 2DVSA 4YYHA 4NYXA 5EWCA 5CQ8A 1EQFA 4QEVA 1WUGA 5K29A 4QSVA 5E9YA 5F61A 5F5ZA 4A9LA 4QBMA 5L99A 4QEUA 5D3RA 5FE0A 4XUBA 2N9GA 5E9MA 4UITA 5EPBA 2DVVA 4Z93A 5KTUA 5A5PA 5TB6A 3U5OA 4O75A 4NS5A 5DW2A 5I83A 3NXBA 4QSUA 5BT3A 4TZ2A 3U5JA 3Q2FA 4LZ2A 2RO1A 4WIVA 5CQ6A 5F2PA 4YATA 4AKNA 4J0SA 4UIWA 4YYGA 5FE3A 5EV9A 4N3WA 2YDWA 3LXJA 4UIVA 4O74A 4UIXA 2DKWA 5ACYA 5LJ2A 4LYWA 5D7XA 5AMFA 4QSWA 5C87A 2RNXA 3FKMX 4UYFB 4HXPA 4O77A 5CGPA 4CUUA 2RNYA 5D3TA 4NYVA 2D9EA 1ZS5A 4X2IA 2YELA 4A9FA 4MENA 5CUGA 5DW1A 3K2JA 2F6JA 3JVLA 3MB3A 4QUTA 2R0SA 5DFDA 5ENCA 5CUDA 4TTEA 4TU6A 4TS8A 4YBSA 4TT6A 3AADA 5E73A 4QB3A 3HMEA 4LZRA 5E7DA 5KTXA 3UVXA 4Z6IA 3O33A 4IOQA 4UYDA 4Y03A 3UW9A 4YYJA 4MEOA 3IU6A 4O76A 3LQHA 4O72A 5I86A 5DKDA 2RNWA 5IIDA 3LJWA 4N4GA 5D26A 5DX4A 5E74A 4YYIA 5F1HA 4J3IA 5IGNA 5F1LA 5DKCA 3UV5A 5IG6A 4O7AA 4CUTA 5FE8A 5L96A 5BT5A 2YW5A 2E3KA 2LSPB 3MULA 4XY9A 5ENEA 5E9VA 3I3JA 4ZC9A 4Z1SA 4UIZA 4YH3A 4QNSA 3LQJA 2D82A 3S92A 5JWMA 5A82A 5E3GA 5A5NA 4YYMA 4NUCA 4HXOA 5HRWA 4RVRA 5L8TA 3MQMA 4HXSA 4GPJA 4NQNA 3QZTA 5C7NA 3HMHA 4NXJA 2YQDA 5LJ1A 4O70A 3TLPA 5CQ5A 3G0JA 4XYAA 2OSSA 5HRVA 5HELA 3P1DA 4J1PA 4KV4A 2FSAA 4MEPA 5AD2A 4ZW1A 4CURA 5FB0A 3UV4A 2GRCA 5FE2A 4PCEA 2NXBA 5CRMA 4A9MA 4NR7A 5FFVA 4TT2A 5E3DA 2RS9B 5AMEA 5CQ4A 5DLZA 4A9IA 2F6NA 4IR6A 5FH7A 4XY8A 3S91A 4UYHA 5E9LA 4PY6A 5DYXA 5FE1A 4O71A 2DVQA 2L5EA 5DYUA 3MUKA 4HXLA 3O36A 4QR3A 4YYDA 5FFYA 2I7KA 4HXMA 5COIA 4QZSA 5FE4A 5G4SA 4C66A 5CUAA 5A5SA 5FG6A 3JVMA 3D7CA 5ENIA 5II2A 4NR4A 5CQ7A 4BHWA 2L85A 2KTBB 5HM0A 5F3AA 4A9EA 2DVRA 5D3PA 2YEMA 5EA1A 5EU1A 5CUEA 5FDZA 3P1EA 2DATA 2RFJA 4LR6A 5J0DA 2R0YA 4YY4A 5E9KA 4ALGA 4BW4A 4NR5A 4HXKA 4OUFA 5FB1A 4XUAA 5CQAA 4LDFA 4WHUA 5LUUA 5IGKA 4NRAA 4E96A 4BW1A 4F3IA 5A5OA 4QY4A 4CL9A 5FH8A 4A9HA 4QSRA 4N4FA 5D3LA 4IORA 4WHWA 5ETDA 5FE9A 5CS8A 3UVDA 5BT4A 5HQ7A 5EGUA 1JSPB 4PKLA 5E9IA 4QR5A 5EK9A 3MB4A 3IU5A 4Z6HA 5ENHA 3P1CA 3P5OA 4QSTA 5KO4A 4A9KA 5I89A 5HCLA 5F60A 4LYSA 4HXRA 5CRZA 5EVAA 1N72A 4QSSA 2I8NA 4IR4A 3SVFA 4QSXA 4MR4A 4TYLA 3QZVA 4TQNA 5EPRA 4CUQA 5I1QA 2OUOA 5C85A 4Z1QA 3JVJA 5L97A 2OO1A 4HBXA 4UYEA 5LKZA 1WUMA 4UIYA 5I80A 3G0LA 4UIUA 5E0RA 5EWWA 5HENA 5HRXA 4YBMA 5EP7A 5CPEA 2RI7A 3SVGA 4CUPA 4N4IA 5KTWA 4IOOA 4O78A 4QEWA 5CTLA 2WP1A 3JVKA 5CZGA 4LC2A 5D25A 2E7OA 5D24A 4C67A 5KHMA 5DLXA 5D3HA 5HQ5A 5H85A 5I29A 4UYGA 5FG4A 3HMFA 4LZSA 5EISA 4CFKA 5ENJA 5EM3A 4KV1A 5G4RA 5IGMA 5EWDA 5C4QA 4CFLA 5HQ6A 5CUBA 3DWYA 3Q2EA 3ZYUA 5EICA 1E6IA 4MR3A 5C89A 4DONA 5ENGA 2MJVB 4OGIA 3DAIA 5LKUA 5ENFA 3U5NA 3UVYA 4N4HA 3UV2A 5H1VA 5H1TA 5CU8A 4NYWA 5DYAA 5IGLA 5EPSA 3O34A 4YH4A 5FFWA 3MXFA 4HBWA 4Q0NA 5DBMA 3U5LA 5EWHA 4J0RA 4NR8A 5A83A 5FE5A 3U5MA 5CUCA 5F36A 4O7CA 4NR9A 4PTBA 5LKXA 4KCXA 5LKTA 5A7CA 5C8GA 2R10A 2R0VA 5CP5A 5I88A 4O7EA 2WP2A 5DKHA 4LYIA 3U5KA 5ETBA 4YADA 2L84A 5CQ3A 4IR5A 4NR6A 2E7NA 5FH6A 3P1FA 5A5QA 5DFBA 4TT4A 5I7YA 4NUDA 2G4AA 5HFRA 5KU3A 4YABA 5AD3A 4QC1A 4NRCA 4BW3A 5LVQA 3GG3A 4TU4A 5L98A 5A81A 5F62A 4CLBA 4O7FA 5F25A 5TCMA 4CUSA 4TZ8A 5A5RA 2YEKA 5I7XA 5FG5A 5L8UA 4YY6A 5D3SA 2DWWA 4NRBA 5EWVA 5D3JA 5IBNA 5JI8A 4QC3A 5CQTA 3UVWA 5I40A 4YAXA 4QSPA 3O37A 5HLSA 4PS5A 4MR6A
chains in the Genus database with same CATH superfamily
4IR3A 3QZSA 4HBVA 4YBTA 4MR5A 4A9NA 4QSQA 3ONIA 4QYDA 4FLPA 4A9JA 4NQMA 4QUUA 5CFWA 2YYNA 4OGJA 4NUEA 1JM4B 4MEQA 3LQIA 3O35A 5D0CA 3U5PA 4YC9A 5FE6A 4ALHA 5ENBA 4YYNA 3SVHA 5A85A 5DYCA 5FE7A 5EQ1A 3RCWA 4Q0OA 4BW2A 4BJXA 1X0JA 4HBYA 3AQAA 5HEMA 5H1UA 5FBXA 4QYLA 5LVRA 4A9OA 4ZQLA 1F68A 4PCIA 4HXNA 4YK0A 4YYKA 5CY9A 4LRGA 5F63A 5HJCA 4QR4A 4O7BA 5LJ0A 5HFQA 2H60A 5EI4A 4UYFA 5II1A 5DY7A 5D3NA 5DFCA 2DVSA 4YYHA 4NYXA 5EWCA 5CQ8A 1EQFA 4QEVA 1WUGA 5K29A 4QSVA 5E9YA 5F61A 5F5ZA 4A9LA 4QBMA 5L99A 4QEUA 5D3RA 5FE0A 4XUBA 2N9GA 5E9MA 4UITA 5EPBA 2DVVA 4Z93A 5KTUA 5A5PA 5TB6A 3U5OA 4O75A 4NS5A 5DW2A 5I83A 3NXBA 4QSUA 5BT3A 4TZ2A 3U5JA 3Q2FA 4LZ2A 2RO1A 4WIVA 5CQ6A 5F2PA 4YATA 4AKNA 4J0SA 4UIWA 4YYGA 5FE3A 5EV9A 4N3WA 2YDWA 3LXJA 4UIVA 4AKIA 4O74A 4UIXA 2DKWA 5ACYA 5LJ2A 4LYWA 5D7XA 5AMFA 4QSWA 5C87A 2RNXA 3FKMX 4UYFB 4HXPA 4O77A 5CGPA 4CUUA 2RNYA 5D3TA 4NYVA 2D9EA 1ZS5A 4X2IA 2YELA 4A9FA 1ZKRA 4MENA 5CUGA 5DW1A 3K2JA 2F6JA 3JVLA 3MB3A 4QUTA 2R0SA 5DFDA 5ENCA 5CUDA 4TTEA 4TU6A 4TS8A 4YBSA 4TT6A 3AADA 5E73A 4QB3A 3HMEA 4LZRA 5E7DA 5KTXA 3UVXA 4Z6IA 3O33A 4IOQA 4UYDA 4Y03A 3UW9A 4YYJA 4MEOA 3IU6A 4O76A 3LQHA 4O72A 5I86A 5DKDA 2RNWA 5IIDA 3LJWA 4N4GA 5D26A 5DX4A 5E74A 4YYIA 5F1HA 4J3IA 5IGNA 5F1LA 5DKCA 3UV5A 5IG6A 4O7AA 4CUTA 5FE8A 5L96A 5BT5A 2YW5A 2E3KA 2LSPB 3MULA 4XY9A 5ENEA 5E9VA 3I3JA 4ZC9A 4Z1SA 4UIZA 4YH3A 4QNSA 3LQJA 2D82A 3S92A 5JWMA 5A82A 5E3GA 5A5NA 4YYMA 4NUCA 4HXOA 5HRWA 4RVRA 5L8TA 3MQMA 4HXSA 4GPJA 4NQNA 3QZTA 5C7NA 3HMHA 4NXJA 2YQDA 5LJ1A 4O70A 3TLPA 5CQ5A 4AKHA 3G0JA 4XYAA 2OSSA 5HRVA 5HELA 3P1DA 4J1PA 4KV4A 2FSAA 4MEPA 5AD2A 4ZW1A 4CURA 5FB0A 3UV4A 2GRCA 5FE2A 4PCEA 2NXBA 5CRMA 4A9MA 4NR7A 5FFVA 4TT2A 5E3DA 2RS9B 5AMEA 5CQ4A 5DLZA 4A9IA 2F6NA 4IR6A 5FH7A 4XY8A 3S91A 4UYHA 5E9LA 4PY6A 5DYXA 5FE1A 4O71A 2DVQA 2L5EA 5DYUA 3MUKA 4HXLA 3O36A 4QR3A 4YYDA 5FFYA 2I7KA 4HXMA 5COIA 4QZSA 5FE4A 5G4SA 4C66A 5CUAA 5A5SA 5FG6A 3JVMA 3D7CA 5ENIA 5II2A 4NR4A 5CQ7A 4BHWA 3VKHA 2L85A 2KTBB 5HM0A 5F3AA 4A9EA 2DVRA 5D3PA 2YEMA 5EA1A 5EU1A 5CUEA 3VKGA 5FDZA 3P1EA 2DATA 2RFJA 4LR6A 5J0DA 2R0YA 4YY4A 5E9KA 4ALGA 4BW4A 4NR5A 4HXKA 4OUFA 5FB1A 4XUAA 5CQAA 4LDFA 4WHUA 5LUUA 5IGKA 4NRAA 4E96A 4BW1A 4F3IA 5A5OA 4QY4A 4CL9A 5FH8A 4A9HA 4QSRA 4N4FA 5D3LA 4IORA 4WHWA 5ETDA 5FE9A 5CS8A 3UVDA 5BT4A 5HQ7A 5EGUA 1JSPB 4PKLA 5E9IA 4QR5A 5EK9A 3MB4A 3IU5A 4Z6HA 4AKGA 5ENHA 3P1CA 3P5OA 4QSTA 5KO4A 4A9KA 5I89A 5HCLA 5F60A 4LYSA 4HXRA 5CRZA 5EVAA 1N72A 4QSSA 2I8NA 4IR4A 3SVFA 4QSXA 4MR4A 4TYLA 3QZVA 4TQNA 5EPRA 4CUQA 5I1QA 2OUOA 5C85A 4Z1QA 3JVJA 5L97A 2OO1A 4HBXA 4UYEA 5LKZA 1WUMA 4UIYA 5I80A 3G0LA 4UIUA 5E0RA 5EWWA 5HENA 5HRXA 4YBMA 3ERRA 5EP7A 5CPEA 2RI7A 3SVGA 4CUPA 4N4IA 5KTWA 4IOOA 4O78A 4QEWA 4AI6A 5CTLA 2WP1A 3JVKA 5CZGA 4LC2A 5D25A 2E7OA 5D24A 4C67A 5KHMA 5DLXA 5D3HA 5HQ5A 5H85A 5I29A 4UYGA 5FG4A 3HMFA 4LZSA 5EISA 4CFKA 5ENJA 5EM3A 4KV1A 5G4RA 5IGMA 2EJNA 5EWDA 4CFLA 5C4QA 5HQ6A 5CUBA 3DWYA 3Q2EA 3ZYUA 5EICA 1E6IA 4MR3A 5C89A 4DONA 5ENGA 2MJVB 4OGIA 3DAIA 5LKUA 5ENFA 3U5NA 3UVYA 4N4HA 3UV2A 5H1VA 5H1TA 5CU8A 4NYWA 5DYAA 5IGLA 5EPSA 3O34A 4YH4A 5FFWA 3MXFA 4HBWA 4Q0NA 5DBMA 3U5LA 5EWHA 4J0RA 4NR8A 5A83A 5FE5A 3U5MA 5CUCA 5F36A 4O7CA 4NR9A 4PTBA 5LKXA 4KCXA 5LKTA 5A7CA 5C8GA 2R10A 2R0VA 5CP5A 5I88A 4O7EA 2WP2A 5DKHA 4LYIA 3U5KA 5ETBA 4YADA 2L84A 5CQ3A 4IR5A 4NR6A 2E7NA 5FH6A 3P1FA 5A5QA 5DFBA 4TT4A 5I7YA 4NUDA 2G4AA 3D1BA 5HFRA 5KU3A 4YABA 5AD3A 4QC1A 4NRCA 4BW3A 5LVQA 3D1DA 3GG3A 4TU4A 5L98A 5A81A 5F62A 4CLBA 4O7FA 5F25A 5TCMA 4CUSA 1PUOA 4TZ8A 5A5RA 2YEKA 5I7XA 5FG5A 5L8UA 4YY6A 5D3SA 2DWWA 4NRBA 5EWVA 5D3JA 5IBNA 5JI8A 4QC3A 5CQTA 3UVWA 5I40A 4YAXA 4QSPA 3O37A 5HLSA 4PS5A 4MR6A
chains in the Genus database with same CATH topology
4IR3A 3QZSA 4HBVA 4YBTA 4MR5A 4A9NA 4QSQA 3ONIA 4QYDA 4FLPA 4A9JA 4NQMA 4QUUA 5CFWA 2YYNA 4OGJA 4NUEA 1JM4B 4MEQA 3LQIA 3O35A 5D0CA 3U5PA 4YC9A 5FE6A 4ALHA 5ENBA 4YYNA 3SVHA 5A85A 5DYCA 5FE7A 5EQ1A 3RCWA 4Q0OA 4BW2A 4BJXA 1X0JA 4HBYA 3AQAA 5HEMA 5H1UA 5FBXA 4QYLA 5LVRA 4A9OA 4ZQLA 1F68A 4PCIA 4HXNA 4YK0A 4YYKA 5CY9A 4LRGA 5F63A 5HJCA 4QR4A 4O7BA 5LJ0A 5HFQA 2H60A 5EI4A 4UYFA 5II1A 5DY7A 5D3NA 5DFCA 2DVSA 4YYHA 4NYXA 5EWCA 5CQ8A 1EQFA 4QEVA 1WUGA 5K29A 4QSVA 5E9YA 5F61A 5F5ZA 4A9LA 4QBMA 5L99A 4QEUA 5D3RA 5FE0A 4XUBA 2N9GA 5E9MA 4UITA 5EPBA 2DVVA 4Z93A 5KTUA 5A5PA 5TB6A 3U5OA 4O75A 4NS5A 5DW2A 5I83A 3NXBA 4QSUA 5BT3A 4TZ2A 3U5JA 3Q2FA 4LZ2A 2RO1A 4WIVA 5CQ6A 5F2PA 4YATA 4AKNA 4J0SA 4UIWA 4YYGA 5FE3A 5EV9A 4N3WA 2YDWA 3LXJA 4UIVA 4O74A 4UIXA 2DKWA 5ACYA 5LJ2A 4LYWA 5D7XA 5AMFA 4QSWA 5C87A 2RNXA 3FKMX 4UYFB 4HXPA 4O77A 5CGPA 4CUUA 2RNYA 5D3TA 4NYVA 2D9EA 1ZS5A 4X2IA 2YELA 4A9FA 4MENA 5CUGA 5DW1A 3K2JA 2F6JA 3JVLA 3MB3A 4QUTA 2R0SA 5DFDA 5ENCA 5CUDA 4TTEA 4TU6A 4TS8A 4YBSA 4TT6A 3AADA 5E73A 4QB3A 3HMEA 4LZRA 5E7DA 5KTXA 3UVXA 4Z6IA 3O33A 4IOQA 4UYDA 4Y03A 3UW9A 4YYJA 4MEOA 3IU6A 4O76A 3LQHA 4O72A 5I86A 5DKDA 2RNWA 5IIDA 3LJWA 4N4GA 5D26A 5DX4A 5E74A 4YYIA 5F1HA 4J3IA 5IGNA 5F1LA 5DKCA 3UV5A 5IG6A 4O7AA 4CUTA 5FE8A 5L96A 5BT5A 2YW5A 2E3KA 2LSPB 3MULA 4XY9A 5ENEA 5E9VA 3I3JA 4ZC9A 4Z1SA 4UIZA 4YH3A 4QNSA 3LQJA 2D82A 3S92A 5JWMA 5A82A 5E3GA 5A5NA 4YYMA 4NUCA 4HXOA 5HRWA 4RVRA 5L8TA 3MQMA 4HXSA 4GPJA 4NQNA 3QZTA 5C7NA 3HMHA 4NXJA 2YQDA 5LJ1A 4O70A 3TLPA 5CQ5A 3G0JA 4XYAA 2OSSA 5HRVA 5HELA 3P1DA 4J1PA 4KV4A 2FSAA 4MEPA 5AD2A 4ZW1A 4CURA 5FB0A 3UV4A 2GRCA 5FE2A 4PCEA 2NXBA 5CRMA 4A9MA 4NR7A 5FFVA 4TT2A 5E3DA 2RS9B 5AMEA 5CQ4A 5DLZA 4A9IA 2F6NA 4IR6A 5FH7A 4XY8A 3S91A 4UYHA 5E9LA 4PY6A 5DYXA 5FE1A 4O71A 2DVQA 2L5EA 5DYUA 3MUKA 4HXLA 3O36A 4QR3A 4YYDA 5FFYA 2I7KA 4HXMA 5COIA 4QZSA 5FE4A 5G4SA 4C66A 5CUAA 5A5SA 5FG6A 3JVMA 3D7CA 5ENIA 5II2A 4NR4A 5CQ7A 4BHWA 2L85A 2KTBB 5HM0A 5F3AA 4A9EA 2DVRA 5D3PA 2YEMA 5EA1A 5EU1A 5CUEA 5FDZA 3P1EA 2DATA 2RFJA 4LR6A 5J0DA 2R0YA 4YY4A 5E9KA 4ALGA 4BW4A 4NR5A 4HXKA 4OUFA 5FB1A 4XUAA 5CQAA 4LDFA 4WHUA 5LUUA 5IGKA 4NRAA 4E96A 4BW1A 4F3IA 5A5OA 4QY4A 4CL9A 5FH8A 4A9HA 4QSRA 4N4FA 5D3LA 4IORA 4WHWA 5ETDA 5FE9A 5CS8A 3UVDA 5BT4A 5HQ7A 5EGUA 1JSPB 4PKLA 5E9IA 4QR5A 5EK9A 3MB4A 3IU5A 4Z6HA 5ENHA 3P1CA 3P5OA 4QSTA 5KO4A 4A9KA 5I89A 5HCLA 5F60A 4LYSA 4HXRA 5CRZA 5EVAA 1N72A 4QSSA 2I8NA 4IR4A 3SVFA 4QSXA 4MR4A 4TYLA 3QZVA 4TQNA 5EPRA 4CUQA 5I1QA 2OUOA 5C85A 4Z1QA 3JVJA 5L97A 2OO1A 4HBXA 4UYEA 5LKZA 1WUMA 4UIYA 5I80A 3G0LA 4UIUA 5E0RA 5EWWA 5HENA 5HRXA 4YBMA 5EP7A 5CPEA 2RI7A 3SVGA 4CUPA 4N4IA 5KTWA 4IOOA 4O78A 4QEWA 5CTLA 2WP1A 3JVKA 5CZGA 4LC2A 5D25A 2E7OA 5D24A 4C67A 5KHMA 5DLXA 5D3HA 5HQ5A 5H85A 5I29A 4UYGA 5FG4A 3HMFA 4LZSA 5EISA 4CFKA 5ENJA 5EM3A 4KV1A 5G4RA 5IGMA 5EWDA 5C4QA 4CFLA 5HQ6A 5CUBA 3DWYA 3Q2EA 3ZYUA 5EICA 1E6IA 4MR3A 5C89A 4DONA 5ENGA 2MJVB 4OGIA 3DAIA 5LKUA 5ENFA 3U5NA 3UVYA 4N4HA 3UV2A 5H1VA 5H1TA 5CU8A 4NYWA 5DYAA 5IGLA 5EPSA 3O34A 4YH4A 5FFWA 3MXFA 4HBWA 4Q0NA 5DBMA 3U5LA 5EWHA 4J0RA 4NR8A 5A83A 5FE5A 3U5MA 5CUCA 5F36A 4O7CA 4NR9A 4PTBA 5LKXA 4KCXA 5LKTA 5A7CA 5C8GA 2R10A 2R0VA 5CP5A 5I88A 4O7EA 2WP2A 5DKHA 4LYIA 3U5KA 5ETBA 4YADA 2L84A 5CQ3A 4IR5A 4NR6A 2E7NA 5FH6A 3P1FA 5A5QA 5DFBA 4TT4A 5I7YA 4NUDA 2G4AA 5HFRA 5KU3A 4YABA 5AD3A 4QC1A 4NRCA 4BW3A 5LVQA 3GG3A 4TU4A 5L98A 5A81A 5F62A 4CLBA 4O7FA 5F25A 5TCMA 4CUSA 4TZ8A 5A5RA 2YEKA 5I7XA 5FG5A 5L8UA 4YY6A 5D3SA 2DWWA 4NRBA 5EWVA 5D3JA 5IBNA 5JI8A 4QC3A 5CQTA 3UVWA 5I40A 4YAXA 4QSPA 3O37A 5HLSA 4PS5A 4MR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IR3 A;  3QZS A;  4HBV A;  4YBT A;  4MR5 A;  4A9N A;  4QSQ A;  3ONI A;  4QYD A;  4FLP A;  4A9J A;  4NQM A;  4QUU A;  5CFW A;  2YYN A;  4OGJ A;  4NUE A;  1JM4 B;  4MEQ A;  3LQI A;  3O35 A;  5D0C A;  3U5P A;  4YC9 A;  5FE6 A;  4ALH A;  5ENB A;  4YYN A;  3SVH A;  5A85 A;  5DYC A;  5FE7 A;  5EQ1 A;  3RCW A;  4Q0O A;  4BW2 A;  4BJX A;  1X0J A;  4HBY A;  3AQA A;  5HEM A;  5H1U A;  5FBX A;  4QYL A;  5LVR A;  4A9O A;  4ZQL A;  1F68 A;  4PCI A;  4HXN A;  4YK0 A;  4YYK A;  5CY9 A;  4LRG A;  5F63 A;  5HJC A;  4QR4 A;  4O7B A;  5LJ0 A;  5HFQ A;  2H60 A;  5EI4 A;  4UYF A;  5II1 A;  5DY7 A;  5D3N A;  5DFC A;  2DVS A;  4YYH A;  4NYX A;  5EWC A;  5CQ8 A;  1EQF A;  4QEV A;  1WUG A;  5K29 A;  4QSV A;  5E9Y A;  5F61 A;  5F5Z A;  4A9L A;  4QBM A;  5L99 A;  4QEU A;  5D3R A;  5FE0 A;  4XUB A;  2N9G A;  5E9M A;  4UIT A;  5EPB A;  2DVV A;  4Z93 A;  5KTU A;  5A5P A;  5TB6 A;  3U5O A;  4O75 A;  4NS5 A;  5DW2 A;  5I83 A;  3NXB A;  4QSU A;  5BT3 A;  4TZ2 A;  3U5J A;  3Q2F A;  4LZ2 A;  2RO1 A;  4WIV A;  5CQ6 A;  5F2P A;  4YAT A;  4AKN A;  4J0S A;  4UIW A;  4YYG A;  5FE3 A;  5EV9 A;  4N3W A;  2YDW A;  3LXJ A;  4UIV A;  4O74 A;  4UIX A;  2DKW A;  5ACY A;  5LJ2 A;  4LYW A;  5D7X A;  5AMF A;  4QSW A;  5C87 A;  2RNX A;  3FKM X;  4UYF B;  4HXP A;  4O77 A;  5CGP A;  4CUU A;  2RNY A;  5D3T A;  4NYV A;  2D9E A;  1ZS5 A;  4X2I A;  2YEL A;  4A9F A;  4MEN A;  5CUG A;  5DW1 A;  3K2J A;  2F6J A;  3JVL A;  3MB3 A;  4QUT A;  2R0S A;  5DFD A;  5ENC A;  5CUD A;  4TTE A;  4TU6 A;  4TS8 A;  4YBS A;  4TT6 A;  3AAD A;  5E73 A;  4QB3 A;  3HME A;  4LZR A;  5E7D A;  5KTX A;  3UVX A;  4Z6I A;  3O33 A;  4IOQ A;  4UYD A;  4Y03 A;  3UW9 A;  4YYJ A;  4MEO A;  3IU6 A;  4O76 A;  3LQH A;  4O72 A;  5I86 A;  5DKD A;  2RNW A;  5IID A;  3LJW A;  4N4G A;  5D26 A;  5DX4 A;  5E74 A;  4YYI A;  5F1H A;  4J3I A;  5IGN A;  5F1L A;  5DKC A;  3UV5 A;  5IG6 A;  4O7A A;  4CUT A;  5FE8 A;  5L96 A;  5BT5 A;  2YW5 A;  2E3K A;  2LSP B;  3MUL A;  4XY9 A;  5ENE A;  5E9V A;  3I3J A;  4ZC9 A;  4Z1S A;  4UIZ A;  4YH3 A;  4QNS A;  3LQJ A;  2D82 A;  3S92 A;  5JWM A;  5A82 A;  5E3G A;  5A5N A;  4YYM A;  4NUC A;  4HXO A;  5HRW A;  4RVR A;  5L8T A;  3MQM A;  4HXS A;  4GPJ A;  4NQN A;  3QZT A;  5C7N A;  3HMH A;  4NXJ A;  2YQD A;  5LJ1 A;  4O70 A;  3TLP A;  5CQ5 A;  3G0J A;  4XYA A;  2OSS A;  5HRV A;  5HEL A;  3P1D A;  4J1P A;  4KV4 A;  2FSA A;  4MEP A;  5AD2 A;  4ZW1 A;  4CUR A;  5FB0 A;  3UV4 A;  2GRC A;  5FE2 A;  4PCE A;  2NXB A;  5CRM A;  4A9M A;  4NR7 A;  5FFV A;  4TT2 A;  5E3D A;  2RS9 B;  5AME A;  5CQ4 A;  5DLZ A;  4A9I A;  2F6N A;  4IR6 A;  5FH7 A;  4XY8 A;  3S91 A;  4UYH A;  5E9L A;  4PY6 A;  5DYX A;  5FE1 A;  4O71 A;  2DVQ A;  2L5E A;  5DYU A;  3MUK A;  4HXL A;  3O36 A;  4QR3 A;  4YYD A;  5FFY A;  2I7K A;  4HXM A;  5COI A;  4QZS A;  5FE4 A;  5G4S A;  4C66 A;  5CUA A;  5A5S A;  5FG6 A;  3JVM A;  3D7C A;  5ENI A;  5II2 A;  4NR4 A;  5CQ7 A;  4BHW A;  2L85 A;  2KTB B;  5HM0 A;  5F3A A;  4A9E A;  2DVR A;  5D3P A;  2YEM A;  5EA1 A;  5EU1 A;  5CUE A;  5FDZ A;  3P1E A;  2DAT A;  2RFJ A;  4LR6 A;  5J0D A;  2R0Y A;  4YY4 A;  5E9K A;  4ALG A;  4BW4 A;  4NR5 A;  4HXK A;  4OUF A;  5FB1 A;  4XUA A;  5CQA A;  4LDF A;  4WHU A;  5LUU A;  5IGK A;  4NRA A;  4E96 A;  4BW1 A;  4F3I A;  5A5O A;  4QY4 A;  4CL9 A;  5FH8 A;  4A9H A;  4QSR A;  4N4F A;  5D3L A;  4IOR A;  4WHW A;  5ETD A;  5FE9 A;  5CS8 A;  3UVD A;  5BT4 A;  5HQ7 A;  5EGU A;  1JSP B;  4PKL A;  5E9I A;  4QR5 A;  5EK9 A;  3MB4 A;  3IU5 A;  4Z6H A;  5ENH A;  3P1C A;  3P5O A;  4QST A;  5KO4 A;  4A9K A;  5I89 A;  5HCL A;  5F60 A;  4LYS A;  4HXR A;  5CRZ A;  5EVA A;  1N72 A;  4QSS A;  2I8N A;  4IR4 A;  3SVF A;  4QSX A;  4MR4 A;  4TYL A;  3QZV A;  4TQN A;  5EPR A;  4CUQ A;  5I1Q A;  2OUO A;  5C85 A;  4Z1Q A;  3JVJ A;  5L97 A;  2OO1 A;  4HBX A;  4UYE A;  5LKZ A;  1WUM A;  4UIY A;  5I80 A;  3G0L A;  4UIU A;  5E0R A;  5EWW A;  5HEN A;  5HRX A;  4YBM A;  5EP7 A;  5CPE A;  2RI7 A;  3SVG A;  4CUP A;  4N4I A;  5KTW A;  4IOO A;  4O78 A;  4QEW A;  5CTL A;  2WP1 A;  3JVK A;  5CZG A;  4LC2 A;  5D25 A;  2E7O A;  5D24 A;  4C67 A;  5KHM A;  5DLX A;  5D3H A;  5HQ5 A;  5H85 A;  5I29 A;  4UYG A;  5FG4 A;  3HMF A;  4LZS A;  5EIS A;  4CFK A;  5ENJ A;  5EM3 A;  4KV1 A;  5G4R A;  5IGM A;  5EWD A;  5C4Q A;  4CFL A;  5HQ6 A;  5CUB A;  3DWY A;  3Q2E A;  3ZYU A;  5EIC A;  1E6I A;  4MR3 A;  5C89 A;  4DON A;  5ENG A;  2MJV B;  4OGI A;  3DAI A;  5LKU A;  5ENF A;  3U5N A;  3UVY A;  4N4H A;  3UV2 A;  5H1V A;  5H1T A;  5CU8 A;  4NYW A;  5DYA A;  5IGL A;  5EPS A;  3O34 A;  4YH4 A;  5FFW A;  3MXF A;  4HBW A;  4Q0N A;  5DBM A;  3U5L A;  5EWH A;  4J0R A;  4NR8 A;  5A83 A;  5FE5 A;  3U5M A;  5CUC A;  5F36 A;  4O7C A;  4NR9 A;  4PTB A;  5LKX A;  4KCX A;  5LKT A;  5A7C A;  5C8G A;  2R10 A;  2R0V A;  5CP5 A;  5I88 A;  4O7E A;  2WP2 A;  5DKH A;  4LYI A;  3U5K A;  5ETB A;  4YAD A;  2L84 A;  5CQ3 A;  4IR5 A;  4NR6 A;  2E7N A;  5FH6 A;  3P1F A;  5A5Q A;  5DFB A;  4TT4 A;  5I7Y A;  4NUD A;  2G4A A;  5HFR A;  5KU3 A;  4YAB A;  5AD3 A;  4QC1 A;  4NRC A;  4BW3 A;  5LVQ A;  3GG3 A;  4TU4 A;  5L98 A;  5A81 A;  5F62 A;  4CLB A;  4O7F A;  5F25 A;  5TCM A;  4CUS A;  4TZ8 A;  5A5R A;  2YEK A;  5I7X A;  5FG5 A;  5L8U A;  4YY6 A;  5D3S A;  2DWW A;  4NRB A;  5EWV A;  5D3J A;  5IBN A;  5JI8 A;  4QC3 A;  5CQT A;  3UVW A;  5I40 A;  4YAX A;  4QSP A;  3O37 A;  5HLS A;  4PS5 A;  4MR6 A; 
#chains in the Genus database with same CATH topology
 4IR3 A;  3QZS A;  4HBV A;  4YBT A;  4MR5 A;  4A9N A;  4QSQ A;  3ONI A;  4QYD A;  4FLP A;  4A9J A;  4NQM A;  4QUU A;  5CFW A;  2YYN A;  4OGJ A;  4NUE A;  1JM4 B;  4MEQ A;  3LQI A;  3O35 A;  5D0C A;  3U5P A;  4YC9 A;  5FE6 A;  4ALH A;  5ENB A;  4YYN A;  3SVH A;  5A85 A;  5DYC A;  5FE7 A;  5EQ1 A;  3RCW A;  4Q0O A;  4BW2 A;  4BJX A;  1X0J A;  4HBY A;  3AQA A;  5HEM A;  5H1U A;  5FBX A;  4QYL A;  5LVR A;  4A9O A;  4ZQL A;  1F68 A;  4PCI A;  4HXN A;  4YK0 A;  4YYK A;  5CY9 A;  4LRG A;  5F63 A;  5HJC A;  4QR4 A;  4O7B A;  5LJ0 A;  5HFQ A;  2H60 A;  5EI4 A;  4UYF A;  5II1 A;  5DY7 A;  5D3N A;  5DFC A;  2DVS A;  4YYH A;  4NYX A;  5EWC A;  5CQ8 A;  1EQF A;  4QEV A;  1WUG A;  5K29 A;  4QSV A;  5E9Y A;  5F61 A;  5F5Z A;  4A9L A;  4QBM A;  5L99 A;  4QEU A;  5D3R A;  5FE0 A;  4XUB A;  2N9G A;  5E9M A;  4UIT A;  5EPB A;  2DVV A;  4Z93 A;  5KTU A;  5A5P A;  5TB6 A;  3U5O A;  4O75 A;  4NS5 A;  5DW2 A;  5I83 A;  3NXB A;  4QSU A;  5BT3 A;  4TZ2 A;  3U5J A;  3Q2F A;  4LZ2 A;  2RO1 A;  4WIV A;  5CQ6 A;  5F2P A;  4YAT A;  4AKN A;  4J0S A;  4UIW A;  4YYG A;  5FE3 A;  5EV9 A;  4N3W A;  2YDW A;  3LXJ A;  4UIV A;  4AKI A;  4O74 A;  4UIX A;  2DKW A;  5ACY A;  5LJ2 A;  4LYW A;  5D7X A;  5AMF A;  4QSW A;  5C87 A;  2RNX A;  3FKM X;  4UYF B;  4HXP A;  4O77 A;  5CGP A;  4CUU A;  2RNY A;  5D3T A;  4NYV A;  2D9E A;  1ZS5 A;  4X2I A;  2YEL A;  4A9F A;  1ZKR A;  4MEN A;  5CUG A;  5DW1 A;  3K2J A;  2F6J A;  3JVL A;  3MB3 A;  4QUT A;  2R0S A;  5DFD A;  5ENC A;  5CUD A;  4TTE A;  4TU6 A;  4TS8 A;  4YBS A;  4TT6 A;  3AAD A;  5E73 A;  4QB3 A;  3HME A;  4LZR A;  5E7D A;  5KTX A;  3UVX A;  4Z6I A;  3O33 A;  4IOQ A;  4UYD A;  4Y03 A;  3UW9 A;  4YYJ A;  4MEO A;  3IU6 A;  4O76 A;  3LQH A;  4O72 A;  5I86 A;  5DKD A;  2RNW A;  5IID A;  3LJW A;  4N4G A;  5D26 A;  5DX4 A;  5E74 A;  4YYI A;  5F1H A;  4J3I A;  5IGN A;  5F1L A;  5DKC A;  3UV5 A;  5IG6 A;  4O7A A;  4CUT A;  5FE8 A;  5L96 A;  5BT5 A;  2YW5 A;  2E3K A;  2LSP B;  3MUL A;  4XY9 A;  5ENE A;  5E9V A;  3I3J A;  4ZC9 A;  4Z1S A;  4UIZ A;  4YH3 A;  4QNS A;  3LQJ A;  2D82 A;  3S92 A;  5JWM A;  5A82 A;  5E3G A;  5A5N A;  4YYM A;  4NUC A;  4HXO A;  5HRW A;  4RVR A;  5L8T A;  3MQM A;  4HXS A;  4GPJ A;  4NQN A;  3QZT A;  5C7N A;  3HMH A;  4NXJ A;  2YQD A;  5LJ1 A;  4O70 A;  3TLP A;  5CQ5 A;  4AKH A;  3G0J A;  4XYA A;  2OSS A;  5HRV A;  5HEL A;  3P1D A;  4J1P A;  4KV4 A;  2FSA A;  4MEP A;  5AD2 A;  4ZW1 A;  4CUR A;  5FB0 A;  3UV4 A;  2GRC A;  5FE2 A;  4PCE A;  2NXB A;  5CRM A;  4A9M A;  4NR7 A;  5FFV A;  4TT2 A;  5E3D A;  2RS9 B;  5AME A;  5CQ4 A;  5DLZ A;  4A9I A;  2F6N A;  4IR6 A;  5FH7 A;  4XY8 A;  3S91 A;  4UYH A;  5E9L A;  4PY6 A;  5DYX A;  5FE1 A;  4O71 A;  2DVQ A;  2L5E A;  5DYU A;  3MUK A;  4HXL A;  3O36 A;  4QR3 A;  4YYD A;  5FFY A;  2I7K A;  4HXM A;  5COI A;  4QZS A;  5FE4 A;  5G4S A;  4C66 A;  5CUA A;  5A5S A;  5FG6 A;  3JVM A;  3D7C A;  5ENI A;  5II2 A;  4NR4 A;  5CQ7 A;  4BHW A;  3VKH A;  2L85 A;  2KTB B;  5HM0 A;  5F3A A;  4A9E A;  2DVR A;  5D3P A;  2YEM A;  5EA1 A;  5EU1 A;  5CUE A;  3VKG A;  5FDZ A;  3P1E A;  2DAT A;  2RFJ A;  4LR6 A;  5J0D A;  2R0Y A;  4YY4 A;  5E9K A;  4ALG A;  4BW4 A;  4NR5 A;  4HXK A;  4OUF A;  5FB1 A;  4XUA A;  5CQA A;  4LDF A;  4WHU A;  5LUU A;  5IGK A;  4NRA A;  4E96 A;  4BW1 A;  4F3I A;  5A5O A;  4QY4 A;  4CL9 A;  5FH8 A;  4A9H A;  4QSR A;  4N4F A;  5D3L A;  4IOR A;  4WHW A;  5ETD A;  5FE9 A;  5CS8 A;  3UVD A;  5BT4 A;  5HQ7 A;  5EGU A;  1JSP B;  4PKL A;  5E9I A;  4QR5 A;  5EK9 A;  3MB4 A;  3IU5 A;  4Z6H A;  4AKG A;  5ENH A;  3P1C A;  3P5O A;  4QST A;  5KO4 A;  4A9K A;  5I89 A;  5HCL A;  5F60 A;  4LYS A;  4HXR A;  5CRZ A;  5EVA A;  1N72 A;  4QSS A;  2I8N A;  4IR4 A;  3SVF A;  4QSX A;  4MR4 A;  4TYL A;  3QZV A;  4TQN A;  5EPR A;  4CUQ A;  5I1Q A;  2OUO A;  5C85 A;  4Z1Q A;  3JVJ A;  5L97 A;  2OO1 A;  4HBX A;  4UYE A;  5LKZ A;  1WUM A;  4UIY A;  5I80 A;  3G0L A;  4UIU A;  5E0R A;  5EWW A;  5HEN A;  5HRX A;  4YBM A;  3ERR A;  5EP7 A;  5CPE A;  2RI7 A;  3SVG A;  4CUP A;  4N4I A;  5KTW A;  4IOO A;  4O78 A;  4QEW A;  4AI6 A;  5CTL A;  2WP1 A;  3JVK A;  5CZG A;  4LC2 A;  5D25 A;  2E7O A;  5D24 A;  4C67 A;  5KHM A;  5DLX A;  5D3H A;  5HQ5 A;  5H85 A;  5I29 A;  4UYG A;  5FG4 A;  3HMF A;  4LZS A;  5EIS A;  4CFK A;  5ENJ A;  5EM3 A;  4KV1 A;  5G4R A;  5IGM A;  2EJN A;  5EWD A;  4CFL A;  5C4Q A;  5HQ6 A;  5CUB A;  3DWY A;  3Q2E A;  3ZYU A;  5EIC A;  1E6I A;  4MR3 A;  5C89 A;  4DON A;  5ENG A;  2MJV B;  4OGI A;  3DAI A;  5LKU A;  5ENF A;  3U5N A;  3UVY A;  4N4H A;  3UV2 A;  5H1V A;  5H1T A;  5CU8 A;  4NYW A;  5DYA A;  5IGL A;  5EPS A;  3O34 A;  4YH4 A;  5FFW A;  3MXF A;  4HBW A;  4Q0N A;  5DBM A;  3U5L A;  5EWH A;  4J0R A;  4NR8 A;  5A83 A;  5FE5 A;  3U5M A;  5CUC A;  5F36 A;  4O7C A;  4NR9 A;  4PTB A;  5LKX A;  4KCX A;  5LKT A;  5A7C A;  5C8G A;  2R10 A;  2R0V A;  5CP5 A;  5I88 A;  4O7E A;  2WP2 A;  5DKH A;  4LYI A;  3U5K A;  5ETB A;  4YAD A;  2L84 A;  5CQ3 A;  4IR5 A;  4NR6 A;  2E7N A;  5FH6 A;  3P1F A;  5A5Q A;  5DFB A;  4TT4 A;  5I7Y A;  4NUD A;  2G4A A;  3D1B A;  5HFR A;  5KU3 A;  4YAB A;  5AD3 A;  4QC1 A;  4NRC A;  4BW3 A;  5LVQ A;  3D1D A;  3GG3 A;  4TU4 A;  5L98 A;  5A81 A;  5F62 A;  4CLB A;  4O7F A;  5F25 A;  5TCM A;  4CUS A;  1PUO A;  4TZ8 A;  5A5R A;  2YEK A;  5I7X A;  5FG5 A;  5L8U A;  4YY6 A;  5D3S A;  2DWW A;  4NRB A;  5EWV A;  5D3J A;  5IBN A;  5JI8 A;  4QC3 A;  5CQT A;  3UVW A;  5I40 A;  4YAX A;  4QSP A;  3O37 A;  5HLS A;  4PS5 A;  4MR6 A; 
#chains in the Genus database with same CATH homology
 4IR3 A;  3QZS A;  4HBV A;  4YBT A;  4MR5 A;  4A9N A;  4QSQ A;  3ONI A;  4QYD A;  4FLP A;  4A9J A;  4NQM A;  4QUU A;  5CFW A;  2YYN A;  4OGJ A;  4NUE A;  1JM4 B;  4MEQ A;  3LQI A;  3O35 A;  5D0C A;  3U5P A;  4YC9 A;  5FE6 A;  4ALH A;  5ENB A;  4YYN A;  3SVH A;  5A85 A;  5DYC A;  5FE7 A;  5EQ1 A;  3RCW A;  4Q0O A;  4BW2 A;  4BJX A;  1X0J A;  4HBY A;  3AQA A;  5HEM A;  5H1U A;  5FBX A;  4QYL A;  5LVR A;  4A9O A;  4ZQL A;  1F68 A;  4PCI A;  4HXN A;  4YK0 A;  4YYK A;  5CY9 A;  4LRG A;  5F63 A;  5HJC A;  4QR4 A;  4O7B A;  5LJ0 A;  5HFQ A;  2H60 A;  5EI4 A;  4UYF A;  5II1 A;  5DY7 A;  5D3N A;  5DFC A;  2DVS A;  4YYH A;  4NYX A;  5EWC A;  5CQ8 A;  1EQF A;  4QEV A;  1WUG A;  5K29 A;  4QSV A;  5E9Y A;  5F61 A;  5F5Z A;  4A9L A;  4QBM A;  5L99 A;  4QEU A;  5D3R A;  5FE0 A;  4XUB A;  2N9G A;  5E9M A;  4UIT A;  5EPB A;  2DVV A;  4Z93 A;  5KTU A;  5A5P A;  5TB6 A;  3U5O A;  4O75 A;  4NS5 A;  5DW2 A;  5I83 A;  3NXB A;  4QSU A;  5BT3 A;  4TZ2 A;  3U5J A;  3Q2F A;  4LZ2 A;  2RO1 A;  4WIV A;  5CQ6 A;  5F2P A;  4YAT A;  4AKN A;  4J0S A;  4UIW A;  4YYG A;  5FE3 A;  5EV9 A;  4N3W A;  2YDW A;  3LXJ A;  4UIV A;  4O74 A;  4UIX A;  2DKW A;  5ACY A;  5LJ2 A;  4LYW A;  5D7X A;  5AMF A;  4QSW A;  5C87 A;  2RNX A;  3FKM X;  4UYF B;  4HXP A;  4O77 A;  5CGP A;  4CUU A;  2RNY A;  5D3T A;  4NYV A;  2D9E A;  1ZS5 A;  4X2I A;  2YEL A;  4A9F A;  4MEN A;  5CUG A;  5DW1 A;  3K2J A;  2F6J A;  3JVL A;  3MB3 A;  4QUT A;  2R0S A;  5DFD A;  5ENC A;  5CUD A;  4TTE A;  4TU6 A;  4TS8 A;  4YBS A;  4TT6 A;  3AAD A;  5E73 A;  4QB3 A;  3HME A;  4LZR A;  5E7D A;  5KTX A;  3UVX A;  4Z6I A;  3O33 A;  4IOQ A;  4UYD A;  4Y03 A;  3UW9 A;  4YYJ A;  4MEO A;  3IU6 A;  4O76 A;  3LQH A;  4O72 A;  5I86 A;  5DKD A;  2RNW A;  5IID A;  3LJW A;  4N4G A;  5D26 A;  5DX4 A;  5E74 A;  4YYI A;  5F1H A;  4J3I A;  5IGN A;  5F1L A;  5DKC A;  3UV5 A;  5IG6 A;  4O7A A;  4CUT A;  5FE8 A;  5L96 A;  5BT5 A;  2YW5 A;  2E3K A;  2LSP B;  3MUL A;  4XY9 A;  5ENE A;  5E9V A;  3I3J A;  4ZC9 A;  4Z1S A;  4UIZ A;  4YH3 A;  4QNS A;  3LQJ A;  2D82 A;  3S92 A;  5JWM A;  5A82 A;  5E3G A;  5A5N A;  4YYM A;  4NUC A;  4HXO A;  5HRW A;  4RVR A;  5L8T A;  3MQM A;  4HXS A;  4GPJ A;  4NQN A;  3QZT A;  5C7N A;  3HMH A;  4NXJ A;  2YQD A;  5LJ1 A;  4O70 A;  3TLP A;  5CQ5 A;  3G0J A;  4XYA A;  2OSS A;  5HRV A;  5HEL A;  3P1D A;  4J1P A;  4KV4 A;  2FSA A;  4MEP A;  5AD2 A;  4ZW1 A;  4CUR A;  5FB0 A;  3UV4 A;  2GRC A;  5FE2 A;  4PCE A;  2NXB A;  5CRM A;  4A9M A;  4NR7 A;  5FFV A;  4TT2 A;  5E3D A;  2RS9 B;  5AME A;  5CQ4 A;  5DLZ A;  4A9I A;  2F6N A;  4IR6 A;  5FH7 A;  4XY8 A;  3S91 A;  4UYH A;  5E9L A;  4PY6 A;  5DYX A;  5FE1 A;  4O71 A;  2DVQ A;  2L5E A;  5DYU A;  3MUK A;  4HXL A;  3O36 A;  4QR3 A;  4YYD A;  5FFY A;  2I7K A;  4HXM A;  5COI A;  4QZS A;  5FE4 A;  5G4S A;  4C66 A;  5CUA A;  5A5S A;  5FG6 A;  3JVM A;  3D7C A;  5ENI A;  5II2 A;  4NR4 A;  5CQ7 A;  4BHW A;  2L85 A;  2KTB B;  5HM0 A;  5F3A A;  4A9E A;  2DVR A;  5D3P A;  2YEM A;  5EA1 A;  5EU1 A;  5CUE A;  5FDZ A;  3P1E A;  2DAT A;  2RFJ A;  4LR6 A;  5J0D A;  2R0Y A;  4YY4 A;  5E9K A;  4ALG A;  4BW4 A;  4NR5 A;  4HXK A;  4OUF A;  5FB1 A;  4XUA A;  5CQA A;  4LDF A;  4WHU A;  5LUU A;  5IGK A;  4NRA A;  4E96 A;  4BW1 A;  4F3I A;  5A5O A;  4QY4 A;  4CL9 A;  5FH8 A;  4A9H A;  4QSR A;  4N4F A;  5D3L A;  4IOR A;  4WHW A;  5ETD A;  5FE9 A;  5CS8 A;  3UVD A;  5BT4 A;  5HQ7 A;  5EGU A;  1JSP B;  4PKL A;  5E9I A;  4QR5 A;  5EK9 A;  3MB4 A;  3IU5 A;  4Z6H A;  5ENH A;  3P1C A;  3P5O A;  4QST A;  5KO4 A;  4A9K A;  5I89 A;  5HCL A;  5F60 A;  4LYS A;  4HXR A;  5CRZ A;  5EVA A;  1N72 A;  4QSS A;  2I8N A;  4IR4 A;  3SVF A;  4QSX A;  4MR4 A;  4TYL A;  3QZV A;  4TQN A;  5EPR A;  4CUQ A;  5I1Q A;  2OUO A;  5C85 A;  4Z1Q A;  3JVJ A;  5L97 A;  2OO1 A;  4HBX A;  4UYE A;  5LKZ A;  1WUM A;  4UIY A;  5I80 A;  3G0L A;  4UIU A;  5E0R A;  5EWW A;  5HEN A;  5HRX A;  4YBM A;  5EP7 A;  5CPE A;  2RI7 A;  3SVG A;  4CUP A;  4N4I A;  5KTW A;  4IOO A;  4O78 A;  4QEW A;  5CTL A;  2WP1 A;  3JVK A;  5CZG A;  4LC2 A;  5D25 A;  2E7O A;  5D24 A;  4C67 A;  5KHM A;  5DLX A;  5D3H A;  5HQ5 A;  5H85 A;  5I29 A;  4UYG A;  5FG4 A;  3HMF A;  4LZS A;  5EIS A;  4CFK A;  5ENJ A;  5EM3 A;  4KV1 A;  5G4R A;  5IGM A;  5EWD A;  5C4Q A;  4CFL A;  5HQ6 A;  5CUB A;  3DWY A;  3Q2E A;  3ZYU A;  5EIC A;  1E6I A;  4MR3 A;  5C89 A;  4DON A;  5ENG A;  2MJV B;  4OGI A;  3DAI A;  5LKU A;  5ENF A;  3U5N A;  3UVY A;  4N4H A;  3UV2 A;  5H1V A;  5H1T A;  5CU8 A;  4NYW A;  5DYA A;  5IGL A;  5EPS A;  3O34 A;  4YH4 A;  5FFW A;  3MXF A;  4HBW A;  4Q0N A;  5DBM A;  3U5L A;  5EWH A;  4J0R A;  4NR8 A;  5A83 A;  5FE5 A;  3U5M A;  5CUC A;  5F36 A;  4O7C A;  4NR9 A;  4PTB A;  5LKX A;  4KCX A;  5LKT A;  5A7C A;  5C8G A;  2R10 A;  2R0V A;  5CP5 A;  5I88 A;  4O7E A;  2WP2 A;  5DKH A;  4LYI A;  3U5K A;  5ETB A;  4YAD A;  2L84 A;  5CQ3 A;  4IR5 A;  4NR6 A;  2E7N A;  5FH6 A;  3P1F A;  5A5Q A;  5DFB A;  4TT4 A;  5I7Y A;  4NUD A;  2G4A A;  5HFR A;  5KU3 A;  4YAB A;  5AD3 A;  4QC1 A;  4NRC A;  4BW3 A;  5LVQ A;  3GG3 A;  4TU4 A;  5L98 A;  5A81 A;  5F62 A;  4CLB A;  4O7F A;  5F25 A;  5TCM A;  4CUS A;  4TZ8 A;  5A5R A;  2YEK A;  5I7X A;  5FG5 A;  5L8U A;  4YY6 A;  5D3S A;  2DWW A;  4NRB A;  5EWV A;  5D3J A;  5IBN A;  5JI8 A;  4QC3 A;  5CQT A;  3UVW A;  5I40 A;  4YAX A;  4QSP A;  3O37 A;  5HLS A;  4PS5 A;  4MR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...