5I7YA

Brd9 in complex with cpd4 ((e)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)-n,n-dimethylbenzamide)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i7yA00
5FB0A 4YY4A 5D3JA 5D3PA 5C87A 2YEKA 4NS5A 4NXJA 3SVHA 4QSRA 4TU4A 5EU1A 5H1VA 5IGNA 5A5NA 3MB3A 1N72A 4WHWA 3SVGA 4NUCA 4O7CA 3TLPA 4BW3A 5E9IA 5A5OA 5A5PA 5D24A 5LJ0A 5LVQA 5DY7A 3JVLA 3QZTA 5A81A 4PS5A 4PY6A 4XUAA 5I89A 4QEWA 2OO1A 4MR3A 4YYJA 4YH4A 5CQ3A 5CGPA 4J1PA 4J0RA 5DX4A 5A82A 5DYCA 2DWWA 5I86A 2R10A 4YAXA 5JI8A 4CUTA 4CL9A 4PCIA 5D3HA 5FH8A 1JSPB 4UYEA 4QEUA 5A5RA 4O75A 2RO1A 4UYHA 4UIXA 5D26A 2R0SA 4MR6A 5LVRA 4HXPA 5CQ4A 1JM4B 3LJWA 5EWDA 1WUGA 2RFJA 3O35A 4HBXA 5CP5A 5A5SA 4QSVA 5CUBA 3O37A 4O74A 5EVAA 5LKZA 4MEQA 5LKUA 4BW4A 4OUFA 5TB6A 5KTWA 4QC1A 5HFRA 5E9VA 4LC2A 5H85A 5HRVA 5IIDA 3MXFA 4ZW1A 4HXMA 5DKHA 4O70A 5HQ6A 5D0CA 5DW2A 4HBWA 5ENGA 4YYDA 4NUEA 4UYFB 4YC9A 5AMEA 3P1EA 4DONA 5F63A 5ENBA 4TQNA 5HQ7A 2N9GA 5L96A 4XY8A 3LXJA 3JVJA 5HCLA 5D3TA 2NXBA 4LDFA 2YYNA 3GG3A 5L97A 5FB1A 5FFVA 4RVRA 4UITA 3ZYUA 3UW9A 4QSXA 4IOOA 3P5OA 5D3RA 2L5EA 4IR3A 4HBYA 5HM0A 2WP1A 5AD2A 4J0SA 4Q0OA 5KU3A 5F36A 4O7BA 4HXKA 4A9MA 5KO4A 3U5OA 5FE1A 2DVVA 5CTLA 4NR4A 4HXNA 4O76A 3U5KA 4X2IA 4O7FA 3U5JA 5ENIA 3LQIA 3U5MA 4QUUA 5FDZA 1EQFA 5FE8A 2KTBB 3SVFA 5IGLA 2G4AA 2MJVB 2OUOA 4YYHA 4Z1SA 5D25A 3DWYA 5CUAA 2L84A 4NYWA 5FH6A 4N4GA 4TS8A 5DYUA 3QZVA 5FE3A 4CURA 4TTEA 2D82A 3IU5A 2YW5A 4UIVA 4YH3A 5EICA 5BT3A 3Q2EA 4YYMA 2YEMA 4IR4A 3MB4A 4N4HA 4YK0A 5E3GA 5FE5A 5C8GA 4HBVA 4A9KA 3LQHA 4UYDA 5DYAA 4NRBA 3P1DA 4QY4A 3FKMX 5DYXA 3D7CA 5A83A 2RNYA 4YYKA 2I8NA 4BW2A 3UVDA 2FSAA 4YATA 2RNXA 5DKCA 5EWCA 4IR6A 5DKDA 3U5PA 5CFWA 5EM3A 4Q0NA 4MR4A 4A9IA 4XYAA 5C4QA 3IU6A 5A7CA 4F3IA 4CUPA 5HLSA 5ENFA 5FE9A 2YELA 4Z6IA 4NR7A 4ZC9A 5CQAA 5EWWA 5CQ8A 2YDWA 4LRGA 4IORA 5HRXA 5BT5A 4TT2A 5E9KA 4MR5A 4A9OA 3DAIA 3JVKA 4YY6A 3UV2A 4N3WA 4YBTA 4N4IA 4QR5A 5EP7A 5F1LA 3G0LA 2E7NA 3UV4A 5I7XA 4QBMA 2I7KA 4LZRA 5DFDA 5CPEA 5COIA 4TZ2A 4XUBA 5A5QA 4MEOA 2R0VA 5IGMA 1F68A 4OGJA 3I3JA 5TCMA 5CRZA 3U5LA 5HENA 5I88A 5CQ6A 2H60A 3P1FA 4TU6A 4Z6HA 4NYVA 4UYGA 5E3DA 4CUQA 5AD3A 5LKXA 2DATA 4QSWA 4QC3A 4UIZA 4QR4A 4NYXA 2OSSA 5HFQA 5C85A 4UIUA 2LSPB 3MULA 5E9LA 4QUTA 5CUGA 5I7YA 3U5NA 5FE0A 5I80A 3JVMA 4LZ2A 4ALHA 4YABA 4O78A 4NQNA 3HMFA 4CFKA 5EK9A 5E73A 5DLZA 4CFLA 1E6IA 4GPJA 4UYFA 4MEPA 4TZ8A 4J3IA 5D3SA 4N4FA 5HELA 3LQJA 4C66A 5EA1A 3UVWA 3HMHA 1ZS5A 4HXLA 5K29A 4Z93A 4TT6A 2GRCA 4NUDA 5I40A 5CQ5A 5II2A 5HQ5A 5G4RA 4PTBA 4QSTA 5ETDA 5IBNA 4YADA 5BT4A 3RCWA 3UV5A 4CLBA 4QB3A 4LYWA 5LJ2A 4PCEA 5FBXA 5L98A 3AADA 4LZSA 5EGUA 3O33A 5H1TA 5CQ7A 4BHWA 4QSSA 2YQDA 5EPSA 5D3NA 4QSQA 5ACYA 3HMEA 5FFYA 5CRMA 4BJXA 5C7NA 5HRWA 3O34A 3ONIA 5FG6A 3S92A 4O71A 2RS9B 5E9YA 5ENCA 5CS8A 4E96A 5E7DA 5F25A 4Z1QA 4HXRA 4QYLA 5CU8A 5HJCA 2F6NA 5H1UA 1X0JA 2F6JA 3K2JA 5D3LA 4QSUA 3UVYA 5DBMA 2R0YA 4A9NA 4QNSA 5F3AA 5DLXA 4QR3A 5EI4A 5CUCA 5E0RA 5IG6A 4QEVA 2DVSA 2RNWA 5FFWA 5LJ1A 5FG5A 5C89A 4O7EA 5AMFA 5L99A 4TT4A 5FH7A 3MQMA 4ZQLA 3UVXA 5KHMA 4NR8A 4LYIA 4KV4A 5KTUA 4OGIA 4A9JA 4XY9A 5DW1A 5LUUA 5EPRA 5F62A 2WP2A 4NR5A 2DVRA 3S91A 4CUUA 4HXSA 4YYGA 2DKWA 4Y03A 5EWVA 5HEMA 5IGKA 5EPBA 2E3KA 4ALGA 5G4SA 5F1HA 5A85A 4A9LA 5D7XA 5EISA 4YYNA 4O7AA 4QSPA 4QZSA 4O77A 4CUSA 5E9MA 5L8UA 4NRCA 4NR6A 4TYLA 5ENEA 2DVQA 3O36A 4YYIA 4NRAA 5CZGA 4LR6A 3G0JA 5E74A 5EQ1A 3QZSA 5CY9A 4IOQA 4C67A 5DFBA 5II1A 4A9EA 4LYSA 3P1CA 5F5ZA 5FE7A 3MUKA 4KV1A 4HXOA 4WIVA 5F60A 4YBMA 5ENJA 5F2PA 4FLPA 2E7OA 4A9FA 5L8TA 5CUEA 5EV9A 5CUDA 2D9EA 5ENHA 4YBSA 4WHUA 4BW1A 5FG4A 4IR5A 5ETBA 1WUMA 4KCXA 5DFCA 5I83A 5I1QA 5J0DA 3AQAA 4UIWA 3Q2FA 3NXBA 2RI7A 4NR9A 4MENA 5FE4A 4AKNA 4NQMA 5CQTA 4PKLA 5I29A 5LKTA 5FE2A 2L85A 5F61A 4UIYA 5JWMA 5KTXA 4A9HA 4O72A 5FE6A 4QYDA 5EWHA
chains in the Genus database with same CATH superfamily
5FB0A 4YY4A 5D3JA 5D3PA 5C87A 2YEKA 4NS5A 4NXJA 3SVHA 4QSRA 4TU4A 5EU1A 5H1VA 5IGNA 5A5NA 3MB3A 1N72A 4WHWA 3SVGA 4NUCA 4O7CA 3TLPA 4BW3A 5E9IA 5A5OA 5A5PA 5D24A 5LJ0A 5LVQA 5DY7A 3JVLA 3QZTA 5A81A 4PS5A 4PY6A 4XUAA 5I89A 4QEWA 2OO1A 4MR3A 4YYJA 4YH4A 5CQ3A 5CGPA 4J1PA 4J0RA 5DX4A 5A82A 5DYCA 2DWWA 5I86A 2R10A 1ZKRA 4YAXA 5JI8A 4CUTA 4CL9A 4PCIA 5D3HA 5FH8A 1JSPB 4UYEA 4QEUA 5A5RA 4O75A 2RO1A 4UYHA 4UIXA 5D26A 2R0SA 4MR6A 5LVRA 4HXPA 5CQ4A 1JM4B 3LJWA 5EWDA 1WUGA 2RFJA 3O35A 4HBXA 5CP5A 5A5SA 4QSVA 5CUBA 3O37A 4O74A 5EVAA 5LKZA 4MEQA 4AKGA 5LKUA 4BW4A 4OUFA 5TB6A 5KTWA 4QC1A 5HFRA 5E9VA 4LC2A 5H85A 5HRVA 5IIDA 3MXFA 4ZW1A 4HXMA 5DKHA 4O70A 5HQ6A 5D0CA 5DW2A 4HBWA 5ENGA 4YYDA 4NUEA 4UYFB 4YC9A 5AMEA 3P1EA 4DONA 4AKHA 5F63A 5ENBA 4TQNA 5HQ7A 2N9GA 5L96A 4XY8A 3LXJA 3JVJA 5HCLA 5D3TA 2NXBA 4LDFA 2YYNA 3GG3A 5L97A 5FB1A 5FFVA 4RVRA 4UITA 3ZYUA 3UW9A 4QSXA 4IOOA 3P5OA 5D3RA 2L5EA 4IR3A 4HBYA 5HM0A 2WP1A 5AD2A 4J0SA 4Q0OA 5KU3A 5F36A 4O7BA 4AI6A 4HXKA 4A9MA 5KO4A 3U5OA 5FE1A 2DVVA 5CTLA 4NR4A 4HXNA 4O76A 3U5KA 4X2IA 4O7FA 3U5JA 5ENIA 3LQIA 3U5MA 4QUUA 5FDZA 1EQFA 5FE8A 2KTBB 3SVFA 5IGLA 2G4AA 2MJVB 2OUOA 4YYHA 4Z1SA 5D25A 3DWYA 5CUAA 2L84A 4NYWA 5FH6A 4N4GA 4TS8A 5DYUA 3QZVA 5FE3A 4CURA 4TTEA 2D82A 3IU5A 2YW5A 4UIVA 4YH3A 5EICA 5BT3A 3Q2EA 4YYMA 2YEMA 2EJNA 4IR4A 3MB4A 4N4HA 4YK0A 5E3GA 5FE5A 5C8GA 4HBVA 4A9KA 3LQHA 4UYDA 5DYAA 4NRBA 3P1DA 4QY4A 3FKMX 5DYXA 3D7CA 5A83A 2RNYA 4YYKA 2I8NA 4BW2A 3UVDA 2FSAA 4YATA 2RNXA 5DKCA 5EWCA 4IR6A 5DKDA 3U5PA 5CFWA 5EM3A 4Q0NA 4MR4A 4A9IA 4XYAA 5C4QA 3IU6A 5A7CA 4F3IA 4CUPA 5HLSA 4AKIA 5ENFA 5FE9A 2YELA 4Z6IA 4NR7A 4ZC9A 5CQAA 5EWWA 5CQ8A 2YDWA 4LRGA 4IORA 5HRXA 5BT5A 4TT2A 5E9KA 4MR5A 4A9OA 3DAIA 3JVKA 4YY6A 3ERRA 3UV2A 4N3WA 4YBTA 4N4IA 4QR5A 5EP7A 5F1LA 3G0LA 2E7NA 3UV4A 5I7XA 4QBMA 2I7KA 4LZRA 5DFDA 5CPEA 5COIA 4TZ2A 4XUBA 5A5QA 4MEOA 2R0VA 5IGMA 1F68A 4OGJA 3I3JA 5TCMA 5CRZA 3U5LA 3D1DA 5HENA 5I88A 5CQ6A 2H60A 3P1FA 4TU6A 4Z6HA 4NYVA 4UYGA 5E3DA 4CUQA 5AD3A 5LKXA 2DATA 4QSWA 4QC3A 4UIZA 4QR4A 4NYXA 2OSSA 5HFQA 5C85A 4UIUA 2LSPB 3MULA 5E9LA 4QUTA 5CUGA 5I7YA 3U5NA 5FE0A 5I80A 3JVMA 4LZ2A 4ALHA 4YABA 4O78A 4NQNA 3HMFA 4CFKA 5EK9A 5E73A 5DLZA 4CFLA 1E6IA 4GPJA 4UYFA 4MEPA 4TZ8A 4J3IA 5D3SA 4N4FA 5HELA 3LQJA 4C66A 5EA1A 3UVWA 3HMHA 1ZS5A 4HXLA 5K29A 3VKHA 4Z93A 4TT6A 2GRCA 4NUDA 5I40A 5CQ5A 5II2A 5HQ5A 5G4RA 4PTBA 4QSTA 5ETDA 5IBNA 4YADA 5BT4A 3RCWA 3UV5A 4CLBA 4QB3A 4LYWA 5LJ2A 4PCEA 5FBXA 5L98A 3AADA 4LZSA 5EGUA 3O33A 5H1TA 5CQ7A 4BHWA 4QSSA 2YQDA 5EPSA 5D3NA 4QSQA 5ACYA 3HMEA 5FFYA 5CRMA 4BJXA 5C7NA 5HRWA 3O34A 3ONIA 5FG6A 3S92A 4O71A 2RS9B 5E9YA 5ENCA 5CS8A 4E96A 5E7DA 5F25A 4Z1QA 4HXRA 4QYLA 5CU8A 5HJCA 2F6NA 5H1UA 1X0JA 2F6JA 3K2JA 5D3LA 4QSUA 3UVYA 5DBMA 2R0YA 4A9NA 4QNSA 5F3AA 5DLXA 4QR3A 5EI4A 5CUCA 5E0RA 5IG6A 4QEVA 2DVSA 2RNWA 5FFWA 5LJ1A 5FG5A 5C89A 4O7EA 5AMFA 5L99A 4TT4A 5FH7A 3MQMA 4ZQLA 3UVXA 5KHMA 4NR8A 4LYIA 4KV4A 5KTUA 4OGIA 4A9JA 4XY9A 5DW1A 5LUUA 5EPRA 5F62A 2WP2A 4NR5A 2DVRA 3S91A 4CUUA 4HXSA 4YYGA 2DKWA 4Y03A 5EWVA 5HEMA 5IGKA 5EPBA 2E3KA 4ALGA 5G4SA 5F1HA 5A85A 4A9LA 5D7XA 5EISA 4YYNA 4O7AA 4QSPA 4QZSA 4O77A 4CUSA 5E9MA 5L8UA 4NRCA 3D1BA 4NR6A 4TYLA 5ENEA 2DVQA 3O36A 4YYIA 4NRAA 5CZGA 4LR6A 3G0JA 5E74A 5EQ1A 3QZSA 5CY9A 4IOQA 4C67A 5DFBA 5II1A 4A9EA 4LYSA 3P1CA 5F5ZA 5FE7A 3MUKA 4KV1A 4HXOA 4WIVA 5F60A 4YBMA 5ENJA 5F2PA 4FLPA 2E7OA 4A9FA 5L8TA 5CUEA 5EV9A 5CUDA 2D9EA 5ENHA 4YBSA 4WHUA 1PUOA 4BW1A 5FG4A 4IR5A 5ETBA 1WUMA 4KCXA 5DFCA 5I83A 3VKGA 5I1QA 5J0DA 3AQAA 4UIWA 3Q2FA 3NXBA 2RI7A 4NR9A 4MENA 5FE4A 4AKNA 4NQMA 5CQTA 4PKLA 5I29A 5LKTA 5FE2A 2L85A 5F61A 4UIYA 5JWMA 5KTXA 4A9HA 4O72A 5FE6A 4QYDA 5EWHA
chains in the Genus database with same CATH topology
5FB0A 4YY4A 5D3JA 5D3PA 5C87A 2YEKA 4NS5A 4NXJA 3SVHA 4QSRA 4TU4A 5EU1A 5H1VA 5IGNA 5A5NA 3MB3A 1N72A 4WHWA 3SVGA 4NUCA 4O7CA 3TLPA 4BW3A 5E9IA 5A5OA 5A5PA 5D24A 5LJ0A 5LVQA 5DY7A 3JVLA 3QZTA 5A81A 4PS5A 4PY6A 4XUAA 5I89A 4QEWA 2OO1A 4MR3A 4YYJA 4YH4A 5CQ3A 5CGPA 4J1PA 4J0RA 5DX4A 5A82A 5DYCA 2DWWA 5I86A 2R10A 4YAXA 5JI8A 4CUTA 4CL9A 4PCIA 5D3HA 5FH8A 1JSPB 4UYEA 4QEUA 5A5RA 4O75A 2RO1A 4UYHA 4UIXA 5D26A 2R0SA 4MR6A 5LVRA 4HXPA 5CQ4A 1JM4B 3LJWA 5EWDA 1WUGA 2RFJA 3O35A 4HBXA 5CP5A 5A5SA 4QSVA 5CUBA 3O37A 4O74A 5EVAA 5LKZA 4MEQA 5LKUA 4BW4A 4OUFA 5TB6A 5KTWA 4QC1A 5HFRA 5E9VA 4LC2A 5H85A 5HRVA 5IIDA 3MXFA 4ZW1A 4HXMA 5DKHA 4O70A 5HQ6A 5D0CA 5DW2A 4HBWA 5ENGA 4YYDA 4NUEA 4UYFB 4YC9A 5AMEA 3P1EA 4DONA 5F63A 5ENBA 4TQNA 5HQ7A 2N9GA 5L96A 4XY8A 3LXJA 3JVJA 5HCLA 5D3TA 2NXBA 4LDFA 2YYNA 3GG3A 5L97A 5FB1A 5FFVA 4RVRA 4UITA 3ZYUA 3UW9A 4QSXA 4IOOA 3P5OA 5D3RA 2L5EA 4IR3A 4HBYA 5HM0A 2WP1A 5AD2A 4J0SA 4Q0OA 5KU3A 5F36A 4O7BA 4HXKA 4A9MA 5KO4A 3U5OA 5FE1A 2DVVA 5CTLA 4NR4A 4HXNA 4O76A 3U5KA 4X2IA 4O7FA 3U5JA 5ENIA 3LQIA 3U5MA 4QUUA 5FDZA 1EQFA 5FE8A 2KTBB 3SVFA 5IGLA 2G4AA 2MJVB 2OUOA 4YYHA 4Z1SA 5D25A 3DWYA 5CUAA 2L84A 4NYWA 5FH6A 4N4GA 4TS8A 5DYUA 3QZVA 5FE3A 4CURA 4TTEA 2D82A 3IU5A 2YW5A 4UIVA 4YH3A 5EICA 5BT3A 3Q2EA 4YYMA 2YEMA 4IR4A 3MB4A 4N4HA 4YK0A 5E3GA 5FE5A 5C8GA 4HBVA 4A9KA 3LQHA 4UYDA 5DYAA 4NRBA 3P1DA 4QY4A 3FKMX 5DYXA 3D7CA 5A83A 2RNYA 4YYKA 2I8NA 4BW2A 3UVDA 2FSAA 4YATA 2RNXA 5DKCA 5EWCA 4IR6A 5DKDA 3U5PA 5CFWA 5EM3A 4Q0NA 4MR4A 4A9IA 4XYAA 5C4QA 3IU6A 5A7CA 4F3IA 4CUPA 5HLSA 5ENFA 5FE9A 2YELA 4Z6IA 4NR7A 4ZC9A 5CQAA 5EWWA 5CQ8A 2YDWA 4LRGA 4IORA 5HRXA 5BT5A 4TT2A 5E9KA 4MR5A 4A9OA 3DAIA 3JVKA 4YY6A 3UV2A 4N3WA 4YBTA 4N4IA 4QR5A 5EP7A 5F1LA 3G0LA 2E7NA 3UV4A 5I7XA 4QBMA 2I7KA 4LZRA 5DFDA 5CPEA 5COIA 4TZ2A 4XUBA 5A5QA 4MEOA 2R0VA 5IGMA 1F68A 4OGJA 3I3JA 5TCMA 5CRZA 3U5LA 5HENA 5I88A 5CQ6A 2H60A 3P1FA 4TU6A 4Z6HA 4NYVA 4UYGA 5E3DA 4CUQA 5AD3A 5LKXA 2DATA 4QSWA 4QC3A 4UIZA 4QR4A 4NYXA 2OSSA 5HFQA 5C85A 4UIUA 2LSPB 3MULA 5E9LA 4QUTA 5CUGA 5I7YA 3U5NA 5FE0A 5I80A 3JVMA 4LZ2A 4ALHA 4YABA 4O78A 4NQNA 3HMFA 4CFKA 5EK9A 5E73A 5DLZA 4CFLA 1E6IA 4GPJA 4UYFA 4MEPA 4TZ8A 4J3IA 5D3SA 4N4FA 5HELA 3LQJA 4C66A 5EA1A 3UVWA 3HMHA 1ZS5A 4HXLA 5K29A 4Z93A 4TT6A 2GRCA 4NUDA 5I40A 5CQ5A 5II2A 5HQ5A 5G4RA 4PTBA 4QSTA 5ETDA 5IBNA 4YADA 5BT4A 3RCWA 3UV5A 4CLBA 4QB3A 4LYWA 5LJ2A 4PCEA 5FBXA 5L98A 3AADA 4LZSA 5EGUA 3O33A 5H1TA 5CQ7A 4BHWA 4QSSA 2YQDA 5EPSA 5D3NA 4QSQA 5ACYA 3HMEA 5FFYA 5CRMA 4BJXA 5C7NA 5HRWA 3O34A 3ONIA 5FG6A 3S92A 4O71A 2RS9B 5E9YA 5ENCA 5CS8A 4E96A 5E7DA 5F25A 4Z1QA 4HXRA 4QYLA 5CU8A 5HJCA 2F6NA 5H1UA 1X0JA 2F6JA 3K2JA 5D3LA 4QSUA 3UVYA 5DBMA 2R0YA 4A9NA 4QNSA 5F3AA 5DLXA 4QR3A 5EI4A 5CUCA 5E0RA 5IG6A 4QEVA 2DVSA 2RNWA 5FFWA 5LJ1A 5FG5A 5C89A 4O7EA 5AMFA 5L99A 4TT4A 5FH7A 3MQMA 4ZQLA 3UVXA 5KHMA 4NR8A 4LYIA 4KV4A 5KTUA 4OGIA 4A9JA 4XY9A 5DW1A 5LUUA 5EPRA 5F62A 2WP2A 4NR5A 2DVRA 3S91A 4CUUA 4HXSA 4YYGA 2DKWA 4Y03A 5EWVA 5HEMA 5IGKA 5EPBA 2E3KA 4ALGA 5G4SA 5F1HA 5A85A 4A9LA 5D7XA 5EISA 4YYNA 4O7AA 4QSPA 4QZSA 4O77A 4CUSA 5E9MA 5L8UA 4NRCA 4NR6A 4TYLA 5ENEA 2DVQA 3O36A 4YYIA 4NRAA 5CZGA 4LR6A 3G0JA 5E74A 5EQ1A 3QZSA 5CY9A 4IOQA 4C67A 5DFBA 5II1A 4A9EA 4LYSA 3P1CA 5F5ZA 5FE7A 3MUKA 4KV1A 4HXOA 4WIVA 5F60A 4YBMA 5ENJA 5F2PA 4FLPA 2E7OA 4A9FA 5L8TA 5CUEA 5EV9A 5CUDA 2D9EA 5ENHA 4YBSA 4WHUA 4BW1A 5FG4A 4IR5A 5ETBA 1WUMA 4KCXA 5DFCA 5I83A 5I1QA 5J0DA 3AQAA 4UIWA 3Q2FA 3NXBA 2RI7A 4NR9A 4MENA 5FE4A 4AKNA 4NQMA 5CQTA 4PKLA 5I29A 5LKTA 5FE2A 2L85A 5F61A 4UIYA 5JWMA 5KTXA 4A9HA 4O72A 5FE6A 4QYDA 5EWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB0 A;  4YY4 A;  5D3J A;  5D3P A;  5C87 A;  2YEK A;  4NS5 A;  4NXJ A;  3SVH A;  4QSR A;  4TU4 A;  5EU1 A;  5H1V A;  5IGN A;  5A5N A;  3MB3 A;  1N72 A;  4WHW A;  3SVG A;  4NUC A;  4O7C A;  3TLP A;  4BW3 A;  5E9I A;  5A5O A;  5A5P A;  5D24 A;  5LJ0 A;  5LVQ A;  5DY7 A;  3JVL A;  3QZT A;  5A81 A;  4PS5 A;  4PY6 A;  4XUA A;  5I89 A;  4QEW A;  2OO1 A;  4MR3 A;  4YYJ A;  4YH4 A;  5CQ3 A;  5CGP A;  4J1P A;  4J0R A;  5DX4 A;  5A82 A;  5DYC A;  2DWW A;  5I86 A;  2R10 A;  4YAX A;  5JI8 A;  4CUT A;  4CL9 A;  4PCI A;  5D3H A;  5FH8 A;  1JSP B;  4UYE A;  4QEU A;  5A5R A;  4O75 A;  2RO1 A;  4UYH A;  4UIX A;  5D26 A;  2R0S A;  4MR6 A;  5LVR A;  4HXP A;  5CQ4 A;  1JM4 B;  3LJW A;  5EWD A;  1WUG A;  2RFJ A;  3O35 A;  4HBX A;  5CP5 A;  5A5S A;  4QSV A;  5CUB A;  3O37 A;  4O74 A;  5EVA A;  5LKZ A;  4MEQ A;  5LKU A;  4BW4 A;  4OUF A;  5TB6 A;  5KTW A;  4QC1 A;  5HFR A;  5E9V A;  4LC2 A;  5H85 A;  5HRV A;  5IID A;  3MXF A;  4ZW1 A;  4HXM A;  5DKH A;  4O70 A;  5HQ6 A;  5D0C A;  5DW2 A;  4HBW A;  5ENG A;  4YYD A;  4NUE A;  4UYF B;  4YC9 A;  5AME A;  3P1E A;  4DON A;  5F63 A;  5ENB A;  4TQN A;  5HQ7 A;  2N9G A;  5L96 A;  4XY8 A;  3LXJ A;  3JVJ A;  5HCL A;  5D3T A;  2NXB A;  4LDF A;  2YYN A;  3GG3 A;  5L97 A;  5FB1 A;  5FFV A;  4RVR A;  4UIT A;  3ZYU A;  3UW9 A;  4QSX A;  4IOO A;  3P5O A;  5D3R A;  2L5E A;  4IR3 A;  4HBY A;  5HM0 A;  2WP1 A;  5AD2 A;  4J0S A;  4Q0O A;  5KU3 A;  5F36 A;  4O7B A;  4HXK A;  4A9M A;  5KO4 A;  3U5O A;  5FE1 A;  2DVV A;  5CTL A;  4NR4 A;  4HXN A;  4O76 A;  3U5K A;  4X2I A;  4O7F A;  3U5J A;  5ENI A;  3LQI A;  3U5M A;  4QUU A;  5FDZ A;  1EQF A;  5FE8 A;  2KTB B;  3SVF A;  5IGL A;  2G4A A;  2MJV B;  2OUO A;  4YYH A;  4Z1S A;  5D25 A;  3DWY A;  5CUA A;  2L84 A;  4NYW A;  5FH6 A;  4N4G A;  4TS8 A;  5DYU A;  3QZV A;  5FE3 A;  4CUR A;  4TTE A;  2D82 A;  3IU5 A;  2YW5 A;  4UIV A;  4YH3 A;  5EIC A;  5BT3 A;  3Q2E A;  4YYM A;  2YEM A;  4IR4 A;  3MB4 A;  4N4H A;  4YK0 A;  5E3G A;  5FE5 A;  5C8G A;  4HBV A;  4A9K A;  3LQH A;  4UYD A;  5DYA A;  4NRB A;  3P1D A;  4QY4 A;  3FKM X;  5DYX A;  3D7C A;  5A83 A;  2RNY A;  4YYK A;  2I8N A;  4BW2 A;  3UVD A;  2FSA A;  4YAT A;  2RNX A;  5DKC A;  5EWC A;  4IR6 A;  5DKD A;  3U5P A;  5CFW A;  5EM3 A;  4Q0N A;  4MR4 A;  4A9I A;  4XYA A;  5C4Q A;  3IU6 A;  5A7C A;  4F3I A;  4CUP A;  5HLS A;  5ENF A;  5FE9 A;  2YEL A;  4Z6I A;  4NR7 A;  4ZC9 A;  5CQA A;  5EWW A;  5CQ8 A;  2YDW A;  4LRG A;  4IOR A;  5HRX A;  5BT5 A;  4TT2 A;  5E9K A;  4MR5 A;  4A9O A;  3DAI A;  3JVK A;  4YY6 A;  3UV2 A;  4N3W A;  4YBT A;  4N4I A;  4QR5 A;  5EP7 A;  5F1L A;  3G0L A;  2E7N A;  3UV4 A;  5I7X A;  4QBM A;  2I7K A;  4LZR A;  5DFD A;  5CPE A;  5COI A;  4TZ2 A;  4XUB A;  5A5Q A;  4MEO A;  2R0V A;  5IGM A;  1F68 A;  4OGJ A;  3I3J A;  5TCM A;  5CRZ A;  3U5L A;  5HEN A;  5I88 A;  5CQ6 A;  2H60 A;  3P1F A;  4TU6 A;  4Z6H A;  4NYV A;  4UYG A;  5E3D A;  4CUQ A;  5AD3 A;  5LKX A;  2DAT A;  4QSW A;  4QC3 A;  4UIZ A;  4QR4 A;  4NYX A;  2OSS A;  5HFQ A;  5C85 A;  4UIU A;  2LSP B;  3MUL A;  5E9L A;  4QUT A;  5CUG A;  5I7Y A;  3U5N A;  5FE0 A;  5I80 A;  3JVM A;  4LZ2 A;  4ALH A;  4YAB A;  4O78 A;  4NQN A;  3HMF A;  4CFK A;  5EK9 A;  5E73 A;  5DLZ A;  4CFL A;  1E6I A;  4GPJ A;  4UYF A;  4MEP A;  4TZ8 A;  4J3I A;  5D3S A;  4N4F A;  5HEL A;  3LQJ A;  4C66 A;  5EA1 A;  3UVW A;  3HMH A;  1ZS5 A;  4HXL A;  5K29 A;  4Z93 A;  4TT6 A;  2GRC A;  4NUD A;  5I40 A;  5CQ5 A;  5II2 A;  5HQ5 A;  5G4R A;  4PTB A;  4QST A;  5ETD A;  5IBN A;  4YAD A;  5BT4 A;  3RCW A;  3UV5 A;  4CLB A;  4QB3 A;  4LYW A;  5LJ2 A;  4PCE A;  5FBX A;  5L98 A;  3AAD A;  4LZS A;  5EGU A;  3O33 A;  5H1T A;  5CQ7 A;  4BHW A;  4QSS A;  2YQD A;  5EPS A;  5D3N A;  4QSQ A;  5ACY A;  3HME A;  5FFY A;  5CRM A;  4BJX A;  5C7N A;  5HRW A;  3O34 A;  3ONI A;  5FG6 A;  3S92 A;  4O71 A;  2RS9 B;  5E9Y A;  5ENC A;  5CS8 A;  4E96 A;  5E7D A;  5F25 A;  4Z1Q A;  4HXR A;  4QYL A;  5CU8 A;  5HJC A;  2F6N A;  5H1U A;  1X0J A;  2F6J A;  3K2J A;  5D3L A;  4QSU A;  3UVY A;  5DBM A;  2R0Y A;  4A9N A;  4QNS A;  5F3A A;  5DLX A;  4QR3 A;  5EI4 A;  5CUC A;  5E0R A;  5IG6 A;  4QEV A;  2DVS A;  2RNW A;  5FFW A;  5LJ1 A;  5FG5 A;  5C89 A;  4O7E A;  5AMF A;  5L99 A;  4TT4 A;  5FH7 A;  3MQM A;  4ZQL A;  3UVX A;  5KHM A;  4NR8 A;  4LYI A;  4KV4 A;  5KTU A;  4OGI A;  4A9J A;  4XY9 A;  5DW1 A;  5LUU A;  5EPR A;  5F62 A;  2WP2 A;  4NR5 A;  2DVR A;  3S91 A;  4CUU A;  4HXS A;  4YYG A;  2DKW A;  4Y03 A;  5EWV A;  5HEM A;  5IGK A;  5EPB A;  2E3K A;  4ALG A;  5G4S A;  5F1H A;  5A85 A;  4A9L A;  5D7X A;  5EIS A;  4YYN A;  4O7A A;  4QSP A;  4QZS A;  4O77 A;  4CUS A;  5E9M A;  5L8U A;  4NRC A;  4NR6 A;  4TYL A;  5ENE A;  2DVQ A;  3O36 A;  4YYI A;  4NRA A;  5CZG A;  4LR6 A;  3G0J A;  5E74 A;  5EQ1 A;  3QZS A;  5CY9 A;  4IOQ A;  4C67 A;  5DFB A;  5II1 A;  4A9E A;  4LYS A;  3P1C A;  5F5Z A;  5FE7 A;  3MUK A;  4KV1 A;  4HXO A;  4WIV A;  5F60 A;  4YBM A;  5ENJ A;  5F2P A;  4FLP A;  2E7O A;  4A9F A;  5L8T A;  5CUE A;  5EV9 A;  5CUD A;  2D9E A;  5ENH A;  4YBS A;  4WHU A;  4BW1 A;  5FG4 A;  4IR5 A;  5ETB A;  1WUM A;  4KCX A;  5DFC A;  5I83 A;  5I1Q A;  5J0D A;  3AQA A;  4UIW A;  3Q2F A;  3NXB A;  2RI7 A;  4NR9 A;  4MEN A;  5FE4 A;  4AKN A;  4NQM A;  5CQT A;  4PKL A;  5I29 A;  5LKT A;  5FE2 A;  2L85 A;  5F61 A;  4UIY A;  5JWM A;  5KTX A;  4A9H A;  4O72 A;  5FE6 A;  4QYD A;  5EWH A; 
#chains in the Genus database with same CATH topology
 5FB0 A;  4YY4 A;  5D3J A;  5D3P A;  5C87 A;  2YEK A;  4NS5 A;  4NXJ A;  3SVH A;  4QSR A;  4TU4 A;  5EU1 A;  5H1V A;  5IGN A;  5A5N A;  3MB3 A;  1N72 A;  4WHW A;  3SVG A;  4NUC A;  4O7C A;  3TLP A;  4BW3 A;  5E9I A;  5A5O A;  5A5P A;  5D24 A;  5LJ0 A;  5LVQ A;  5DY7 A;  3JVL A;  3QZT A;  5A81 A;  4PS5 A;  4PY6 A;  4XUA A;  5I89 A;  4QEW A;  2OO1 A;  4MR3 A;  4YYJ A;  4YH4 A;  5CQ3 A;  5CGP A;  4J1P A;  4J0R A;  5DX4 A;  5A82 A;  5DYC A;  2DWW A;  5I86 A;  2R10 A;  1ZKR A;  4YAX A;  5JI8 A;  4CUT A;  4CL9 A;  4PCI A;  5D3H A;  5FH8 A;  1JSP B;  4UYE A;  4QEU A;  5A5R A;  4O75 A;  2RO1 A;  4UYH A;  4UIX A;  5D26 A;  2R0S A;  4MR6 A;  5LVR A;  4HXP A;  5CQ4 A;  1JM4 B;  3LJW A;  5EWD A;  1WUG A;  2RFJ A;  3O35 A;  4HBX A;  5CP5 A;  5A5S A;  4QSV A;  5CUB A;  3O37 A;  4O74 A;  5EVA A;  5LKZ A;  4MEQ A;  4AKG A;  5LKU A;  4BW4 A;  4OUF A;  5TB6 A;  5KTW A;  4QC1 A;  5HFR A;  5E9V A;  4LC2 A;  5H85 A;  5HRV A;  5IID A;  3MXF A;  4ZW1 A;  4HXM A;  5DKH A;  4O70 A;  5HQ6 A;  5D0C A;  5DW2 A;  4HBW A;  5ENG A;  4YYD A;  4NUE A;  4UYF B;  4YC9 A;  5AME A;  3P1E A;  4DON A;  4AKH A;  5F63 A;  5ENB A;  4TQN A;  5HQ7 A;  2N9G A;  5L96 A;  4XY8 A;  3LXJ A;  3JVJ A;  5HCL A;  5D3T A;  2NXB A;  4LDF A;  2YYN A;  3GG3 A;  5L97 A;  5FB1 A;  5FFV A;  4RVR A;  4UIT A;  3ZYU A;  3UW9 A;  4QSX A;  4IOO A;  3P5O A;  5D3R A;  2L5E A;  4IR3 A;  4HBY A;  5HM0 A;  2WP1 A;  5AD2 A;  4J0S A;  4Q0O A;  5KU3 A;  5F36 A;  4O7B A;  4AI6 A;  4HXK A;  4A9M A;  5KO4 A;  3U5O A;  5FE1 A;  2DVV A;  5CTL A;  4NR4 A;  4HXN A;  4O76 A;  3U5K A;  4X2I A;  4O7F A;  3U5J A;  5ENI A;  3LQI A;  3U5M A;  4QUU A;  5FDZ A;  1EQF A;  5FE8 A;  2KTB B;  3SVF A;  5IGL A;  2G4A A;  2MJV B;  2OUO A;  4YYH A;  4Z1S A;  5D25 A;  3DWY A;  5CUA A;  2L84 A;  4NYW A;  5FH6 A;  4N4G A;  4TS8 A;  5DYU A;  3QZV A;  5FE3 A;  4CUR A;  4TTE A;  2D82 A;  3IU5 A;  2YW5 A;  4UIV A;  4YH3 A;  5EIC A;  5BT3 A;  3Q2E A;  4YYM A;  2YEM A;  2EJN A;  4IR4 A;  3MB4 A;  4N4H A;  4YK0 A;  5E3G A;  5FE5 A;  5C8G A;  4HBV A;  4A9K A;  3LQH A;  4UYD A;  5DYA A;  4NRB A;  3P1D A;  4QY4 A;  3FKM X;  5DYX A;  3D7C A;  5A83 A;  2RNY A;  4YYK A;  2I8N A;  4BW2 A;  3UVD A;  2FSA A;  4YAT A;  2RNX A;  5DKC A;  5EWC A;  4IR6 A;  5DKD A;  3U5P A;  5CFW A;  5EM3 A;  4Q0N A;  4MR4 A;  4A9I A;  4XYA A;  5C4Q A;  3IU6 A;  5A7C A;  4F3I A;  4CUP A;  5HLS A;  4AKI A;  5ENF A;  5FE9 A;  2YEL A;  4Z6I A;  4NR7 A;  4ZC9 A;  5CQA A;  5EWW A;  5CQ8 A;  2YDW A;  4LRG A;  4IOR A;  5HRX A;  5BT5 A;  4TT2 A;  5E9K A;  4MR5 A;  4A9O A;  3DAI A;  3JVK A;  4YY6 A;  3ERR A;  3UV2 A;  4N3W A;  4YBT A;  4N4I A;  4QR5 A;  5EP7 A;  5F1L A;  3G0L A;  2E7N A;  3UV4 A;  5I7X A;  4QBM A;  2I7K A;  4LZR A;  5DFD A;  5CPE A;  5COI A;  4TZ2 A;  4XUB A;  5A5Q A;  4MEO A;  2R0V A;  5IGM A;  1F68 A;  4OGJ A;  3I3J A;  5TCM A;  5CRZ A;  3U5L A;  3D1D A;  5HEN A;  5I88 A;  5CQ6 A;  2H60 A;  3P1F A;  4TU6 A;  4Z6H A;  4NYV A;  4UYG A;  5E3D A;  4CUQ A;  5AD3 A;  5LKX A;  2DAT A;  4QSW A;  4QC3 A;  4UIZ A;  4QR4 A;  4NYX A;  2OSS A;  5HFQ A;  5C85 A;  4UIU A;  2LSP B;  3MUL A;  5E9L A;  4QUT A;  5CUG A;  5I7Y A;  3U5N A;  5FE0 A;  5I80 A;  3JVM A;  4LZ2 A;  4ALH A;  4YAB A;  4O78 A;  4NQN A;  3HMF A;  4CFK A;  5EK9 A;  5E73 A;  5DLZ A;  4CFL A;  1E6I A;  4GPJ A;  4UYF A;  4MEP A;  4TZ8 A;  4J3I A;  5D3S A;  4N4F A;  5HEL A;  3LQJ A;  4C66 A;  5EA1 A;  3UVW A;  3HMH A;  1ZS5 A;  4HXL A;  5K29 A;  3VKH A;  4Z93 A;  4TT6 A;  2GRC A;  4NUD A;  5I40 A;  5CQ5 A;  5II2 A;  5HQ5 A;  5G4R A;  4PTB A;  4QST A;  5ETD A;  5IBN A;  4YAD A;  5BT4 A;  3RCW A;  3UV5 A;  4CLB A;  4QB3 A;  4LYW A;  5LJ2 A;  4PCE A;  5FBX A;  5L98 A;  3AAD A;  4LZS A;  5EGU A;  3O33 A;  5H1T A;  5CQ7 A;  4BHW A;  4QSS A;  2YQD A;  5EPS A;  5D3N A;  4QSQ A;  5ACY A;  3HME A;  5FFY A;  5CRM A;  4BJX A;  5C7N A;  5HRW A;  3O34 A;  3ONI A;  5FG6 A;  3S92 A;  4O71 A;  2RS9 B;  5E9Y A;  5ENC A;  5CS8 A;  4E96 A;  5E7D A;  5F25 A;  4Z1Q A;  4HXR A;  4QYL A;  5CU8 A;  5HJC A;  2F6N A;  5H1U A;  1X0J A;  2F6J A;  3K2J A;  5D3L A;  4QSU A;  3UVY A;  5DBM A;  2R0Y A;  4A9N A;  4QNS A;  5F3A A;  5DLX A;  4QR3 A;  5EI4 A;  5CUC A;  5E0R A;  5IG6 A;  4QEV A;  2DVS A;  2RNW A;  5FFW A;  5LJ1 A;  5FG5 A;  5C89 A;  4O7E A;  5AMF A;  5L99 A;  4TT4 A;  5FH7 A;  3MQM A;  4ZQL A;  3UVX A;  5KHM A;  4NR8 A;  4LYI A;  4KV4 A;  5KTU A;  4OGI A;  4A9J A;  4XY9 A;  5DW1 A;  5LUU A;  5EPR A;  5F62 A;  2WP2 A;  4NR5 A;  2DVR A;  3S91 A;  4CUU A;  4HXS A;  4YYG A;  2DKW A;  4Y03 A;  5EWV A;  5HEM A;  5IGK A;  5EPB A;  2E3K A;  4ALG A;  5G4S A;  5F1H A;  5A85 A;  4A9L A;  5D7X A;  5EIS A;  4YYN A;  4O7A A;  4QSP A;  4QZS A;  4O77 A;  4CUS A;  5E9M A;  5L8U A;  4NRC A;  3D1B A;  4NR6 A;  4TYL A;  5ENE A;  2DVQ A;  3O36 A;  4YYI A;  4NRA A;  5CZG A;  4LR6 A;  3G0J A;  5E74 A;  5EQ1 A;  3QZS A;  5CY9 A;  4IOQ A;  4C67 A;  5DFB A;  5II1 A;  4A9E A;  4LYS A;  3P1C A;  5F5Z A;  5FE7 A;  3MUK A;  4KV1 A;  4HXO A;  4WIV A;  5F60 A;  4YBM A;  5ENJ A;  5F2P A;  4FLP A;  2E7O A;  4A9F A;  5L8T A;  5CUE A;  5EV9 A;  5CUD A;  2D9E A;  5ENH A;  4YBS A;  4WHU A;  1PUO A;  4BW1 A;  5FG4 A;  4IR5 A;  5ETB A;  1WUM A;  4KCX A;  5DFC A;  5I83 A;  3VKG A;  5I1Q A;  5J0D A;  3AQA A;  4UIW A;  3Q2F A;  3NXB A;  2RI7 A;  4NR9 A;  4MEN A;  5FE4 A;  4AKN A;  4NQM A;  5CQT A;  4PKL A;  5I29 A;  5LKT A;  5FE2 A;  2L85 A;  5F61 A;  4UIY A;  5JWM A;  5KTX A;  4A9H A;  4O72 A;  5FE6 A;  4QYD A;  5EWH A; 
#chains in the Genus database with same CATH homology
 5FB0 A;  4YY4 A;  5D3J A;  5D3P A;  5C87 A;  2YEK A;  4NS5 A;  4NXJ A;  3SVH A;  4QSR A;  4TU4 A;  5EU1 A;  5H1V A;  5IGN A;  5A5N A;  3MB3 A;  1N72 A;  4WHW A;  3SVG A;  4NUC A;  4O7C A;  3TLP A;  4BW3 A;  5E9I A;  5A5O A;  5A5P A;  5D24 A;  5LJ0 A;  5LVQ A;  5DY7 A;  3JVL A;  3QZT A;  5A81 A;  4PS5 A;  4PY6 A;  4XUA A;  5I89 A;  4QEW A;  2OO1 A;  4MR3 A;  4YYJ A;  4YH4 A;  5CQ3 A;  5CGP A;  4J1P A;  4J0R A;  5DX4 A;  5A82 A;  5DYC A;  2DWW A;  5I86 A;  2R10 A;  4YAX A;  5JI8 A;  4CUT A;  4CL9 A;  4PCI A;  5D3H A;  5FH8 A;  1JSP B;  4UYE A;  4QEU A;  5A5R A;  4O75 A;  2RO1 A;  4UYH A;  4UIX A;  5D26 A;  2R0S A;  4MR6 A;  5LVR A;  4HXP A;  5CQ4 A;  1JM4 B;  3LJW A;  5EWD A;  1WUG A;  2RFJ A;  3O35 A;  4HBX A;  5CP5 A;  5A5S A;  4QSV A;  5CUB A;  3O37 A;  4O74 A;  5EVA A;  5LKZ A;  4MEQ A;  5LKU A;  4BW4 A;  4OUF A;  5TB6 A;  5KTW A;  4QC1 A;  5HFR A;  5E9V A;  4LC2 A;  5H85 A;  5HRV A;  5IID A;  3MXF A;  4ZW1 A;  4HXM A;  5DKH A;  4O70 A;  5HQ6 A;  5D0C A;  5DW2 A;  4HBW A;  5ENG A;  4YYD A;  4NUE A;  4UYF B;  4YC9 A;  5AME A;  3P1E A;  4DON A;  5F63 A;  5ENB A;  4TQN A;  5HQ7 A;  2N9G A;  5L96 A;  4XY8 A;  3LXJ A;  3JVJ A;  5HCL A;  5D3T A;  2NXB A;  4LDF A;  2YYN A;  3GG3 A;  5L97 A;  5FB1 A;  5FFV A;  4RVR A;  4UIT A;  3ZYU A;  3UW9 A;  4QSX A;  4IOO A;  3P5O A;  5D3R A;  2L5E A;  4IR3 A;  4HBY A;  5HM0 A;  2WP1 A;  5AD2 A;  4J0S A;  4Q0O A;  5KU3 A;  5F36 A;  4O7B A;  4HXK A;  4A9M A;  5KO4 A;  3U5O A;  5FE1 A;  2DVV A;  5CTL A;  4NR4 A;  4HXN A;  4O76 A;  3U5K A;  4X2I A;  4O7F A;  3U5J A;  5ENI A;  3LQI A;  3U5M A;  4QUU A;  5FDZ A;  1EQF A;  5FE8 A;  2KTB B;  3SVF A;  5IGL A;  2G4A A;  2MJV B;  2OUO A;  4YYH A;  4Z1S A;  5D25 A;  3DWY A;  5CUA A;  2L84 A;  4NYW A;  5FH6 A;  4N4G A;  4TS8 A;  5DYU A;  3QZV A;  5FE3 A;  4CUR A;  4TTE A;  2D82 A;  3IU5 A;  2YW5 A;  4UIV A;  4YH3 A;  5EIC A;  5BT3 A;  3Q2E A;  4YYM A;  2YEM A;  4IR4 A;  3MB4 A;  4N4H A;  4YK0 A;  5E3G A;  5FE5 A;  5C8G A;  4HBV A;  4A9K A;  3LQH A;  4UYD A;  5DYA A;  4NRB A;  3P1D A;  4QY4 A;  3FKM X;  5DYX A;  3D7C A;  5A83 A;  2RNY A;  4YYK A;  2I8N A;  4BW2 A;  3UVD A;  2FSA A;  4YAT A;  2RNX A;  5DKC A;  5EWC A;  4IR6 A;  5DKD A;  3U5P A;  5CFW A;  5EM3 A;  4Q0N A;  4MR4 A;  4A9I A;  4XYA A;  5C4Q A;  3IU6 A;  5A7C A;  4F3I A;  4CUP A;  5HLS A;  5ENF A;  5FE9 A;  2YEL A;  4Z6I A;  4NR7 A;  4ZC9 A;  5CQA A;  5EWW A;  5CQ8 A;  2YDW A;  4LRG A;  4IOR A;  5HRX A;  5BT5 A;  4TT2 A;  5E9K A;  4MR5 A;  4A9O A;  3DAI A;  3JVK A;  4YY6 A;  3UV2 A;  4N3W A;  4YBT A;  4N4I A;  4QR5 A;  5EP7 A;  5F1L A;  3G0L A;  2E7N A;  3UV4 A;  5I7X A;  4QBM A;  2I7K A;  4LZR A;  5DFD A;  5CPE A;  5COI A;  4TZ2 A;  4XUB A;  5A5Q A;  4MEO A;  2R0V A;  5IGM A;  1F68 A;  4OGJ A;  3I3J A;  5TCM A;  5CRZ A;  3U5L A;  5HEN A;  5I88 A;  5CQ6 A;  2H60 A;  3P1F A;  4TU6 A;  4Z6H A;  4NYV A;  4UYG A;  5E3D A;  4CUQ A;  5AD3 A;  5LKX A;  2DAT A;  4QSW A;  4QC3 A;  4UIZ A;  4QR4 A;  4NYX A;  2OSS A;  5HFQ A;  5C85 A;  4UIU A;  2LSP B;  3MUL A;  5E9L A;  4QUT A;  5CUG A;  5I7Y A;  3U5N A;  5FE0 A;  5I80 A;  3JVM A;  4LZ2 A;  4ALH A;  4YAB A;  4O78 A;  4NQN A;  3HMF A;  4CFK A;  5EK9 A;  5E73 A;  5DLZ A;  4CFL A;  1E6I A;  4GPJ A;  4UYF A;  4MEP A;  4TZ8 A;  4J3I A;  5D3S A;  4N4F A;  5HEL A;  3LQJ A;  4C66 A;  5EA1 A;  3UVW A;  3HMH A;  1ZS5 A;  4HXL A;  5K29 A;  4Z93 A;  4TT6 A;  2GRC A;  4NUD A;  5I40 A;  5CQ5 A;  5II2 A;  5HQ5 A;  5G4R A;  4PTB A;  4QST A;  5ETD A;  5IBN A;  4YAD A;  5BT4 A;  3RCW A;  3UV5 A;  4CLB A;  4QB3 A;  4LYW A;  5LJ2 A;  4PCE A;  5FBX A;  5L98 A;  3AAD A;  4LZS A;  5EGU A;  3O33 A;  5H1T A;  5CQ7 A;  4BHW A;  4QSS A;  2YQD A;  5EPS A;  5D3N A;  4QSQ A;  5ACY A;  3HME A;  5FFY A;  5CRM A;  4BJX A;  5C7N A;  5HRW A;  3O34 A;  3ONI A;  5FG6 A;  3S92 A;  4O71 A;  2RS9 B;  5E9Y A;  5ENC A;  5CS8 A;  4E96 A;  5E7D A;  5F25 A;  4Z1Q A;  4HXR A;  4QYL A;  5CU8 A;  5HJC A;  2F6N A;  5H1U A;  1X0J A;  2F6J A;  3K2J A;  5D3L A;  4QSU A;  3UVY A;  5DBM A;  2R0Y A;  4A9N A;  4QNS A;  5F3A A;  5DLX A;  4QR3 A;  5EI4 A;  5CUC A;  5E0R A;  5IG6 A;  4QEV A;  2DVS A;  2RNW A;  5FFW A;  5LJ1 A;  5FG5 A;  5C89 A;  4O7E A;  5AMF A;  5L99 A;  4TT4 A;  5FH7 A;  3MQM A;  4ZQL A;  3UVX A;  5KHM A;  4NR8 A;  4LYI A;  4KV4 A;  5KTU A;  4OGI A;  4A9J A;  4XY9 A;  5DW1 A;  5LUU A;  5EPR A;  5F62 A;  2WP2 A;  4NR5 A;  2DVR A;  3S91 A;  4CUU A;  4HXS A;  4YYG A;  2DKW A;  4Y03 A;  5EWV A;  5HEM A;  5IGK A;  5EPB A;  2E3K A;  4ALG A;  5G4S A;  5F1H A;  5A85 A;  4A9L A;  5D7X A;  5EIS A;  4YYN A;  4O7A A;  4QSP A;  4QZS A;  4O77 A;  4CUS A;  5E9M A;  5L8U A;  4NRC A;  4NR6 A;  4TYL A;  5ENE A;  2DVQ A;  3O36 A;  4YYI A;  4NRA A;  5CZG A;  4LR6 A;  3G0J A;  5E74 A;  5EQ1 A;  3QZS A;  5CY9 A;  4IOQ A;  4C67 A;  5DFB A;  5II1 A;  4A9E A;  4LYS A;  3P1C A;  5F5Z A;  5FE7 A;  3MUK A;  4KV1 A;  4HXO A;  4WIV A;  5F60 A;  4YBM A;  5ENJ A;  5F2P A;  4FLP A;  2E7O A;  4A9F A;  5L8T A;  5CUE A;  5EV9 A;  5CUD A;  2D9E A;  5ENH A;  4YBS A;  4WHU A;  4BW1 A;  5FG4 A;  4IR5 A;  5ETB A;  1WUM A;  4KCX A;  5DFC A;  5I83 A;  5I1Q A;  5J0D A;  3AQA A;  4UIW A;  3Q2F A;  3NXB A;  2RI7 A;  4NR9 A;  4MEN A;  5FE4 A;  4AKN A;  4NQM A;  5CQT A;  4PKL A;  5I29 A;  5LKT A;  5FE2 A;  2L85 A;  5F61 A;  4UIY A;  5JWM A;  5KTX A;  4A9H A;  4O72 A;  5FE6 A;  4QYD A;  5EWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...