5CY9A

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
HLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5cy9A01
2H60A 2RNXA 2NXBA 4KCXA 4YYIA 2R0YA 5KHMA 5F2PA 5F62A 4MR4A 4TS8A 2YQDA 5FBXA 4YYJA 5DLZA 5FFWA 5IGLA 4QC1A 4O77A 3U5LA 2DATA 3HMEA 4NXJA 4BW2A 5H1UA 4O7CA 5FFVA 4ZW1A 4N4FA 1WUGA 1WUMA 2F6JA 4QSWA 5G4RA 3O35A 4HXOA 4NQNA 4CUSA 5DW2A 5KU3A 4O7FA 5FB0A 5F61A 5KTWA 2RFJA 5D3NA 5FE1A 3G0JA 5JI8A 3IU5A 4UIUA 4CFLA 4BJXA 4A9KA 4UIWA 1N72A 5I80A 5ENCA 4KV1A 3P1DA 5I89A 2E7OA 3O33A 4O72A 1JSPB 4QEUA 3I3JA 3HMHA 5EGUA 5E73A 4KV4A 5A81A 3RCWA 5AD2A 4CUTA 3MB4A 4MR3A 4O7AA 3ONIA 5FDZA 3FKMX 4QSPA 4Z6IA 4XYAA 4PCEA 4J0SA 5E0RA 3K2JA 5ETDA 4UIXA 4TTEA 4NR5A 5L97A 4QBMA 5LKTA 5E9LA 4LYSA 2D9EA 4QSUA 1ZS5A 5LJ0A 4QUTA 5C8GA 4HXRA 4UYDA 5E3DA 4HXKA 4AKNA 4O71A 4N3WA 4QSQA 4Z1SA 5A7CA 4LZ2A 4NR7A 5FG6A 5ENBA 5IGKA 4A9JA 5HQ6A 3U5PA 4OUFA 4XY8A 5L98A 5COIA 3UV2A 4NR6A 2WP2A 3SVFA 5E9MA 5EWCA 4YBSA 5IIDA 3LQHA 4NUCA 3UVXA 5LKXA 2G4AA 2KTBB 3GG3A 4YC9A 5CTLA 4HBYA 5LVQA 2DVVA 4O7BA 5FE5A 4YYNA 4PKLA 5F1HA 5I88A 4HBVA 5DYUA 4TT4A 4C66A 4A9MA 4MEOA 3S91A 3MXFA 3O36A 5EA1A 5HQ5A 4Q0OA 5CUGA 4YH3A 5E9YA 4ALGA 5LKUA 4A9NA 4MEPA 2I7KA 5HEMA 5ACYA 5EK9A 4Z6HA 2YEKA 4A9HA 5I7YA 5CRMA 5CRZA 5H1TA 3P5OA 4NRBA 3JVMA 4YY6A 2I8NA 5C87A 3P1CA 5BT3A 5DYAA 3QZSA 4NR4A 4UIYA 5DW1A 5TB6A 5K29A 5EU1A 4CFKA 5FE9A 4QUUA 5FE8A 4LZSA 2WP1A 3QZTA 3Q2FA 4NR8A 4O7EA 4UIVA 5II2A 3IU6A 5F25A 4YBMA 5DFDA 5D25A 4WHUA 2OO1A 4MENA 4O75A 3U5OA 2YELA 4Q0NA 4QB3A 4HXLA 1X0JA 5KTXA 3D7CA 5I7XA 2RO1A 4NRCA 5C85A 5D7XA 4QSVA 1E6IA 4GPJA 2DKWA 3NXBA 4NYVA 2R0VA 5KTUA 4HXPA 5A5NA 2E7NA 3U5JA 4IOQA 4TT2A 2D82A 3UVYA 4A9IA 5LJ1A 5CU8A 4QSXA 5EICA 5J0DA 5HM0A 5F1LA 4C67A 4QYLA 4LYWA 5H1VA 4YYHA 5D26A 4TYLA 5A83A 5JWMA 5EM3A 5A85A 4QR3A 5E3GA 5HLSA 5D3SA 5FE4A 3QZVA 4YABA 2YYNA 5II1A 4N4GA 2YW5A 5E7DA 4YK0A 5CGPA 4LZRA 5EI4A 2L84A 3P1EA 5DKHA 4WHWA 4PY6A 5G4SA 5HRVA 5LUUA 5FB1A 3UV5A 4X2IA 5HFRA 3U5MA 5CQ7A 5CFWA 5DX4A 5EISA 5FFYA 4QEVA 2RNYA 3LQJA 4N4IA 4XY9A 5F60A 3LQIA 4A9FA 5CQ4A 3JVLA 5I40A 3SVGA 3G0LA 2LSPB 3O37A 5F3AA 5DLXA 5CUAA 5CUDA 2R0SA 5HCLA 4Y03A 4O70A 4QSTA 5CUEA 3S92A 4F3IA 5EPSA 5ENFA 5HRWA 5DFBA 5ENGA 5D24A 1EQFA 4IR4A 4MR5A 4CUQA 4YYKA 4ZC9A 4NR9A 5FH8A 2YEMA 5FH6A 4PTBA 5CZGA 5D3LA 5EPBA 4HXNA 5A5OA 5EVAA 4DONA 4QEWA 4UYHA 3DAIA 5AMEA 5L8TA 5LVRA 4NS5A 5ENIA 4BW1A 4HBWA 5EP7A 4UYFA 2E3KA 3U5NA 4UITA 5EWWA 5BT5A 5FG5A 2GRCA 2MJVB 3ZYUA 5FE0A 4MR6A 5FE6A 4QSRA 5IGMA 2L85A 5A5QA 5LJ2A 4YAXA 5E9IA 5F36A 4QSSA 5CQAA 4ALHA 2OSSA 5EQ1A 4OGJA 4QR4A 5E9KA 4A9OA 2RS9B 5C4QA 2FSAA 4O74A 3U5KA 4QNSA 4HXMA 4YYGA 4YATA 5L8UA 5F5ZA 5CQ5A 5HENA 5D3PA 5D3HA 3Q2EA 5CQ8A 4NQMA 4HBXA 4YADA 5FE3A 5A5PA 4YH4A 3LJWA 4N4HA 5A5RA 5C7NA 2DWWA 2OUOA 2N9GA 4HXSA 4J3IA 3TLPA 5KO4A 5ENEA 4QR5A 5E74A 3MUKA 4IR3A 4NYWA 3UV4A 3LXJA 4QYDA 4YY4A 4BW3A 5FE2A 4Z1QA 4LYIA 4E96A 3MULA 4MEQA 5CUBA 5CQTA 5L99A 4PS5A 4NUEA 3UVDA 3JVJA 4CUPA 4J0RA 3SVHA 5CQ6A 4LC2A 4CLBA 5ENHA 5HFQA 2F6NA 5L96A 1F68A 4XUAA 4A9LA 4FLPA 4IR6A 5E9VA 4LRGA 5BT4A 4A9EA 4UIZA 4UYGA 4NRAA 4TU4A 5CS8A 4TZ2A 4ZQLA 4CURA 5EWHA 4QZSA 5D3RA 5D0CA 4OGIA 4IORA 5FG4A 3JVKA 4YBTA 4YYDA 3HMFA 4UYEA 5DYCA 4LDFA 5I29A 4TT6A 3DWYA 2DVSA 3O34A 4RVRA 5H85A 5EPRA 4UYFB 5A82A 2L5EA 4XUBA 3P1FA 5I1QA 4IR5A 4TU6A 5HQ7A 4PCIA 5ENJA 3AADA 4IOOA 5EWDA 5HELA 5IBNA 5CPEA 5EWVA 4NYXA 5FH7A 4YYMA 2DVQA 2YDWA 4TQNA 5CQ3A 5C89A 5DFCA 5IG6A 5FE7A 5CP5A 4BW4A 5HJCA 4QY4A 5I83A 2RNWA 4O78A 5ETBA 3MQMA 4BHWA 4O76A 5LKZA 5DKDA 5A5SA 5DBMA 4J1PA 5CUCA 3UW9A 5F63A 4CUUA 2RI7A 4CL9A 5EV9A 3AQAA 4LR6A 5DKCA 5DY7A 5DYXA 4NUDA 2DVRA 5AMFA 1JM4B 3MB3A 4QC3A 5CY9A 4Z93A 5I86A 5D3TA 5HRXA 5TCMA 5AD3A 4WIVA 3UVWA 5IGNA 2R10A 4TZ8A 5D3JA
chains in the Genus database with same CATH superfamily
2H60A 2RNXA 2NXBA 4KCXA 4YYIA 2R0YA 5KHMA 5F2PA 5F62A 4MR4A 4TS8A 2YQDA 5FBXA 4YYJA 5DLZA 5FFWA 5IGLA 4QC1A 4O77A 3U5LA 2DATA 3HMEA 4NXJA 4BW2A 5H1UA 4O7CA 5FFVA 4ZW1A 4N4FA 1WUGA 1WUMA 2F6JA 4QSWA 5G4RA 4AKIA 3O35A 4HXOA 4NQNA 4CUSA 5DW2A 5KU3A 4O7FA 5FB0A 5F61A 5KTWA 2RFJA 5D3NA 5FE1A 3G0JA 5JI8A 3IU5A 4UIUA 4CFLA 4BJXA 4A9KA 4UIWA 1N72A 5I80A 5ENCA 4KV1A 3P1DA 5I89A 2E7OA 1ZKRA 3O33A 4O72A 1JSPB 4QEUA 3I3JA 3HMHA 5EGUA 5E73A 4KV4A 5A81A 3RCWA 5AD2A 4CUTA 3MB4A 4MR3A 4O7AA 3ONIA 5FDZA 3FKMX 4QSPA 4Z6IA 4XYAA 4PCEA 4J0SA 5E0RA 3K2JA 5ETDA 4UIXA 4TTEA 4NR5A 5L97A 4QBMA 5LKTA 5E9LA 4LYSA 2D9EA 4QSUA 1ZS5A 5LJ0A 4QUTA 5C8GA 4HXRA 4UYDA 5E3DA 4HXKA 4AKNA 4O71A 4N3WA 4QSQA 4Z1SA 5A7CA 4LZ2A 4NR7A 5FG6A 5ENBA 5IGKA 4A9JA 5HQ6A 3U5PA 4OUFA 4XY8A 5L98A 5COIA 3UV2A 4NR6A 2WP2A 3SVFA 5E9MA 5EWCA 4YBSA 5IIDA 3LQHA 2EJNA 4NUCA 3UVXA 5LKXA 2G4AA 2KTBB 3GG3A 4YC9A 5CTLA 4HBYA 5LVQA 2DVVA 4O7BA 5FE5A 4YYNA 4PKLA 5F1HA 5I88A 4HBVA 5DYUA 4TT4A 4C66A 4A9MA 4MEOA 3S91A 3MXFA 3O36A 5EA1A 5HQ5A 4Q0OA 5CUGA 4YH3A 5E9YA 4ALGA 5LKUA 4A9NA 4MEPA 4AKGA 2I7KA 5HEMA 5ACYA 5EK9A 4Z6HA 2YEKA 4A9HA 5I7YA 5CRMA 5CRZA 5H1TA 3P5OA 4NRBA 3JVMA 4AI6A 4YY6A 2I8NA 5C87A 3P1CA 5BT3A 5DYAA 3QZSA 4NR4A 4UIYA 5DW1A 5TB6A 5K29A 5EU1A 4CFKA 5FE9A 4QUUA 5FE8A 4LZSA 2WP1A 3QZTA 3Q2FA 4NR8A 4O7EA 4UIVA 5II2A 3IU6A 5F25A 4YBMA 5DFDA 5D25A 4WHUA 2OO1A 4MENA 4O75A 3U5OA 2YELA 4Q0NA 4QB3A 4HXLA 3VKGA 1X0JA 5KTXA 3D7CA 5I7XA 2RO1A 4NRCA 5C85A 5D7XA 4QSVA 1E6IA 4GPJA 2DKWA 3NXBA 4NYVA 2R0VA 5KTUA 4HXPA 5A5NA 2E7NA 3U5JA 4IOQA 4TT2A 2D82A 3UVYA 4A9IA 5LJ1A 5CU8A 4QSXA 5EICA 5J0DA 5HM0A 5F1LA 4C67A 4QYLA 4LYWA 5H1VA 4YYHA 5D26A 4TYLA 5A83A 5JWMA 5EM3A 5A85A 4QR3A 5E3GA 5HLSA 5D3SA 5FE4A 3QZVA 4YABA 2YYNA 5II1A 4N4GA 2YW5A 5E7DA 4YK0A 5CGPA 4LZRA 5EI4A 2L84A 3P1EA 5DKHA 4WHWA 4PY6A 5G4SA 5HRVA 5LUUA 5FB1A 3UV5A 4AKHA 4X2IA 5HFRA 3U5MA 5CQ7A 5CFWA 5DX4A 5EISA 5FFYA 4QEVA 2RNYA 3LQJA 4N4IA 4XY9A 5F60A 3LQIA 4A9FA 5CQ4A 3JVLA 3D1DA 5I40A 3SVGA 3G0LA 2LSPB 3O37A 5F3AA 5DLXA 5CUAA 5CUDA 2R0SA 5HCLA 4Y03A 4O70A 4QSTA 5CUEA 3S92A 4F3IA 5EPSA 5ENFA 5HRWA 5DFBA 5ENGA 5D24A 1EQFA 4IR4A 4MR5A 4CUQA 3VKHA 4YYKA 4ZC9A 4NR9A 5FH8A 2YEMA 5FH6A 4PTBA 5CZGA 5D3LA 5EPBA 4HXNA 5A5OA 5EVAA 4DONA 4QEWA 4UYHA 3DAIA 5AMEA 5L8TA 5LVRA 4NS5A 5ENIA 4BW1A 4HBWA 5EP7A 4UYFA 2E3KA 3U5NA 4UITA 5EWWA 5BT5A 5FG5A 2GRCA 2MJVB 3ZYUA 5FE0A 4MR6A 5FE6A 4QSRA 5IGMA 2L85A 5A5QA 5LJ2A 4YAXA 5E9IA 5F36A 4QSSA 5CQAA 4ALHA 2OSSA 5EQ1A 4OGJA 4QR4A 5E9KA 4A9OA 2RS9B 5C4QA 2FSAA 4O74A 3U5KA 4QNSA 4HXMA 4YYGA 4YATA 5L8UA 5F5ZA 5CQ5A 5HENA 5D3PA 5D3HA 3Q2EA 5CQ8A 4NQMA 4HBXA 4YADA 5FE3A 5A5PA 4YH4A 3LJWA 4N4HA 5A5RA 5C7NA 2DWWA 2OUOA 2N9GA 4HXSA 4J3IA 3TLPA 5KO4A 5ENEA 4QR5A 5E74A 3MUKA 4IR3A 4NYWA 3UV4A 3LXJA 4QYDA 4YY4A 3ERRA 4BW3A 5FE2A 4Z1QA 4LYIA 4E96A 3MULA 4MEQA 5CUBA 5CQTA 5L99A 4PS5A 4NUEA 3UVDA 3JVJA 4CUPA 4J0RA 3SVHA 5CQ6A 4LC2A 4CLBA 5ENHA 5HFQA 2F6NA 5L96A 1F68A 4XUAA 4A9LA 4FLPA 4IR6A 5E9VA 4LRGA 5BT4A 4A9EA 4UIZA 4UYGA 4NRAA 4TU4A 5CS8A 4TZ2A 4ZQLA 4CURA 5EWHA 4QZSA 5D3RA 5D0CA 4OGIA 4IORA 5FG4A 3JVKA 4YBTA 4YYDA 3HMFA 4UYEA 5DYCA 4LDFA 5I29A 4TT6A 3DWYA 2DVSA 3O34A 4RVRA 5H85A 5EPRA 4UYFB 5A82A 2L5EA 4XUBA 3P1FA 5I1QA 4IR5A 4TU6A 5HQ7A 4PCIA 5ENJA 3AADA 4IOOA 5EWDA 5HELA 5IBNA 5CPEA 5EWVA 4NYXA 5FH7A 4YYMA 2DVQA 2YDWA 4TQNA 5CQ3A 5C89A 5DFCA 5IG6A 5FE7A 5CP5A 4BW4A 5HJCA 4QY4A 5I83A 2RNWA 4O78A 5ETBA 3MQMA 4BHWA 4O76A 5LKZA 5DKDA 5A5SA 5DBMA 4J1PA 5CUCA 3UW9A 5F63A 4CUUA 2RI7A 4CL9A 5EV9A 3AQAA 4LR6A 5DKCA 5DY7A 3D1BA 5DYXA 4NUDA 2DVRA 5AMFA 1JM4B 3MB3A 4QC3A 5CY9A 4Z93A 5I86A 5D3TA 5HRXA 5TCMA 5AD3A 1PUOA 4WIVA 3UVWA 5IGNA 2R10A 4TZ8A 5D3JA
chains in the Genus database with same CATH topology
2H60A 2RNXA 2NXBA 4KCXA 4YYIA 2R0YA 5KHMA 5F2PA 5F62A 4MR4A 4TS8A 2YQDA 5FBXA 4YYJA 5DLZA 5FFWA 5IGLA 4QC1A 4O77A 3U5LA 2DATA 3HMEA 4NXJA 4BW2A 5H1UA 4O7CA 5FFVA 4ZW1A 4N4FA 1WUGA 1WUMA 2F6JA 4QSWA 5G4RA 3O35A 4HXOA 4NQNA 4CUSA 5DW2A 5KU3A 4O7FA 5FB0A 5F61A 5KTWA 2RFJA 5D3NA 5FE1A 3G0JA 5JI8A 3IU5A 4UIUA 4CFLA 4BJXA 4A9KA 4UIWA 1N72A 5I80A 5ENCA 4KV1A 3P1DA 5I89A 2E7OA 3O33A 4O72A 1JSPB 4QEUA 3I3JA 3HMHA 5EGUA 5E73A 4KV4A 5A81A 3RCWA 5AD2A 4CUTA 3MB4A 4MR3A 4O7AA 3ONIA 5FDZA 3FKMX 4QSPA 4Z6IA 4XYAA 4PCEA 4J0SA 5E0RA 3K2JA 5ETDA 4UIXA 4TTEA 4NR5A 5L97A 4QBMA 5LKTA 5E9LA 4LYSA 2D9EA 4QSUA 1ZS5A 5LJ0A 4QUTA 5C8GA 4HXRA 4UYDA 5E3DA 4HXKA 4AKNA 4O71A 4N3WA 4QSQA 4Z1SA 5A7CA 4LZ2A 4NR7A 5FG6A 5ENBA 5IGKA 4A9JA 5HQ6A 3U5PA 4OUFA 4XY8A 5L98A 5COIA 3UV2A 4NR6A 2WP2A 3SVFA 5E9MA 5EWCA 4YBSA 5IIDA 3LQHA 4NUCA 3UVXA 5LKXA 2G4AA 2KTBB 3GG3A 4YC9A 5CTLA 4HBYA 5LVQA 2DVVA 4O7BA 5FE5A 4YYNA 4PKLA 5F1HA 5I88A 4HBVA 5DYUA 4TT4A 4C66A 4A9MA 4MEOA 3S91A 3MXFA 3O36A 5EA1A 5HQ5A 4Q0OA 5CUGA 4YH3A 5E9YA 4ALGA 5LKUA 4A9NA 4MEPA 2I7KA 5HEMA 5ACYA 5EK9A 4Z6HA 2YEKA 4A9HA 5I7YA 5CRMA 5CRZA 5H1TA 3P5OA 4NRBA 3JVMA 4YY6A 2I8NA 5C87A 3P1CA 5BT3A 5DYAA 3QZSA 4NR4A 4UIYA 5DW1A 5TB6A 5K29A 5EU1A 4CFKA 5FE9A 4QUUA 5FE8A 4LZSA 2WP1A 3QZTA 3Q2FA 4NR8A 4O7EA 4UIVA 5II2A 3IU6A 5F25A 4YBMA 5DFDA 5D25A 4WHUA 2OO1A 4MENA 4O75A 3U5OA 2YELA 4Q0NA 4QB3A 4HXLA 1X0JA 5KTXA 3D7CA 5I7XA 2RO1A 4NRCA 5C85A 5D7XA 4QSVA 1E6IA 4GPJA 2DKWA 3NXBA 4NYVA 2R0VA 5KTUA 4HXPA 5A5NA 2E7NA 3U5JA 4IOQA 4TT2A 2D82A 3UVYA 4A9IA 5LJ1A 5CU8A 4QSXA 5EICA 5J0DA 5HM0A 5F1LA 4C67A 4QYLA 4LYWA 5H1VA 4YYHA 5D26A 4TYLA 5A83A 5JWMA 5EM3A 5A85A 4QR3A 5E3GA 5HLSA 5D3SA 5FE4A 3QZVA 4YABA 2YYNA 5II1A 4N4GA 2YW5A 5E7DA 4YK0A 5CGPA 4LZRA 5EI4A 2L84A 3P1EA 5DKHA 4WHWA 4PY6A 5G4SA 5HRVA 5LUUA 5FB1A 3UV5A 4X2IA 5HFRA 3U5MA 5CQ7A 5CFWA 5DX4A 5EISA 5FFYA 4QEVA 2RNYA 3LQJA 4N4IA 4XY9A 5F60A 3LQIA 4A9FA 5CQ4A 3JVLA 5I40A 3SVGA 3G0LA 2LSPB 3O37A 5F3AA 5DLXA 5CUAA 5CUDA 2R0SA 5HCLA 4Y03A 4O70A 4QSTA 5CUEA 3S92A 4F3IA 5EPSA 5ENFA 5HRWA 5DFBA 5ENGA 5D24A 1EQFA 4IR4A 4MR5A 4CUQA 4YYKA 4ZC9A 4NR9A 5FH8A 2YEMA 5FH6A 4PTBA 5CZGA 5D3LA 5EPBA 4HXNA 5A5OA 5EVAA 4DONA 4QEWA 4UYHA 3DAIA 5AMEA 5L8TA 5LVRA 4NS5A 5ENIA 4BW1A 4HBWA 5EP7A 4UYFA 2E3KA 3U5NA 4UITA 5EWWA 5BT5A 5FG5A 2GRCA 2MJVB 3ZYUA 5FE0A 4MR6A 5FE6A 4QSRA 5IGMA 2L85A 5A5QA 5LJ2A 4YAXA 5E9IA 5F36A 4QSSA 5CQAA 4ALHA 2OSSA 5EQ1A 4OGJA 4QR4A 5E9KA 4A9OA 2RS9B 5C4QA 2FSAA 4O74A 3U5KA 4QNSA 4HXMA 4YYGA 4YATA 5L8UA 5F5ZA 5CQ5A 5HENA 5D3PA 5D3HA 3Q2EA 5CQ8A 4NQMA 4HBXA 4YADA 5FE3A 5A5PA 4YH4A 3LJWA 4N4HA 5A5RA 5C7NA 2DWWA 2OUOA 2N9GA 4HXSA 4J3IA 3TLPA 5KO4A 5ENEA 4QR5A 5E74A 3MUKA 4IR3A 4NYWA 3UV4A 3LXJA 4QYDA 4YY4A 4BW3A 5FE2A 4Z1QA 4LYIA 4E96A 3MULA 4MEQA 5CUBA 5CQTA 5L99A 4PS5A 4NUEA 3UVDA 3JVJA 4CUPA 4J0RA 3SVHA 5CQ6A 4LC2A 4CLBA 5ENHA 5HFQA 2F6NA 5L96A 1F68A 4XUAA 4A9LA 4FLPA 4IR6A 5E9VA 4LRGA 5BT4A 4A9EA 4UIZA 4UYGA 4NRAA 4TU4A 5CS8A 4TZ2A 4ZQLA 4CURA 5EWHA 4QZSA 5D3RA 5D0CA 4OGIA 4IORA 5FG4A 3JVKA 4YBTA 4YYDA 3HMFA 4UYEA 5DYCA 4LDFA 5I29A 4TT6A 3DWYA 2DVSA 3O34A 4RVRA 5H85A 5EPRA 4UYFB 5A82A 2L5EA 4XUBA 3P1FA 5I1QA 4IR5A 4TU6A 5HQ7A 4PCIA 5ENJA 3AADA 4IOOA 5EWDA 5HELA 5IBNA 5CPEA 5EWVA 4NYXA 5FH7A 4YYMA 2DVQA 2YDWA 4TQNA 5CQ3A 5C89A 5DFCA 5IG6A 5FE7A 5CP5A 4BW4A 5HJCA 4QY4A 5I83A 2RNWA 4O78A 5ETBA 3MQMA 4BHWA 4O76A 5LKZA 5DKDA 5A5SA 5DBMA 4J1PA 5CUCA 3UW9A 5F63A 4CUUA 2RI7A 4CL9A 5EV9A 3AQAA 4LR6A 5DKCA 5DY7A 5DYXA 4NUDA 2DVRA 5AMFA 1JM4B 3MB3A 4QC3A 5CY9A 4Z93A 5I86A 5D3TA 5HRXA 5TCMA 5AD3A 4WIVA 3UVWA 5IGNA 2R10A 4TZ8A 5D3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H60 A;  2RNX A;  2NXB A;  4KCX A;  4YYI A;  2R0Y A;  5KHM A;  5F2P A;  5F62 A;  4MR4 A;  4TS8 A;  2YQD A;  5FBX A;  4YYJ A;  5DLZ A;  5FFW A;  5IGL A;  4QC1 A;  4O77 A;  3U5L A;  2DAT A;  3HME A;  4NXJ A;  4BW2 A;  5H1U A;  4O7C A;  5FFV A;  4ZW1 A;  4N4F A;  1WUG A;  1WUM A;  2F6J A;  4QSW A;  5G4R A;  3O35 A;  4HXO A;  4NQN A;  4CUS A;  5DW2 A;  5KU3 A;  4O7F A;  5FB0 A;  5F61 A;  5KTW A;  2RFJ A;  5D3N A;  5FE1 A;  3G0J A;  5JI8 A;  3IU5 A;  4UIU A;  4CFL A;  4BJX A;  4A9K A;  4UIW A;  1N72 A;  5I80 A;  5ENC A;  4KV1 A;  3P1D A;  5I89 A;  2E7O A;  3O33 A;  4O72 A;  1JSP B;  4QEU A;  3I3J A;  3HMH A;  5EGU A;  5E73 A;  4KV4 A;  5A81 A;  3RCW A;  5AD2 A;  4CUT A;  3MB4 A;  4MR3 A;  4O7A A;  3ONI A;  5FDZ A;  3FKM X;  4QSP A;  4Z6I A;  4XYA A;  4PCE A;  4J0S A;  5E0R A;  3K2J A;  5ETD A;  4UIX A;  4TTE A;  4NR5 A;  5L97 A;  4QBM A;  5LKT A;  5E9L A;  4LYS A;  2D9E A;  4QSU A;  1ZS5 A;  5LJ0 A;  4QUT A;  5C8G A;  4HXR A;  4UYD A;  5E3D A;  4HXK A;  4AKN A;  4O71 A;  4N3W A;  4QSQ A;  4Z1S A;  5A7C A;  4LZ2 A;  4NR7 A;  5FG6 A;  5ENB A;  5IGK A;  4A9J A;  5HQ6 A;  3U5P A;  4OUF A;  4XY8 A;  5L98 A;  5COI A;  3UV2 A;  4NR6 A;  2WP2 A;  3SVF A;  5E9M A;  5EWC A;  4YBS A;  5IID A;  3LQH A;  4NUC A;  3UVX A;  5LKX A;  2G4A A;  2KTB B;  3GG3 A;  4YC9 A;  5CTL A;  4HBY A;  5LVQ A;  2DVV A;  4O7B A;  5FE5 A;  4YYN A;  4PKL A;  5F1H A;  5I88 A;  4HBV A;  5DYU A;  4TT4 A;  4C66 A;  4A9M A;  4MEO A;  3S91 A;  3MXF A;  3O36 A;  5EA1 A;  5HQ5 A;  4Q0O A;  5CUG A;  4YH3 A;  5E9Y A;  4ALG A;  5LKU A;  4A9N A;  4MEP A;  2I7K A;  5HEM A;  5ACY A;  5EK9 A;  4Z6H A;  2YEK A;  4A9H A;  5I7Y A;  5CRM A;  5CRZ A;  5H1T A;  3P5O A;  4NRB A;  3JVM A;  4YY6 A;  2I8N A;  5C87 A;  3P1C A;  5BT3 A;  5DYA A;  3QZS A;  4NR4 A;  4UIY A;  5DW1 A;  5TB6 A;  5K29 A;  5EU1 A;  4CFK A;  5FE9 A;  4QUU A;  5FE8 A;  4LZS A;  2WP1 A;  3QZT A;  3Q2F A;  4NR8 A;  4O7E A;  4UIV A;  5II2 A;  3IU6 A;  5F25 A;  4YBM A;  5DFD A;  5D25 A;  4WHU A;  2OO1 A;  4MEN A;  4O75 A;  3U5O A;  2YEL A;  4Q0N A;  4QB3 A;  4HXL A;  1X0J A;  5KTX A;  3D7C A;  5I7X A;  2RO1 A;  4NRC A;  5C85 A;  5D7X A;  4QSV A;  1E6I A;  4GPJ A;  2DKW A;  3NXB A;  4NYV A;  2R0V A;  5KTU A;  4HXP A;  5A5N A;  2E7N A;  3U5J A;  4IOQ A;  4TT2 A;  2D82 A;  3UVY A;  4A9I A;  5LJ1 A;  5CU8 A;  4QSX A;  5EIC A;  5J0D A;  5HM0 A;  5F1L A;  4C67 A;  4QYL A;  4LYW A;  5H1V A;  4YYH A;  5D26 A;  4TYL A;  5A83 A;  5JWM A;  5EM3 A;  5A85 A;  4QR3 A;  5E3G A;  5HLS A;  5D3S A;  5FE4 A;  3QZV A;  4YAB A;  2YYN A;  5II1 A;  4N4G A;  2YW5 A;  5E7D A;  4YK0 A;  5CGP A;  4LZR A;  5EI4 A;  2L84 A;  3P1E A;  5DKH A;  4WHW A;  4PY6 A;  5G4S A;  5HRV A;  5LUU A;  5FB1 A;  3UV5 A;  4X2I A;  5HFR A;  3U5M A;  5CQ7 A;  5CFW A;  5DX4 A;  5EIS A;  5FFY A;  4QEV A;  2RNY A;  3LQJ A;  4N4I A;  4XY9 A;  5F60 A;  3LQI A;  4A9F A;  5CQ4 A;  3JVL A;  5I40 A;  3SVG A;  3G0L A;  2LSP B;  3O37 A;  5F3A A;  5DLX A;  5CUA A;  5CUD A;  2R0S A;  5HCL A;  4Y03 A;  4O70 A;  4QST A;  5CUE A;  3S92 A;  4F3I A;  5EPS A;  5ENF A;  5HRW A;  5DFB A;  5ENG A;  5D24 A;  1EQF A;  4IR4 A;  4MR5 A;  4CUQ A;  4YYK A;  4ZC9 A;  4NR9 A;  5FH8 A;  2YEM A;  5FH6 A;  4PTB A;  5CZG A;  5D3L A;  5EPB A;  4HXN A;  5A5O A;  5EVA A;  4DON A;  4QEW A;  4UYH A;  3DAI A;  5AME A;  5L8T A;  5LVR A;  4NS5 A;  5ENI A;  4BW1 A;  4HBW A;  5EP7 A;  4UYF A;  2E3K A;  3U5N A;  4UIT A;  5EWW A;  5BT5 A;  5FG5 A;  2GRC A;  2MJV B;  3ZYU A;  5FE0 A;  4MR6 A;  5FE6 A;  4QSR A;  5IGM A;  2L85 A;  5A5Q A;  5LJ2 A;  4YAX A;  5E9I A;  5F36 A;  4QSS A;  5CQA A;  4ALH A;  2OSS A;  5EQ1 A;  4OGJ A;  4QR4 A;  5E9K A;  4A9O A;  2RS9 B;  5C4Q A;  2FSA A;  4O74 A;  3U5K A;  4QNS A;  4HXM A;  4YYG A;  4YAT A;  5L8U A;  5F5Z A;  5CQ5 A;  5HEN A;  5D3P A;  5D3H A;  3Q2E A;  5CQ8 A;  4NQM A;  4HBX A;  4YAD A;  5FE3 A;  5A5P A;  4YH4 A;  3LJW A;  4N4H A;  5A5R A;  5C7N A;  2DWW A;  2OUO A;  2N9G A;  4HXS A;  4J3I A;  3TLP A;  5KO4 A;  5ENE A;  4QR5 A;  5E74 A;  3MUK A;  4IR3 A;  4NYW A;  3UV4 A;  3LXJ A;  4QYD A;  4YY4 A;  4BW3 A;  5FE2 A;  4Z1Q A;  4LYI A;  4E96 A;  3MUL A;  4MEQ A;  5CUB A;  5CQT A;  5L99 A;  4PS5 A;  4NUE A;  3UVD A;  3JVJ A;  4CUP A;  4J0R A;  3SVH A;  5CQ6 A;  4LC2 A;  4CLB A;  5ENH A;  5HFQ A;  2F6N A;  5L96 A;  1F68 A;  4XUA A;  4A9L A;  4FLP A;  4IR6 A;  5E9V A;  4LRG A;  5BT4 A;  4A9E A;  4UIZ A;  4UYG A;  4NRA A;  4TU4 A;  5CS8 A;  4TZ2 A;  4ZQL A;  4CUR A;  5EWH A;  4QZS A;  5D3R A;  5D0C A;  4OGI A;  4IOR A;  5FG4 A;  3JVK A;  4YBT A;  4YYD A;  3HMF A;  4UYE A;  5DYC A;  4LDF A;  5I29 A;  4TT6 A;  3DWY A;  2DVS A;  3O34 A;  4RVR A;  5H85 A;  5EPR A;  4UYF B;  5A82 A;  2L5E A;  4XUB A;  3P1F A;  5I1Q A;  4IR5 A;  4TU6 A;  5HQ7 A;  4PCI A;  5ENJ A;  3AAD A;  4IOO A;  5EWD A;  5HEL A;  5IBN A;  5CPE A;  5EWV A;  4NYX A;  5FH7 A;  4YYM A;  2DVQ A;  2YDW A;  4TQN A;  5CQ3 A;  5C89 A;  5DFC A;  5IG6 A;  5FE7 A;  5CP5 A;  4BW4 A;  5HJC A;  4QY4 A;  5I83 A;  2RNW A;  4O78 A;  5ETB A;  3MQM A;  4BHW A;  4O76 A;  5LKZ A;  5DKD A;  5A5S A;  5DBM A;  4J1P A;  5CUC A;  3UW9 A;  5F63 A;  4CUU A;  2RI7 A;  4CL9 A;  5EV9 A;  3AQA A;  4LR6 A;  5DKC A;  5DY7 A;  5DYX A;  4NUD A;  2DVR A;  5AMF A;  1JM4 B;  3MB3 A;  4QC3 A;  5CY9 A;  4Z93 A;  5I86 A;  5D3T A;  5HRX A;  5TCM A;  5AD3 A;  4WIV A;  3UVW A;  5IGN A;  2R10 A;  4TZ8 A;  5D3J A; 
#chains in the Genus database with same CATH topology
 2H60 A;  2RNX A;  2NXB A;  4KCX A;  4YYI A;  2R0Y A;  5KHM A;  5F2P A;  5F62 A;  4MR4 A;  4TS8 A;  2YQD A;  5FBX A;  4YYJ A;  5DLZ A;  5FFW A;  5IGL A;  4QC1 A;  4O77 A;  3U5L A;  2DAT A;  3HME A;  4NXJ A;  4BW2 A;  5H1U A;  4O7C A;  5FFV A;  4ZW1 A;  4N4F A;  1WUG A;  1WUM A;  2F6J A;  4QSW A;  5G4R A;  4AKI A;  3O35 A;  4HXO A;  4NQN A;  4CUS A;  5DW2 A;  5KU3 A;  4O7F A;  5FB0 A;  5F61 A;  5KTW A;  2RFJ A;  5D3N A;  5FE1 A;  3G0J A;  5JI8 A;  3IU5 A;  4UIU A;  4CFL A;  4BJX A;  4A9K A;  4UIW A;  1N72 A;  5I80 A;  5ENC A;  4KV1 A;  3P1D A;  5I89 A;  2E7O A;  1ZKR A;  3O33 A;  4O72 A;  1JSP B;  4QEU A;  3I3J A;  3HMH A;  5EGU A;  5E73 A;  4KV4 A;  5A81 A;  3RCW A;  5AD2 A;  4CUT A;  3MB4 A;  4MR3 A;  4O7A A;  3ONI A;  5FDZ A;  3FKM X;  4QSP A;  4Z6I A;  4XYA A;  4PCE A;  4J0S A;  5E0R A;  3K2J A;  5ETD A;  4UIX A;  4TTE A;  4NR5 A;  5L97 A;  4QBM A;  5LKT A;  5E9L A;  4LYS A;  2D9E A;  4QSU A;  1ZS5 A;  5LJ0 A;  4QUT A;  5C8G A;  4HXR A;  4UYD A;  5E3D A;  4HXK A;  4AKN A;  4O71 A;  4N3W A;  4QSQ A;  4Z1S A;  5A7C A;  4LZ2 A;  4NR7 A;  5FG6 A;  5ENB A;  5IGK A;  4A9J A;  5HQ6 A;  3U5P A;  4OUF A;  4XY8 A;  5L98 A;  5COI A;  3UV2 A;  4NR6 A;  2WP2 A;  3SVF A;  5E9M A;  5EWC A;  4YBS A;  5IID A;  3LQH A;  2EJN A;  4NUC A;  3UVX A;  5LKX A;  2G4A A;  2KTB B;  3GG3 A;  4YC9 A;  5CTL A;  4HBY A;  5LVQ A;  2DVV A;  4O7B A;  5FE5 A;  4YYN A;  4PKL A;  5F1H A;  5I88 A;  4HBV A;  5DYU A;  4TT4 A;  4C66 A;  4A9M A;  4MEO A;  3S91 A;  3MXF A;  3O36 A;  5EA1 A;  5HQ5 A;  4Q0O A;  5CUG A;  4YH3 A;  5E9Y A;  4ALG A;  5LKU A;  4A9N A;  4MEP A;  4AKG A;  2I7K A;  5HEM A;  5ACY A;  5EK9 A;  4Z6H A;  2YEK A;  4A9H A;  5I7Y A;  5CRM A;  5CRZ A;  5H1T A;  3P5O A;  4NRB A;  3JVM A;  4AI6 A;  4YY6 A;  2I8N A;  5C87 A;  3P1C A;  5BT3 A;  5DYA A;  3QZS A;  4NR4 A;  4UIY A;  5DW1 A;  5TB6 A;  5K29 A;  5EU1 A;  4CFK A;  5FE9 A;  4QUU A;  5FE8 A;  4LZS A;  2WP1 A;  3QZT A;  3Q2F A;  4NR8 A;  4O7E A;  4UIV A;  5II2 A;  3IU6 A;  5F25 A;  4YBM A;  5DFD A;  5D25 A;  4WHU A;  2OO1 A;  4MEN A;  4O75 A;  3U5O A;  2YEL A;  4Q0N A;  4QB3 A;  4HXL A;  3VKG A;  1X0J A;  5KTX A;  3D7C A;  5I7X A;  2RO1 A;  4NRC A;  5C85 A;  5D7X A;  4QSV A;  1E6I A;  4GPJ A;  2DKW A;  3NXB A;  4NYV A;  2R0V A;  5KTU A;  4HXP A;  5A5N A;  2E7N A;  3U5J A;  4IOQ A;  4TT2 A;  2D82 A;  3UVY A;  4A9I A;  5LJ1 A;  5CU8 A;  4QSX A;  5EIC A;  5J0D A;  5HM0 A;  5F1L A;  4C67 A;  4QYL A;  4LYW A;  5H1V A;  4YYH A;  5D26 A;  4TYL A;  5A83 A;  5JWM A;  5EM3 A;  5A85 A;  4QR3 A;  5E3G A;  5HLS A;  5D3S A;  5FE4 A;  3QZV A;  4YAB A;  2YYN A;  5II1 A;  4N4G A;  2YW5 A;  5E7D A;  4YK0 A;  5CGP A;  4LZR A;  5EI4 A;  2L84 A;  3P1E A;  5DKH A;  4WHW A;  4PY6 A;  5G4S A;  5HRV A;  5LUU A;  5FB1 A;  3UV5 A;  4AKH A;  4X2I A;  5HFR A;  3U5M A;  5CQ7 A;  5CFW A;  5DX4 A;  5EIS A;  5FFY A;  4QEV A;  2RNY A;  3LQJ A;  4N4I A;  4XY9 A;  5F60 A;  3LQI A;  4A9F A;  5CQ4 A;  3JVL A;  3D1D A;  5I40 A;  3SVG A;  3G0L A;  2LSP B;  3O37 A;  5F3A A;  5DLX A;  5CUA A;  5CUD A;  2R0S A;  5HCL A;  4Y03 A;  4O70 A;  4QST A;  5CUE A;  3S92 A;  4F3I A;  5EPS A;  5ENF A;  5HRW A;  5DFB A;  5ENG A;  5D24 A;  1EQF A;  4IR4 A;  4MR5 A;  4CUQ A;  3VKH A;  4YYK A;  4ZC9 A;  4NR9 A;  5FH8 A;  2YEM A;  5FH6 A;  4PTB A;  5CZG A;  5D3L A;  5EPB A;  4HXN A;  5A5O A;  5EVA A;  4DON A;  4QEW A;  4UYH A;  3DAI A;  5AME A;  5L8T A;  5LVR A;  4NS5 A;  5ENI A;  4BW1 A;  4HBW A;  5EP7 A;  4UYF A;  2E3K A;  3U5N A;  4UIT A;  5EWW A;  5BT5 A;  5FG5 A;  2GRC A;  2MJV B;  3ZYU A;  5FE0 A;  4MR6 A;  5FE6 A;  4QSR A;  5IGM A;  2L85 A;  5A5Q A;  5LJ2 A;  4YAX A;  5E9I A;  5F36 A;  4QSS A;  5CQA A;  4ALH A;  2OSS A;  5EQ1 A;  4OGJ A;  4QR4 A;  5E9K A;  4A9O A;  2RS9 B;  5C4Q A;  2FSA A;  4O74 A;  3U5K A;  4QNS A;  4HXM A;  4YYG A;  4YAT A;  5L8U A;  5F5Z A;  5CQ5 A;  5HEN A;  5D3P A;  5D3H A;  3Q2E A;  5CQ8 A;  4NQM A;  4HBX A;  4YAD A;  5FE3 A;  5A5P A;  4YH4 A;  3LJW A;  4N4H A;  5A5R A;  5C7N A;  2DWW A;  2OUO A;  2N9G A;  4HXS A;  4J3I A;  3TLP A;  5KO4 A;  5ENE A;  4QR5 A;  5E74 A;  3MUK A;  4IR3 A;  4NYW A;  3UV4 A;  3LXJ A;  4QYD A;  4YY4 A;  3ERR A;  4BW3 A;  5FE2 A;  4Z1Q A;  4LYI A;  4E96 A;  3MUL A;  4MEQ A;  5CUB A;  5CQT A;  5L99 A;  4PS5 A;  4NUE A;  3UVD A;  3JVJ A;  4CUP A;  4J0R A;  3SVH A;  5CQ6 A;  4LC2 A;  4CLB A;  5ENH A;  5HFQ A;  2F6N A;  5L96 A;  1F68 A;  4XUA A;  4A9L A;  4FLP A;  4IR6 A;  5E9V A;  4LRG A;  5BT4 A;  4A9E A;  4UIZ A;  4UYG A;  4NRA A;  4TU4 A;  5CS8 A;  4TZ2 A;  4ZQL A;  4CUR A;  5EWH A;  4QZS A;  5D3R A;  5D0C A;  4OGI A;  4IOR A;  5FG4 A;  3JVK A;  4YBT A;  4YYD A;  3HMF A;  4UYE A;  5DYC A;  4LDF A;  5I29 A;  4TT6 A;  3DWY A;  2DVS A;  3O34 A;  4RVR A;  5H85 A;  5EPR A;  4UYF B;  5A82 A;  2L5E A;  4XUB A;  3P1F A;  5I1Q A;  4IR5 A;  4TU6 A;  5HQ7 A;  4PCI A;  5ENJ A;  3AAD A;  4IOO A;  5EWD A;  5HEL A;  5IBN A;  5CPE A;  5EWV A;  4NYX A;  5FH7 A;  4YYM A;  2DVQ A;  2YDW A;  4TQN A;  5CQ3 A;  5C89 A;  5DFC A;  5IG6 A;  5FE7 A;  5CP5 A;  4BW4 A;  5HJC A;  4QY4 A;  5I83 A;  2RNW A;  4O78 A;  5ETB A;  3MQM A;  4BHW A;  4O76 A;  5LKZ A;  5DKD A;  5A5S A;  5DBM A;  4J1P A;  5CUC A;  3UW9 A;  5F63 A;  4CUU A;  2RI7 A;  4CL9 A;  5EV9 A;  3AQA A;  4LR6 A;  5DKC A;  5DY7 A;  3D1B A;  5DYX A;  4NUD A;  2DVR A;  5AMF A;  1JM4 B;  3MB3 A;  4QC3 A;  5CY9 A;  4Z93 A;  5I86 A;  5D3T A;  5HRX A;  5TCM A;  5AD3 A;  1PUO A;  4WIV A;  3UVW A;  5IGN A;  2R10 A;  4TZ8 A;  5D3J A; 
#chains in the Genus database with same CATH homology
 2H60 A;  2RNX A;  2NXB A;  4KCX A;  4YYI A;  2R0Y A;  5KHM A;  5F2P A;  5F62 A;  4MR4 A;  4TS8 A;  2YQD A;  5FBX A;  4YYJ A;  5DLZ A;  5FFW A;  5IGL A;  4QC1 A;  4O77 A;  3U5L A;  2DAT A;  3HME A;  4NXJ A;  4BW2 A;  5H1U A;  4O7C A;  5FFV A;  4ZW1 A;  4N4F A;  1WUG A;  1WUM A;  2F6J A;  4QSW A;  5G4R A;  3O35 A;  4HXO A;  4NQN A;  4CUS A;  5DW2 A;  5KU3 A;  4O7F A;  5FB0 A;  5F61 A;  5KTW A;  2RFJ A;  5D3N A;  5FE1 A;  3G0J A;  5JI8 A;  3IU5 A;  4UIU A;  4CFL A;  4BJX A;  4A9K A;  4UIW A;  1N72 A;  5I80 A;  5ENC A;  4KV1 A;  3P1D A;  5I89 A;  2E7O A;  3O33 A;  4O72 A;  1JSP B;  4QEU A;  3I3J A;  3HMH A;  5EGU A;  5E73 A;  4KV4 A;  5A81 A;  3RCW A;  5AD2 A;  4CUT A;  3MB4 A;  4MR3 A;  4O7A A;  3ONI A;  5FDZ A;  3FKM X;  4QSP A;  4Z6I A;  4XYA A;  4PCE A;  4J0S A;  5E0R A;  3K2J A;  5ETD A;  4UIX A;  4TTE A;  4NR5 A;  5L97 A;  4QBM A;  5LKT A;  5E9L A;  4LYS A;  2D9E A;  4QSU A;  1ZS5 A;  5LJ0 A;  4QUT A;  5C8G A;  4HXR A;  4UYD A;  5E3D A;  4HXK A;  4AKN A;  4O71 A;  4N3W A;  4QSQ A;  4Z1S A;  5A7C A;  4LZ2 A;  4NR7 A;  5FG6 A;  5ENB A;  5IGK A;  4A9J A;  5HQ6 A;  3U5P A;  4OUF A;  4XY8 A;  5L98 A;  5COI A;  3UV2 A;  4NR6 A;  2WP2 A;  3SVF A;  5E9M A;  5EWC A;  4YBS A;  5IID A;  3LQH A;  4NUC A;  3UVX A;  5LKX A;  2G4A A;  2KTB B;  3GG3 A;  4YC9 A;  5CTL A;  4HBY A;  5LVQ A;  2DVV A;  4O7B A;  5FE5 A;  4YYN A;  4PKL A;  5F1H A;  5I88 A;  4HBV A;  5DYU A;  4TT4 A;  4C66 A;  4A9M A;  4MEO A;  3S91 A;  3MXF A;  3O36 A;  5EA1 A;  5HQ5 A;  4Q0O A;  5CUG A;  4YH3 A;  5E9Y A;  4ALG A;  5LKU A;  4A9N A;  4MEP A;  2I7K A;  5HEM A;  5ACY A;  5EK9 A;  4Z6H A;  2YEK A;  4A9H A;  5I7Y A;  5CRM A;  5CRZ A;  5H1T A;  3P5O A;  4NRB A;  3JVM A;  4YY6 A;  2I8N A;  5C87 A;  3P1C A;  5BT3 A;  5DYA A;  3QZS A;  4NR4 A;  4UIY A;  5DW1 A;  5TB6 A;  5K29 A;  5EU1 A;  4CFK A;  5FE9 A;  4QUU A;  5FE8 A;  4LZS A;  2WP1 A;  3QZT A;  3Q2F A;  4NR8 A;  4O7E A;  4UIV A;  5II2 A;  3IU6 A;  5F25 A;  4YBM A;  5DFD A;  5D25 A;  4WHU A;  2OO1 A;  4MEN A;  4O75 A;  3U5O A;  2YEL A;  4Q0N A;  4QB3 A;  4HXL A;  1X0J A;  5KTX A;  3D7C A;  5I7X A;  2RO1 A;  4NRC A;  5C85 A;  5D7X A;  4QSV A;  1E6I A;  4GPJ A;  2DKW A;  3NXB A;  4NYV A;  2R0V A;  5KTU A;  4HXP A;  5A5N A;  2E7N A;  3U5J A;  4IOQ A;  4TT2 A;  2D82 A;  3UVY A;  4A9I A;  5LJ1 A;  5CU8 A;  4QSX A;  5EIC A;  5J0D A;  5HM0 A;  5F1L A;  4C67 A;  4QYL A;  4LYW A;  5H1V A;  4YYH A;  5D26 A;  4TYL A;  5A83 A;  5JWM A;  5EM3 A;  5A85 A;  4QR3 A;  5E3G A;  5HLS A;  5D3S A;  5FE4 A;  3QZV A;  4YAB A;  2YYN A;  5II1 A;  4N4G A;  2YW5 A;  5E7D A;  4YK0 A;  5CGP A;  4LZR A;  5EI4 A;  2L84 A;  3P1E A;  5DKH A;  4WHW A;  4PY6 A;  5G4S A;  5HRV A;  5LUU A;  5FB1 A;  3UV5 A;  4X2I A;  5HFR A;  3U5M A;  5CQ7 A;  5CFW A;  5DX4 A;  5EIS A;  5FFY A;  4QEV A;  2RNY A;  3LQJ A;  4N4I A;  4XY9 A;  5F60 A;  3LQI A;  4A9F A;  5CQ4 A;  3JVL A;  5I40 A;  3SVG A;  3G0L A;  2LSP B;  3O37 A;  5F3A A;  5DLX A;  5CUA A;  5CUD A;  2R0S A;  5HCL A;  4Y03 A;  4O70 A;  4QST A;  5CUE A;  3S92 A;  4F3I A;  5EPS A;  5ENF A;  5HRW A;  5DFB A;  5ENG A;  5D24 A;  1EQF A;  4IR4 A;  4MR5 A;  4CUQ A;  4YYK A;  4ZC9 A;  4NR9 A;  5FH8 A;  2YEM A;  5FH6 A;  4PTB A;  5CZG A;  5D3L A;  5EPB A;  4HXN A;  5A5O A;  5EVA A;  4DON A;  4QEW A;  4UYH A;  3DAI A;  5AME A;  5L8T A;  5LVR A;  4NS5 A;  5ENI A;  4BW1 A;  4HBW A;  5EP7 A;  4UYF A;  2E3K A;  3U5N A;  4UIT A;  5EWW A;  5BT5 A;  5FG5 A;  2GRC A;  2MJV B;  3ZYU A;  5FE0 A;  4MR6 A;  5FE6 A;  4QSR A;  5IGM A;  2L85 A;  5A5Q A;  5LJ2 A;  4YAX A;  5E9I A;  5F36 A;  4QSS A;  5CQA A;  4ALH A;  2OSS A;  5EQ1 A;  4OGJ A;  4QR4 A;  5E9K A;  4A9O A;  2RS9 B;  5C4Q A;  2FSA A;  4O74 A;  3U5K A;  4QNS A;  4HXM A;  4YYG A;  4YAT A;  5L8U A;  5F5Z A;  5CQ5 A;  5HEN A;  5D3P A;  5D3H A;  3Q2E A;  5CQ8 A;  4NQM A;  4HBX A;  4YAD A;  5FE3 A;  5A5P A;  4YH4 A;  3LJW A;  4N4H A;  5A5R A;  5C7N A;  2DWW A;  2OUO A;  2N9G A;  4HXS A;  4J3I A;  3TLP A;  5KO4 A;  5ENE A;  4QR5 A;  5E74 A;  3MUK A;  4IR3 A;  4NYW A;  3UV4 A;  3LXJ A;  4QYD A;  4YY4 A;  4BW3 A;  5FE2 A;  4Z1Q A;  4LYI A;  4E96 A;  3MUL A;  4MEQ A;  5CUB A;  5CQT A;  5L99 A;  4PS5 A;  4NUE A;  3UVD A;  3JVJ A;  4CUP A;  4J0R A;  3SVH A;  5CQ6 A;  4LC2 A;  4CLB A;  5ENH A;  5HFQ A;  2F6N A;  5L96 A;  1F68 A;  4XUA A;  4A9L A;  4FLP A;  4IR6 A;  5E9V A;  4LRG A;  5BT4 A;  4A9E A;  4UIZ A;  4UYG A;  4NRA A;  4TU4 A;  5CS8 A;  4TZ2 A;  4ZQL A;  4CUR A;  5EWH A;  4QZS A;  5D3R A;  5D0C A;  4OGI A;  4IOR A;  5FG4 A;  3JVK A;  4YBT A;  4YYD A;  3HMF A;  4UYE A;  5DYC A;  4LDF A;  5I29 A;  4TT6 A;  3DWY A;  2DVS A;  3O34 A;  4RVR A;  5H85 A;  5EPR A;  4UYF B;  5A82 A;  2L5E A;  4XUB A;  3P1F A;  5I1Q A;  4IR5 A;  4TU6 A;  5HQ7 A;  4PCI A;  5ENJ A;  3AAD A;  4IOO A;  5EWD A;  5HEL A;  5IBN A;  5CPE A;  5EWV A;  4NYX A;  5FH7 A;  4YYM A;  2DVQ A;  2YDW A;  4TQN A;  5CQ3 A;  5C89 A;  5DFC A;  5IG6 A;  5FE7 A;  5CP5 A;  4BW4 A;  5HJC A;  4QY4 A;  5I83 A;  2RNW A;  4O78 A;  5ETB A;  3MQM A;  4BHW A;  4O76 A;  5LKZ A;  5DKD A;  5A5S A;  5DBM A;  4J1P A;  5CUC A;  3UW9 A;  5F63 A;  4CUU A;  2RI7 A;  4CL9 A;  5EV9 A;  3AQA A;  4LR6 A;  5DKC A;  5DY7 A;  5DYX A;  4NUD A;  2DVR A;  5AMF A;  1JM4 B;  3MB3 A;  4QC3 A;  5CY9 A;  4Z93 A;  5I86 A;  5D3T A;  5HRX A;  5TCM A;  5AD3 A;  4WIV A;  3UVW A;  5IGN A;  2R10 A;  4TZ8 A;  5D3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...