2R10A

Structure of an acetylated rsc4 tandem bromodomain histone chimera
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
292
Chain Sequence
RPKYLPGHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin structure-remodeling complex protein RSC4, LINKER,
publication title Autoregulation of the rsc4 tandem bromodomain by gcn5 acetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 102
structure length 292
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r10A01
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r10A02
3Q2EA 4O72A 3JVLA 5ACYA 5FE2A 4O75A 5A85A 5I40A 4LDFA 4MR3A 4O77A 4QSVA 3UVYA 4TT2A 5E3DA 4NR9A 5IIDA 4MEPA 4Z1SA 4UITA 2KTBB 5CQ7A 4F3IA 5F60A 4UYFA 5HQ5A 3K2JA 4YY4A 5CU8A 4NQNA 4PS5A 5CQAA 3HMHA 4QR3A 5CTLA 5E0RA 5A5OA 5BT5A 4YYIA 5F62A 4OUFA 5IGMA 4CUQA 5KTUA 3O37A 4X2IA 5E3GA 4A9OA 5DLZA 4YC9A 5FDZA 3AADA 3NXBA 4NYXA 4CLBA 4N4IA 5ENFA 4Z6HA 3GG3A 4QYLA 3G0LA 5DFBA 4C66A 4Y03A 4LYSA 4O7AA 2OUOA 3S92A 5C4QA 5D3SA 3UVWA 4BW3A 3QZVA 5FE0A 5DKCA 5L97A 3O34A 5FFVA 5LKXA 4NUEA 5D24A 4QC1A 4HBVA 4IR5A 2G4AA 5A82A 4CFLA 3UV4A 4NYVA 5D3HA 2E3KA 4FLPA 4YK0A 3MUKA 5CUCA 5A5SA 4LZ2A 5I29A 2RO1A 1N72A 3O36A 4BW4A 5ETBA 5BT4A 4LR6A 5TB6A 4HXKA 5HFQA 3MXFA 4QR4A 4YABA 5I86A 5IGKA 2D9EA 4UIUA 3QZTA 4NR8A 4NS5A 2F6NA 5E9YA 5I7XA 3P1EA 5E9VA 4XY8A 4BW2A 3SVHA 4ZW1A 4WHWA 5LJ0A 4LC2A 4A9JA 4NRAA 5CZGA 4QBMA 3U5PA 4PKLA 5CQ4A 5G4RA 3LJWA 4HBWA 5C8GA 4QSQA 5CP5A 4A9HA 4YYHA 3O35A 4YYNA 5A5QA 5EPBA 4QEUA 3ZYUA 2R0SA 4YYJA 4YYMA 4N3WA 2R0YA 5DYUA 3MB4A 5F1HA 5FE7A 2YEMA 5I88A 5AD2A 5EPRA 4HXPA 3U5JA 4TT6A 3DWYA 5L8UA 1EQFA 4BJXA 4UIYA 5EPSA 3TLPA 4ZC9A 2RNWA 3AQAA 5CUEA 5D3PA 5A83A 5A5RA 5HQ7A 5EV9A 5CRMA 5HFRA 5CS8A 5I7YA 3RCWA 4UYGA 4UIXA 5EI4A 2LSPB 5TCMA 1WUMA 5DW2A 5FE8A 4HBYA 4A9EA 3SVGA 5L98A 4QEVA 5EISA 4QSWA 2DVSA 4QUUA 4HXOA 5AMFA 4O7FA 4PCEA 5ENHA 4NR5A 5I89A 5IGLA 5I83A 5D26A 4ALHA 4PY6A 4O70A 4A9KA 4QSRA 5II2A 4N4FA 5EM3A 3I3JA 5F36A 4XUBA 2RS9B 5LJ1A 2YW5A 2L5EA 5D0CA 4UYFB 5ENIA 5C87A 3U5OA 2DVRA 4QSTA 3ONIA 4QSXA 5JWMA 3HMFA 5FG5A 4UYHA 4IORA 5D7XA 5I1QA 4TS8A 4TQNA 3UVXA 2WP1A 3MQMA 4NXJA 5J0DA 2YDWA 4AKNA 3FKMX 4C67A 5EA1A 4YYDA 4N4HA 5HLSA 5F1LA 5ENJA 5LJ2A 2WP2A 5BT3A 4O7BA 4CFKA 4IOQA 2RNXA 4KCXA 3UVDA 4QNSA 4J1PA 5CPEA 4O71A 4IR6A 3S91A 5E73A 5FFYA 2DVVA 5E9IA 4CUUA 4TU6A 5EWVA 4QY4A 5LKZA 5CQ6A 5E9KA 2N9GA 3IU5A 5HRWA 5F2PA 1F68A 3U5MA 5CQ3A 4TTEA 4PCIA 5F3AA 2L85A 4NR7A 4IR4A 2OSSA 3P1FA 5D3NA 2YYNA 4Q0NA 5E9MA 4TZ8A 3JVJA 5FE3A 4LZRA 4QC3A 5HRXA 5CQTA 5F61A 2F6JA 4NR6A 5FB1A 3P1CA 4IOOA 4O76A 5F25A 5ENEA 5ETDA 5CY9A 5DKHA 4LRGA 5HCLA 5HEMA 5DYXA 5D3LA 5E9LA 4CL9A 3QZSA 4YYKA 4A9FA 4YY6A 4J0RA 5H1UA 5FH8A 1X0JA 5DKDA 2E7OA 5F5ZA 5LKUA 4QZSA 2DWWA 5FH7A 5IGNA 3UV5A 3MB3A 4WIVA 5FE4A 5K29A 2DVQA 4OGIA 5CRZA 2OO1A 3Q2FA 4QSPA 5E74A 2H60A 5D25A 3U5LA 3U5NA 5IG6A 5L96A 4QEWA 4Z1QA 4PTBA 4UIZA 4N4GA 3SVFA 4YBTA 4LYIA 3LXJA 4HXLA 4CUSA 5EK9A 4HXNA 4NUCA 4A9MA 3JVMA 5C89A 4YBMA 4O7CA 2DATA 5DLXA 4CUPA 2YELA 4XY9A 4J0SA 5HQ6A 2YQDA 5CUAA 5C7NA 4Z93A 5D3JA 4TYLA 4DONA 5A5NA 2R0VA 4MR6A 3G0JA 5EVAA 5E7DA 2NXBA 5ENGA 4YH3A 4TZ2A 4QR5A 5EWDA 5C85A 4UIWA 5H1TA 5LKTA 5EP7A 4TU4A 5CGPA 4MR4A 3O33A 5EWHA 5ENCA 3LQJA 4LZSA 2FSAA 4XYAA 3HMEA 4YYGA 3UV2A 5EU1A 2YEKA 4KV1A 5CUDA 5KO4A 4NR4A 4A9NA 3MULA 3LQHA 4QYDA 4BW1A 4A9LA 5AD3A 5H85A 5II1A 3IU6A 5FH6A 5KTXA 5EWWA 4QUTA 5HM0A 5CQ5A 4IR3A 5EWCA 5LVQA 5IBNA 5KHMA 2R10A 5EQ1A 1E6IA 4YATA 4NRCA 4OGJA 5A81A 4BHWA 4O74A 5JI8A 5KU3A 4E96A 2D82A 2GRCA 5DYCA 4KV4A 5H1VA 5DBMA 5A7CA 4O7EA 5HJCA 4YH4A 2E7NA 4HXMA 4XUAA 4NRBA 5D3TA 5DYAA 4GPJA 5FE6A 4YBSA 5FFWA 5FB0A 5DX4A 2RFJA 4ZQLA 5G4SA 5LUUA 4QSSA 5DFCA 5COIA 4CURA 2I8NA 2MJVB 5HELA 4TT4A 5CUBA 4O78A 4HXRA 5DW1A 5ENBA 5F63A 4WHUA 5L8TA 5CQ8A 3UW9A 2RNYA 3JVKA 3D7CA 4Q0OA 5I80A 3U5KA 5HRVA 5FE5A 4UIVA 5LVRA 2I7KA 4MEQA 4QSUA 5FG4A 3P1DA 4ALGA 4NYWA 2RI7A 4RVRA 3LQIA 4QB3A 5FE9A 4J3IA 4UYEA 4YAXA 5AMEA 5DFDA 4MEOA 4NQMA 5FBXA 1ZS5A 3P5OA 4MENA 3DAIA 5CUGA 5FE1A 5D3RA 1JM4B 5DY7A 1JSPB 5CFWA 4MR5A 2DKWA 1WUGA 5EGUA 4Z6IA 4CUTA 4A9IA 4UYDA 5L99A 5FG6A 5HENA 5A5PA 4LYWA 4YADA 4NUDA 4HXSA 5KTWA 4HBXA 5EICA 2L84A
chains in the Genus database with same CATH superfamily
3Q2EA 4O72A 3JVLA 5ACYA 5FE2A 4O75A 5A85A 5I40A 3VKHA 4LDFA 4MR3A 2EJNA 4O77A 4QSVA 3UVYA 4TT2A 5E3DA 4NR9A 5IIDA 4MEPA 4Z1SA 4UITA 1ZKRA 2KTBB 5CQ7A 4F3IA 5F60A 4UYFA 5HQ5A 3K2JA 4YY4A 5CU8A 4NQNA 4PS5A 5CQAA 3HMHA 4QR3A 5CTLA 5E0RA 5A5OA 5BT5A 4YYIA 5F62A 4OUFA 5IGMA 4CUQA 5KTUA 3O37A 4X2IA 5E3GA 4A9OA 5DLZA 4YC9A 5FDZA 3AADA 3NXBA 4NYXA 4CLBA 4N4IA 5ENFA 4Z6HA 3GG3A 4QYLA 3G0LA 5DFBA 4C66A 4Y03A 4LYSA 4O7AA 2OUOA 3S92A 5C4QA 5D3SA 3UVWA 4BW3A 3QZVA 5FE0A 5DKCA 5L97A 3O34A 5FFVA 5LKXA 4NUEA 5D24A 4QC1A 4HBVA 4IR5A 2G4AA 5A82A 4CFLA 3UV4A 4NYVA 5D3HA 2E3KA 4FLPA 4YK0A 3MUKA 5CUCA 5A5SA 4LZ2A 5I29A 2RO1A 1N72A 3O36A 4BW4A 5ETBA 5BT4A 4LR6A 5TB6A 4HXKA 5HFQA 3MXFA 4QR4A 4YABA 5I86A 5IGKA 2D9EA 4UIUA 3QZTA 4NR8A 4NS5A 2F6NA 5E9YA 5I7XA 3P1EA 5E9VA 4XY8A 4BW2A 3SVHA 4ZW1A 4WHWA 5LJ0A 4LC2A 4A9JA 4NRAA 5CZGA 4QBMA 3U5PA 4PKLA 5CQ4A 5G4RA 3LJWA 4HBWA 5C8GA 4QSQA 5CP5A 4A9HA 4YYHA 3O35A 4YYNA 5A5QA 5EPBA 4QEUA 3ZYUA 2R0SA 4YYJA 4YYMA 4N3WA 2R0YA 5DYUA 3MB4A 5F1HA 5FE7A 2YEMA 5I88A 5AD2A 5EPRA 4HXPA 3U5JA 4TT6A 3DWYA 5L8UA 1EQFA 4BJXA 4UIYA 5EPSA 3TLPA 4ZC9A 2RNWA 3AQAA 5CUEA 5D3PA 5A83A 5A5RA 5HQ7A 5EV9A 5CRMA 5HFRA 5CS8A 5I7YA 3RCWA 4UYGA 4UIXA 5EI4A 2LSPB 5TCMA 1WUMA 5DW2A 5FE8A 4HBYA 4A9EA 3SVGA 5L98A 4QEVA 5EISA 4QSWA 2DVSA 4QUUA 4HXOA 5AMFA 4O7FA 4PCEA 5ENHA 4NR5A 5I89A 5IGLA 5I83A 5D26A 4ALHA 4PY6A 4O70A 4A9KA 4QSRA 5II2A 4N4FA 5EM3A 3I3JA 5F36A 4XUBA 2RS9B 5LJ1A 2YW5A 2L5EA 5D0CA 4UYFB 5ENIA 5C87A 3U5OA 2DVRA 4QSTA 3ONIA 4QSXA 5JWMA 3HMFA 5FG5A 4UYHA 4IORA 5D7XA 5I1QA 4TS8A 4TQNA 3UVXA 2WP1A 3MQMA 4NXJA 5J0DA 2YDWA 4AKNA 3FKMX 4C67A 5EA1A 4YYDA 4N4HA 5HLSA 5F1LA 5ENJA 5LJ2A 4AKGA 2WP2A 5BT3A 4O7BA 4CFKA 4IOQA 2RNXA 4KCXA 3UVDA 4QNSA 4J1PA 5CPEA 4O71A 4IR6A 3VKGA 3S91A 5E73A 5FFYA 2DVVA 5E9IA 4CUUA 4TU6A 5EWVA 4QY4A 5LKZA 5CQ6A 5E9KA 2N9GA 3IU5A 5HRWA 5F2PA 1F68A 3U5MA 5CQ3A 4TTEA 4PCIA 5F3AA 2L85A 4NR7A 4IR4A 2OSSA 3P1FA 5D3NA 2YYNA 4Q0NA 5E9MA 4TZ8A 3JVJA 5FE3A 4LZRA 4QC3A 5HRXA 5CQTA 5F61A 2F6JA 4NR6A 5FB1A 3P1CA 4IOOA 4O76A 5F25A 5ENEA 5ETDA 5CY9A 5DKHA 4LRGA 5HCLA 5HEMA 5DYXA 5D3LA 5E9LA 4CL9A 3QZSA 4YYKA 4A9FA 4YY6A 4J0RA 5H1UA 5FH8A 1X0JA 5DKDA 2E7OA 5F5ZA 5LKUA 4QZSA 2DWWA 5FH7A 5IGNA 3UV5A 3MB3A 4WIVA 5FE4A 5K29A 2DVQA 4OGIA 5CRZA 2OO1A 3Q2FA 4QSPA 5E74A 2H60A 5D25A 3U5LA 3U5NA 5IG6A 5L96A 4QEWA 4Z1QA 4PTBA 4UIZA 4N4GA 3SVFA 4YBTA 4LYIA 3LXJA 4HXLA 4CUSA 5EK9A 4HXNA 4NUCA 4A9MA 3JVMA 5C89A 4YBMA 4O7CA 2DATA 5DLXA 4CUPA 4XY9A 2YELA 4J0SA 5HQ6A 2YQDA 5CUAA 5C7NA 4AKIA 4Z93A 5D3JA 4TYLA 4DONA 5A5NA 2R0VA 4MR6A 3G0JA 5EVAA 5E7DA 2NXBA 5ENGA 4YH3A 4TZ2A 4QR5A 5EWDA 5C85A 4UIWA 5H1TA 5LKTA 5EP7A 4TU4A 5CGPA 4AI6A 4MR4A 3O33A 5EWHA 3D1BA 5ENCA 3LQJA 4LZSA 2FSAA 4XYAA 3HMEA 4YYGA 3UV2A 5EU1A 2YEKA 4KV1A 5CUDA 5KO4A 4NR4A 4A9NA 3MULA 3LQHA 4QYDA 4BW1A 4A9LA 5AD3A 5H85A 5II1A 3IU6A 5FH6A 5KTXA 5EWWA 4QUTA 5HM0A 5CQ5A 4IR3A 5EWCA 5LVQA 5IBNA 5KHMA 2R10A 3ERRA 5EQ1A 1E6IA 4YATA 4NRCA 4OGJA 5A81A 4BHWA 4O74A 5JI8A 5KU3A 4E96A 2D82A 2GRCA 5DYCA 4KV4A 5H1VA 5DBMA 5A7CA 4O7EA 5HJCA 4YH4A 2E7NA 4HXMA 4XUAA 4NRBA 5D3TA 5DYAA 4GPJA 5FE6A 4YBSA 5FFWA 5FB0A 5DX4A 2RFJA 4ZQLA 5G4SA 5LUUA 4AKHA 4QSSA 5DFCA 5COIA 4CURA 2I8NA 2MJVB 5HELA 4TT4A 5CUBA 4O78A 4HXRA 5DW1A 5ENBA 5F63A 4WHUA 5L8TA 5CQ8A 3UW9A 2RNYA 3JVKA 3D7CA 4Q0OA 5I80A 3U5KA 5HRVA 5FE5A 4UIVA 5LVRA 2I7KA 4MEQA 3D1DA 4QSUA 5FG4A 3P1DA 4ALGA 4NYWA 2RI7A 4RVRA 3LQIA 4QB3A 5FE9A 4J3IA 4UYEA 4YAXA 5AMEA 1PUOA 5DFDA 4MEOA 4NQMA 5FBXA 1ZS5A 3P5OA 4MENA 3DAIA 5CUGA 5FE1A 5D3RA 1JM4B 5DY7A 1JSPB 5CFWA 4MR5A 2DKWA 1WUGA 5EGUA 4Z6IA 4CUTA 4A9IA 4UYDA 5L99A 5FG6A 5HENA 5A5PA 4LYWA 4YADA 4NUDA 4HXSA 5KTWA 4HBXA 5EICA 2L84A
chains in the Genus database with same CATH topology
3Q2EA 4O72A 3JVLA 5ACYA 5FE2A 4O75A 5A85A 5I40A 4LDFA 4MR3A 4O77A 4QSVA 3UVYA 4TT2A 5E3DA 4NR9A 5IIDA 4MEPA 4Z1SA 4UITA 2KTBB 5CQ7A 4F3IA 5F60A 4UYFA 5HQ5A 3K2JA 4YY4A 5CU8A 4NQNA 4PS5A 5CQAA 3HMHA 4QR3A 5CTLA 5E0RA 5A5OA 5BT5A 4YYIA 5F62A 4OUFA 5IGMA 4CUQA 5KTUA 3O37A 4X2IA 5E3GA 4A9OA 5DLZA 4YC9A 5FDZA 3AADA 3NXBA 4NYXA 4CLBA 4N4IA 5ENFA 4Z6HA 3GG3A 4QYLA 3G0LA 5DFBA 4C66A 4Y03A 4LYSA 4O7AA 2OUOA 3S92A 5C4QA 5D3SA 3UVWA 4BW3A 3QZVA 5FE0A 5DKCA 5L97A 3O34A 5FFVA 5LKXA 4NUEA 5D24A 4QC1A 4HBVA 4IR5A 2G4AA 5A82A 4CFLA 3UV4A 4NYVA 5D3HA 2E3KA 4FLPA 4YK0A 3MUKA 5CUCA 5A5SA 4LZ2A 5I29A 2RO1A 1N72A 3O36A 4BW4A 5ETBA 5BT4A 4LR6A 5TB6A 4HXKA 5HFQA 3MXFA 4QR4A 4YABA 5I86A 5IGKA 2D9EA 4UIUA 3QZTA 4NR8A 4NS5A 2F6NA 5E9YA 5I7XA 3P1EA 5E9VA 4XY8A 4BW2A 3SVHA 4ZW1A 4WHWA 5LJ0A 4LC2A 4A9JA 4NRAA 5CZGA 4QBMA 3U5PA 4PKLA 5CQ4A 5G4RA 3LJWA 4HBWA 5C8GA 4QSQA 5CP5A 4A9HA 4YYHA 3O35A 4YYNA 5A5QA 5EPBA 4QEUA 3ZYUA 2R0SA 4YYJA 4YYMA 4N3WA 2R0YA 5DYUA 3MB4A 5F1HA 5FE7A 2YEMA 5I88A 5AD2A 5EPRA 4HXPA 3U5JA 4TT6A 3DWYA 5L8UA 1EQFA 4BJXA 4UIYA 5EPSA 3TLPA 4ZC9A 2RNWA 3AQAA 5CUEA 5D3PA 5A83A 5A5RA 5HQ7A 5EV9A 5CRMA 5HFRA 5CS8A 5I7YA 3RCWA 4UYGA 4UIXA 5EI4A 2LSPB 5TCMA 1WUMA 5DW2A 5FE8A 4HBYA 4A9EA 3SVGA 5L98A 4QEVA 5EISA 4QSWA 2DVSA 4QUUA 4HXOA 5AMFA 4O7FA 4PCEA 5ENHA 4NR5A 5I89A 5IGLA 5I83A 5D26A 4ALHA 4PY6A 4O70A 4A9KA 4QSRA 5II2A 4N4FA 5EM3A 3I3JA 5F36A 4XUBA 2RS9B 5LJ1A 2YW5A 2L5EA 5D0CA 4UYFB 5ENIA 5C87A 3U5OA 2DVRA 4QSTA 3ONIA 4QSXA 5JWMA 3HMFA 5FG5A 4UYHA 4IORA 5D7XA 5I1QA 4TS8A 4TQNA 3UVXA 2WP1A 3MQMA 4NXJA 5J0DA 2YDWA 4AKNA 3FKMX 4C67A 5EA1A 4YYDA 4N4HA 5HLSA 5F1LA 5ENJA 5LJ2A 2WP2A 5BT3A 4O7BA 4CFKA 4IOQA 2RNXA 4KCXA 3UVDA 4QNSA 4J1PA 5CPEA 4O71A 4IR6A 3S91A 5E73A 5FFYA 2DVVA 5E9IA 4CUUA 4TU6A 5EWVA 4QY4A 5LKZA 5CQ6A 5E9KA 2N9GA 3IU5A 5HRWA 5F2PA 1F68A 3U5MA 5CQ3A 4TTEA 4PCIA 5F3AA 2L85A 4NR7A 4IR4A 2OSSA 3P1FA 5D3NA 2YYNA 4Q0NA 5E9MA 4TZ8A 3JVJA 5FE3A 4LZRA 4QC3A 5HRXA 5CQTA 5F61A 2F6JA 4NR6A 5FB1A 3P1CA 4IOOA 4O76A 5F25A 5ENEA 5ETDA 5CY9A 5DKHA 4LRGA 5HCLA 5HEMA 5DYXA 5D3LA 5E9LA 4CL9A 3QZSA 4YYKA 4A9FA 4YY6A 4J0RA 5H1UA 5FH8A 1X0JA 5DKDA 2E7OA 5F5ZA 5LKUA 4QZSA 2DWWA 5FH7A 5IGNA 3UV5A 3MB3A 4WIVA 5FE4A 5K29A 2DVQA 4OGIA 5CRZA 2OO1A 3Q2FA 4QSPA 5E74A 2H60A 5D25A 3U5LA 3U5NA 5IG6A 5L96A 4QEWA 4Z1QA 4PTBA 4UIZA 4N4GA 3SVFA 4YBTA 4LYIA 3LXJA 4HXLA 4CUSA 5EK9A 4HXNA 4NUCA 4A9MA 3JVMA 5C89A 4YBMA 4O7CA 2DATA 5DLXA 4CUPA 2YELA 4XY9A 4J0SA 5HQ6A 2YQDA 5CUAA 5C7NA 4Z93A 5D3JA 4TYLA 4DONA 5A5NA 2R0VA 4MR6A 3G0JA 5EVAA 5E7DA 2NXBA 5ENGA 4YH3A 4TZ2A 4QR5A 5EWDA 5C85A 4UIWA 5H1TA 5LKTA 5EP7A 4TU4A 5CGPA 4MR4A 3O33A 5EWHA 5ENCA 3LQJA 4LZSA 2FSAA 4XYAA 3HMEA 4YYGA 3UV2A 5EU1A 2YEKA 4KV1A 5CUDA 5KO4A 4NR4A 4A9NA 3MULA 3LQHA 4QYDA 4BW1A 4A9LA 5AD3A 5H85A 5II1A 3IU6A 5FH6A 5KTXA 5EWWA 4QUTA 5HM0A 5CQ5A 4IR3A 5EWCA 5LVQA 5IBNA 5KHMA 2R10A 5EQ1A 1E6IA 4YATA 4NRCA 4OGJA 5A81A 4BHWA 4O74A 5JI8A 5KU3A 4E96A 2D82A 2GRCA 5DYCA 4KV4A 5H1VA 5DBMA 5A7CA 4O7EA 5HJCA 4YH4A 2E7NA 4HXMA 4XUAA 4NRBA 5D3TA 5DYAA 4GPJA 5FE6A 4YBSA 5FFWA 5FB0A 5DX4A 2RFJA 4ZQLA 5G4SA 5LUUA 4QSSA 5DFCA 5COIA 4CURA 2I8NA 2MJVB 5HELA 4TT4A 5CUBA 4O78A 4HXRA 5DW1A 5ENBA 5F63A 4WHUA 5L8TA 5CQ8A 3UW9A 2RNYA 3JVKA 3D7CA 4Q0OA 5I80A 3U5KA 5HRVA 5FE5A 4UIVA 5LVRA 2I7KA 4MEQA 4QSUA 5FG4A 3P1DA 4ALGA 4NYWA 2RI7A 4RVRA 3LQIA 4QB3A 5FE9A 4J3IA 4UYEA 4YAXA 5AMEA 5DFDA 4MEOA 4NQMA 5FBXA 1ZS5A 3P5OA 4MENA 3DAIA 5CUGA 5FE1A 5D3RA 1JM4B 5DY7A 1JSPB 5CFWA 4MR5A 2DKWA 1WUGA 5EGUA 4Z6IA 4CUTA 4A9IA 4UYDA 5L99A 5FG6A 5HENA 5A5PA 4LYWA 4YADA 4NUDA 4HXSA 5KTWA 4HBXA 5EICA 2L84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2E A;  4O72 A;  3JVL A;  5ACY A;  5FE2 A;  4O75 A;  5A85 A;  5I40 A;  4LDF A;  4MR3 A;  4O77 A;  4QSV A;  3UVY A;  4TT2 A;  5E3D A;  4NR9 A;  5IID A;  4MEP A;  4Z1S A;  4UIT A;  2KTB B;  5CQ7 A;  4F3I A;  5F60 A;  4UYF A;  5HQ5 A;  3K2J A;  4YY4 A;  5CU8 A;  4NQN A;  4PS5 A;  5CQA A;  3HMH A;  4QR3 A;  5CTL A;  5E0R A;  5A5O A;  5BT5 A;  4YYI A;  5F62 A;  4OUF A;  5IGM A;  4CUQ A;  5KTU A;  3O37 A;  4X2I A;  5E3G A;  4A9O A;  5DLZ A;  4YC9 A;  5FDZ A;  3AAD A;  3NXB A;  4NYX A;  4CLB A;  4N4I A;  5ENF A;  4Z6H A;  3GG3 A;  4QYL A;  3G0L A;  5DFB A;  4C66 A;  4Y03 A;  4LYS A;  4O7A A;  2OUO A;  3S92 A;  5C4Q A;  5D3S A;  3UVW A;  4BW3 A;  3QZV A;  5FE0 A;  5DKC A;  5L97 A;  3O34 A;  5FFV A;  5LKX A;  4NUE A;  5D24 A;  4QC1 A;  4HBV A;  4IR5 A;  2G4A A;  5A82 A;  4CFL A;  3UV4 A;  4NYV A;  5D3H A;  2E3K A;  4FLP A;  4YK0 A;  3MUK A;  5CUC A;  5A5S A;  4LZ2 A;  5I29 A;  2RO1 A;  1N72 A;  3O36 A;  4BW4 A;  5ETB A;  5BT4 A;  4LR6 A;  5TB6 A;  4HXK A;  5HFQ A;  3MXF A;  4QR4 A;  4YAB A;  5I86 A;  5IGK A;  2D9E A;  4UIU A;  3QZT A;  4NR8 A;  4NS5 A;  2F6N A;  5E9Y A;  5I7X A;  3P1E A;  5E9V A;  4XY8 A;  4BW2 A;  3SVH A;  4ZW1 A;  4WHW A;  5LJ0 A;  4LC2 A;  4A9J A;  4NRA A;  5CZG A;  4QBM A;  3U5P A;  4PKL A;  5CQ4 A;  5G4R A;  3LJW A;  4HBW A;  5C8G A;  4QSQ A;  5CP5 A;  4A9H A;  4YYH A;  3O35 A;  4YYN A;  5A5Q A;  5EPB A;  4QEU A;  3ZYU A;  2R0S A;  4YYJ A;  4YYM A;  4N3W A;  2R0Y A;  5DYU A;  3MB4 A;  5F1H A;  5FE7 A;  2YEM A;  5I88 A;  5AD2 A;  5EPR A;  4HXP A;  3U5J A;  4TT6 A;  3DWY A;  5L8U A;  1EQF A;  4BJX A;  4UIY A;  5EPS A;  3TLP A;  4ZC9 A;  2RNW A;  3AQA A;  5CUE A;  5D3P A;  5A83 A;  5A5R A;  5HQ7 A;  5EV9 A;  5CRM A;  5HFR A;  5CS8 A;  5I7Y A;  3RCW A;  4UYG A;  4UIX A;  5EI4 A;  2LSP B;  5TCM A;  1WUM A;  5DW2 A;  5FE8 A;  4HBY A;  4A9E A;  3SVG A;  5L98 A;  4QEV A;  5EIS A;  4QSW A;  2DVS A;  4QUU A;  4HXO A;  5AMF A;  4O7F A;  4PCE A;  5ENH A;  4NR5 A;  5I89 A;  5IGL A;  5I83 A;  5D26 A;  4ALH A;  4PY6 A;  4O70 A;  4A9K A;  4QSR A;  5II2 A;  4N4F A;  5EM3 A;  3I3J A;  5F36 A;  4XUB A;  2RS9 B;  5LJ1 A;  2YW5 A;  2L5E A;  5D0C A;  4UYF B;  5ENI A;  5C87 A;  3U5O A;  2DVR A;  4QST A;  3ONI A;  4QSX A;  5JWM A;  3HMF A;  5FG5 A;  4UYH A;  4IOR A;  5D7X A;  5I1Q A;  4TS8 A;  4TQN A;  3UVX A;  2WP1 A;  3MQM A;  4NXJ A;  5J0D A;  2YDW A;  4AKN A;  3FKM X;  4C67 A;  5EA1 A;  4YYD A;  4N4H A;  5HLS A;  5F1L A;  5ENJ A;  5LJ2 A;  2WP2 A;  5BT3 A;  4O7B A;  4CFK A;  4IOQ A;  2RNX A;  4KCX A;  3UVD A;  4QNS A;  4J1P A;  5CPE A;  4O71 A;  4IR6 A;  3S91 A;  5E73 A;  5FFY A;  2DVV A;  5E9I A;  4CUU A;  4TU6 A;  5EWV A;  4QY4 A;  5LKZ A;  5CQ6 A;  5E9K A;  2N9G A;  3IU5 A;  5HRW A;  5F2P A;  1F68 A;  3U5M A;  5CQ3 A;  4TTE A;  4PCI A;  5F3A A;  2L85 A;  4NR7 A;  4IR4 A;  2OSS A;  3P1F A;  5D3N A;  2YYN A;  4Q0N A;  5E9M A;  4TZ8 A;  3JVJ A;  5FE3 A;  4LZR A;  4QC3 A;  5HRX A;  5CQT A;  5F61 A;  2F6J A;  4NR6 A;  5FB1 A;  3P1C A;  4IOO A;  4O76 A;  5F25 A;  5ENE A;  5ETD A;  5CY9 A;  5DKH A;  4LRG A;  5HCL A;  5HEM A;  5DYX A;  5D3L A;  5E9L A;  4CL9 A;  3QZS A;  4YYK A;  4A9F A;  4YY6 A;  4J0R A;  5H1U A;  5FH8 A;  1X0J A;  5DKD A;  2E7O A;  5F5Z A;  5LKU A;  4QZS A;  2DWW A;  5FH7 A;  5IGN A;  3UV5 A;  3MB3 A;  4WIV A;  5FE4 A;  5K29 A;  2DVQ A;  4OGI A;  5CRZ A;  2OO1 A;  3Q2F A;  4QSP A;  5E74 A;  2H60 A;  5D25 A;  3U5L A;  3U5N A;  5IG6 A;  5L96 A;  4QEW A;  4Z1Q A;  4PTB A;  4UIZ A;  4N4G A;  3SVF A;  4YBT A;  4LYI A;  3LXJ A;  4HXL A;  4CUS A;  5EK9 A;  4HXN A;  4NUC A;  4A9M A;  3JVM A;  5C89 A;  4YBM A;  4O7C A;  2DAT A;  5DLX A;  4CUP A;  2YEL A;  4XY9 A;  4J0S A;  5HQ6 A;  2YQD A;  5CUA A;  5C7N A;  4Z93 A;  5D3J A;  4TYL A;  4DON A;  5A5N A;  2R0V A;  4MR6 A;  3G0J A;  5EVA A;  5E7D A;  2NXB A;  5ENG A;  4YH3 A;  4TZ2 A;  4QR5 A;  5EWD A;  5C85 A;  4UIW A;  5H1T A;  5LKT A;  5EP7 A;  4TU4 A;  5CGP A;  4MR4 A;  3O33 A;  5EWH A;  5ENC A;  3LQJ A;  4LZS A;  2FSA A;  4XYA A;  3HME A;  4YYG A;  3UV2 A;  5EU1 A;  2YEK A;  4KV1 A;  5CUD A;  5KO4 A;  4NR4 A;  4A9N A;  3MUL A;  3LQH A;  4QYD A;  4BW1 A;  4A9L A;  5AD3 A;  5H85 A;  5II1 A;  3IU6 A;  5FH6 A;  5KTX A;  5EWW A;  4QUT A;  5HM0 A;  5CQ5 A;  4IR3 A;  5EWC A;  5LVQ A;  5IBN A;  5KHM A;  2R10 A;  5EQ1 A;  1E6I A;  4YAT A;  4NRC A;  4OGJ A;  5A81 A;  4BHW A;  4O74 A;  5JI8 A;  5KU3 A;  4E96 A;  2D82 A;  2GRC A;  5DYC A;  4KV4 A;  5H1V A;  5DBM A;  5A7C A;  4O7E A;  5HJC A;  4YH4 A;  2E7N A;  4HXM A;  4XUA A;  4NRB A;  5D3T A;  5DYA A;  4GPJ A;  5FE6 A;  4YBS A;  5FFW A;  5FB0 A;  5DX4 A;  2RFJ A;  4ZQL A;  5G4S A;  5LUU A;  4QSS A;  5DFC A;  5COI A;  4CUR A;  2I8N A;  2MJV B;  5HEL A;  4TT4 A;  5CUB A;  4O78 A;  4HXR A;  5DW1 A;  5ENB A;  5F63 A;  4WHU A;  5L8T A;  5CQ8 A;  3UW9 A;  2RNY A;  3JVK A;  3D7C A;  4Q0O A;  5I80 A;  3U5K A;  5HRV A;  5FE5 A;  4UIV A;  5LVR A;  2I7K A;  4MEQ A;  4QSU A;  5FG4 A;  3P1D A;  4ALG A;  4NYW A;  2RI7 A;  4RVR A;  3LQI A;  4QB3 A;  5FE9 A;  4J3I A;  4UYE A;  4YAX A;  5AME A;  5DFD A;  4MEO A;  4NQM A;  5FBX A;  1ZS5 A;  3P5O A;  4MEN A;  3DAI A;  5CUG A;  5FE1 A;  5D3R A;  1JM4 B;  5DY7 A;  1JSP B;  5CFW A;  4MR5 A;  2DKW A;  1WUG A;  5EGU A;  4Z6I A;  4CUT A;  4A9I A;  4UYD A;  5L99 A;  5FG6 A;  5HEN A;  5A5P A;  4LYW A;  4YAD A;  4NUD A;  4HXS A;  5KTW A;  4HBX A;  5EIC A;  2L84 A; 
#chains in the Genus database with same CATH topology
 3Q2E A;  4O72 A;  3JVL A;  5ACY A;  5FE2 A;  4O75 A;  5A85 A;  5I40 A;  3VKH A;  4LDF A;  4MR3 A;  2EJN A;  4O77 A;  4QSV A;  3UVY A;  4TT2 A;  5E3D A;  4NR9 A;  5IID A;  4MEP A;  4Z1S A;  4UIT A;  1ZKR A;  2KTB B;  5CQ7 A;  4F3I A;  5F60 A;  4UYF A;  5HQ5 A;  3K2J A;  4YY4 A;  5CU8 A;  4NQN A;  4PS5 A;  5CQA A;  3HMH A;  4QR3 A;  5CTL A;  5E0R A;  5A5O A;  5BT5 A;  4YYI A;  5F62 A;  4OUF A;  5IGM A;  4CUQ A;  5KTU A;  3O37 A;  4X2I A;  5E3G A;  4A9O A;  5DLZ A;  4YC9 A;  5FDZ A;  3AAD A;  3NXB A;  4NYX A;  4CLB A;  4N4I A;  5ENF A;  4Z6H A;  3GG3 A;  4QYL A;  3G0L A;  5DFB A;  4C66 A;  4Y03 A;  4LYS A;  4O7A A;  2OUO A;  3S92 A;  5C4Q A;  5D3S A;  3UVW A;  4BW3 A;  3QZV A;  5FE0 A;  5DKC A;  5L97 A;  3O34 A;  5FFV A;  5LKX A;  4NUE A;  5D24 A;  4QC1 A;  4HBV A;  4IR5 A;  2G4A A;  5A82 A;  4CFL A;  3UV4 A;  4NYV A;  5D3H A;  2E3K A;  4FLP A;  4YK0 A;  3MUK A;  5CUC A;  5A5S A;  4LZ2 A;  5I29 A;  2RO1 A;  1N72 A;  3O36 A;  4BW4 A;  5ETB A;  5BT4 A;  4LR6 A;  5TB6 A;  4HXK A;  5HFQ A;  3MXF A;  4QR4 A;  4YAB A;  5I86 A;  5IGK A;  2D9E A;  4UIU A;  3QZT A;  4NR8 A;  4NS5 A;  2F6N A;  5E9Y A;  5I7X A;  3P1E A;  5E9V A;  4XY8 A;  4BW2 A;  3SVH A;  4ZW1 A;  4WHW A;  5LJ0 A;  4LC2 A;  4A9J A;  4NRA A;  5CZG A;  4QBM A;  3U5P A;  4PKL A;  5CQ4 A;  5G4R A;  3LJW A;  4HBW A;  5C8G A;  4QSQ A;  5CP5 A;  4A9H A;  4YYH A;  3O35 A;  4YYN A;  5A5Q A;  5EPB A;  4QEU A;  3ZYU A;  2R0S A;  4YYJ A;  4YYM A;  4N3W A;  2R0Y A;  5DYU A;  3MB4 A;  5F1H A;  5FE7 A;  2YEM A;  5I88 A;  5AD2 A;  5EPR A;  4HXP A;  3U5J A;  4TT6 A;  3DWY A;  5L8U A;  1EQF A;  4BJX A;  4UIY A;  5EPS A;  3TLP A;  4ZC9 A;  2RNW A;  3AQA A;  5CUE A;  5D3P A;  5A83 A;  5A5R A;  5HQ7 A;  5EV9 A;  5CRM A;  5HFR A;  5CS8 A;  5I7Y A;  3RCW A;  4UYG A;  4UIX A;  5EI4 A;  2LSP B;  5TCM A;  1WUM A;  5DW2 A;  5FE8 A;  4HBY A;  4A9E A;  3SVG A;  5L98 A;  4QEV A;  5EIS A;  4QSW A;  2DVS A;  4QUU A;  4HXO A;  5AMF A;  4O7F A;  4PCE A;  5ENH A;  4NR5 A;  5I89 A;  5IGL A;  5I83 A;  5D26 A;  4ALH A;  4PY6 A;  4O70 A;  4A9K A;  4QSR A;  5II2 A;  4N4F A;  5EM3 A;  3I3J A;  5F36 A;  4XUB A;  2RS9 B;  5LJ1 A;  2YW5 A;  2L5E A;  5D0C A;  4UYF B;  5ENI A;  5C87 A;  3U5O A;  2DVR A;  4QST A;  3ONI A;  4QSX A;  5JWM A;  3HMF A;  5FG5 A;  4UYH A;  4IOR A;  5D7X A;  5I1Q A;  4TS8 A;  4TQN A;  3UVX A;  2WP1 A;  3MQM A;  4NXJ A;  5J0D A;  2YDW A;  4AKN A;  3FKM X;  4C67 A;  5EA1 A;  4YYD A;  4N4H A;  5HLS A;  5F1L A;  5ENJ A;  5LJ2 A;  4AKG A;  2WP2 A;  5BT3 A;  4O7B A;  4CFK A;  4IOQ A;  2RNX A;  4KCX A;  3UVD A;  4QNS A;  4J1P A;  5CPE A;  4O71 A;  4IR6 A;  3VKG A;  3S91 A;  5E73 A;  5FFY A;  2DVV A;  5E9I A;  4CUU A;  4TU6 A;  5EWV A;  4QY4 A;  5LKZ A;  5CQ6 A;  5E9K A;  2N9G A;  3IU5 A;  5HRW A;  5F2P A;  1F68 A;  3U5M A;  5CQ3 A;  4TTE A;  4PCI A;  5F3A A;  2L85 A;  4NR7 A;  4IR4 A;  2OSS A;  3P1F A;  5D3N A;  2YYN A;  4Q0N A;  5E9M A;  4TZ8 A;  3JVJ A;  5FE3 A;  4LZR A;  4QC3 A;  5HRX A;  5CQT A;  5F61 A;  2F6J A;  4NR6 A;  5FB1 A;  3P1C A;  4IOO A;  4O76 A;  5F25 A;  5ENE A;  5ETD A;  5CY9 A;  5DKH A;  4LRG A;  5HCL A;  5HEM A;  5DYX A;  5D3L A;  5E9L A;  4CL9 A;  3QZS A;  4YYK A;  4A9F A;  4YY6 A;  4J0R A;  5H1U A;  5FH8 A;  1X0J A;  5DKD A;  2E7O A;  5F5Z A;  5LKU A;  4QZS A;  2DWW A;  5FH7 A;  5IGN A;  3UV5 A;  3MB3 A;  4WIV A;  5FE4 A;  5K29 A;  2DVQ A;  4OGI A;  5CRZ A;  2OO1 A;  3Q2F A;  4QSP A;  5E74 A;  2H60 A;  5D25 A;  3U5L A;  3U5N A;  5IG6 A;  5L96 A;  4QEW A;  4Z1Q A;  4PTB A;  4UIZ A;  4N4G A;  3SVF A;  4YBT A;  4LYI A;  3LXJ A;  4HXL A;  4CUS A;  5EK9 A;  4HXN A;  4NUC A;  4A9M A;  3JVM A;  5C89 A;  4YBM A;  4O7C A;  2DAT A;  5DLX A;  4CUP A;  4XY9 A;  2YEL A;  4J0S A;  5HQ6 A;  2YQD A;  5CUA A;  5C7N A;  4AKI A;  4Z93 A;  5D3J A;  4TYL A;  4DON A;  5A5N A;  2R0V A;  4MR6 A;  3G0J A;  5EVA A;  5E7D A;  2NXB A;  5ENG A;  4YH3 A;  4TZ2 A;  4QR5 A;  5EWD A;  5C85 A;  4UIW A;  5H1T A;  5LKT A;  5EP7 A;  4TU4 A;  5CGP A;  4AI6 A;  4MR4 A;  3O33 A;  5EWH A;  3D1B A;  5ENC A;  3LQJ A;  4LZS A;  2FSA A;  4XYA A;  3HME A;  4YYG A;  3UV2 A;  5EU1 A;  2YEK A;  4KV1 A;  5CUD A;  5KO4 A;  4NR4 A;  4A9N A;  3MUL A;  3LQH A;  4QYD A;  4BW1 A;  4A9L A;  5AD3 A;  5H85 A;  5II1 A;  3IU6 A;  5FH6 A;  5KTX A;  5EWW A;  4QUT A;  5HM0 A;  5CQ5 A;  4IR3 A;  5EWC A;  5LVQ A;  5IBN A;  5KHM A;  2R10 A;  3ERR A;  5EQ1 A;  1E6I A;  4YAT A;  4NRC A;  4OGJ A;  5A81 A;  4BHW A;  4O74 A;  5JI8 A;  5KU3 A;  4E96 A;  2D82 A;  2GRC A;  5DYC A;  4KV4 A;  5H1V A;  5DBM A;  5A7C A;  4O7E A;  5HJC A;  4YH4 A;  2E7N A;  4HXM A;  4XUA A;  4NRB A;  5D3T A;  5DYA A;  4GPJ A;  5FE6 A;  4YBS A;  5FFW A;  5FB0 A;  5DX4 A;  2RFJ A;  4ZQL A;  5G4S A;  5LUU A;  4AKH A;  4QSS A;  5DFC A;  5COI A;  4CUR A;  2I8N A;  2MJV B;  5HEL A;  4TT4 A;  5CUB A;  4O78 A;  4HXR A;  5DW1 A;  5ENB A;  5F63 A;  4WHU A;  5L8T A;  5CQ8 A;  3UW9 A;  2RNY A;  3JVK A;  3D7C A;  4Q0O A;  5I80 A;  3U5K A;  5HRV A;  5FE5 A;  4UIV A;  5LVR A;  2I7K A;  4MEQ A;  3D1D A;  4QSU A;  5FG4 A;  3P1D A;  4ALG A;  4NYW A;  2RI7 A;  4RVR A;  3LQI A;  4QB3 A;  5FE9 A;  4J3I A;  4UYE A;  4YAX A;  5AME A;  1PUO A;  5DFD A;  4MEO A;  4NQM A;  5FBX A;  1ZS5 A;  3P5O A;  4MEN A;  3DAI A;  5CUG A;  5FE1 A;  5D3R A;  1JM4 B;  5DY7 A;  1JSP B;  5CFW A;  4MR5 A;  2DKW A;  1WUG A;  5EGU A;  4Z6I A;  4CUT A;  4A9I A;  4UYD A;  5L99 A;  5FG6 A;  5HEN A;  5A5P A;  4LYW A;  4YAD A;  4NUD A;  4HXS A;  5KTW A;  4HBX A;  5EIC A;  2L84 A; 
#chains in the Genus database with same CATH homology
 3Q2E A;  4O72 A;  3JVL A;  5ACY A;  5FE2 A;  4O75 A;  5A85 A;  5I40 A;  4LDF A;  4MR3 A;  4O77 A;  4QSV A;  3UVY A;  4TT2 A;  5E3D A;  4NR9 A;  5IID A;  4MEP A;  4Z1S A;  4UIT A;  2KTB B;  5CQ7 A;  4F3I A;  5F60 A;  4UYF A;  5HQ5 A;  3K2J A;  4YY4 A;  5CU8 A;  4NQN A;  4PS5 A;  5CQA A;  3HMH A;  4QR3 A;  5CTL A;  5E0R A;  5A5O A;  5BT5 A;  4YYI A;  5F62 A;  4OUF A;  5IGM A;  4CUQ A;  5KTU A;  3O37 A;  4X2I A;  5E3G A;  4A9O A;  5DLZ A;  4YC9 A;  5FDZ A;  3AAD A;  3NXB A;  4NYX A;  4CLB A;  4N4I A;  5ENF A;  4Z6H A;  3GG3 A;  4QYL A;  3G0L A;  5DFB A;  4C66 A;  4Y03 A;  4LYS A;  4O7A A;  2OUO A;  3S92 A;  5C4Q A;  5D3S A;  3UVW A;  4BW3 A;  3QZV A;  5FE0 A;  5DKC A;  5L97 A;  3O34 A;  5FFV A;  5LKX A;  4NUE A;  5D24 A;  4QC1 A;  4HBV A;  4IR5 A;  2G4A A;  5A82 A;  4CFL A;  3UV4 A;  4NYV A;  5D3H A;  2E3K A;  4FLP A;  4YK0 A;  3MUK A;  5CUC A;  5A5S A;  4LZ2 A;  5I29 A;  2RO1 A;  1N72 A;  3O36 A;  4BW4 A;  5ETB A;  5BT4 A;  4LR6 A;  5TB6 A;  4HXK A;  5HFQ A;  3MXF A;  4QR4 A;  4YAB A;  5I86 A;  5IGK A;  2D9E A;  4UIU A;  3QZT A;  4NR8 A;  4NS5 A;  2F6N A;  5E9Y A;  5I7X A;  3P1E A;  5E9V A;  4XY8 A;  4BW2 A;  3SVH A;  4ZW1 A;  4WHW A;  5LJ0 A;  4LC2 A;  4A9J A;  4NRA A;  5CZG A;  4QBM A;  3U5P A;  4PKL A;  5CQ4 A;  5G4R A;  3LJW A;  4HBW A;  5C8G A;  4QSQ A;  5CP5 A;  4A9H A;  4YYH A;  3O35 A;  4YYN A;  5A5Q A;  5EPB A;  4QEU A;  3ZYU A;  2R0S A;  4YYJ A;  4YYM A;  4N3W A;  2R0Y A;  5DYU A;  3MB4 A;  5F1H A;  5FE7 A;  2YEM A;  5I88 A;  5AD2 A;  5EPR A;  4HXP A;  3U5J A;  4TT6 A;  3DWY A;  5L8U A;  1EQF A;  4BJX A;  4UIY A;  5EPS A;  3TLP A;  4ZC9 A;  2RNW A;  3AQA A;  5CUE A;  5D3P A;  5A83 A;  5A5R A;  5HQ7 A;  5EV9 A;  5CRM A;  5HFR A;  5CS8 A;  5I7Y A;  3RCW A;  4UYG A;  4UIX A;  5EI4 A;  2LSP B;  5TCM A;  1WUM A;  5DW2 A;  5FE8 A;  4HBY A;  4A9E A;  3SVG A;  5L98 A;  4QEV A;  5EIS A;  4QSW A;  2DVS A;  4QUU A;  4HXO A;  5AMF A;  4O7F A;  4PCE A;  5ENH A;  4NR5 A;  5I89 A;  5IGL A;  5I83 A;  5D26 A;  4ALH A;  4PY6 A;  4O70 A;  4A9K A;  4QSR A;  5II2 A;  4N4F A;  5EM3 A;  3I3J A;  5F36 A;  4XUB A;  2RS9 B;  5LJ1 A;  2YW5 A;  2L5E A;  5D0C A;  4UYF B;  5ENI A;  5C87 A;  3U5O A;  2DVR A;  4QST A;  3ONI A;  4QSX A;  5JWM A;  3HMF A;  5FG5 A;  4UYH A;  4IOR A;  5D7X A;  5I1Q A;  4TS8 A;  4TQN A;  3UVX A;  2WP1 A;  3MQM A;  4NXJ A;  5J0D A;  2YDW A;  4AKN A;  3FKM X;  4C67 A;  5EA1 A;  4YYD A;  4N4H A;  5HLS A;  5F1L A;  5ENJ A;  5LJ2 A;  2WP2 A;  5BT3 A;  4O7B A;  4CFK A;  4IOQ A;  2RNX A;  4KCX A;  3UVD A;  4QNS A;  4J1P A;  5CPE A;  4O71 A;  4IR6 A;  3S91 A;  5E73 A;  5FFY A;  2DVV A;  5E9I A;  4CUU A;  4TU6 A;  5EWV A;  4QY4 A;  5LKZ A;  5CQ6 A;  5E9K A;  2N9G A;  3IU5 A;  5HRW A;  5F2P A;  1F68 A;  3U5M A;  5CQ3 A;  4TTE A;  4PCI A;  5F3A A;  2L85 A;  4NR7 A;  4IR4 A;  2OSS A;  3P1F A;  5D3N A;  2YYN A;  4Q0N A;  5E9M A;  4TZ8 A;  3JVJ A;  5FE3 A;  4LZR A;  4QC3 A;  5HRX A;  5CQT A;  5F61 A;  2F6J A;  4NR6 A;  5FB1 A;  3P1C A;  4IOO A;  4O76 A;  5F25 A;  5ENE A;  5ETD A;  5CY9 A;  5DKH A;  4LRG A;  5HCL A;  5HEM A;  5DYX A;  5D3L A;  5E9L A;  4CL9 A;  3QZS A;  4YYK A;  4A9F A;  4YY6 A;  4J0R A;  5H1U A;  5FH8 A;  1X0J A;  5DKD A;  2E7O A;  5F5Z A;  5LKU A;  4QZS A;  2DWW A;  5FH7 A;  5IGN A;  3UV5 A;  3MB3 A;  4WIV A;  5FE4 A;  5K29 A;  2DVQ A;  4OGI A;  5CRZ A;  2OO1 A;  3Q2F A;  4QSP A;  5E74 A;  2H60 A;  5D25 A;  3U5L A;  3U5N A;  5IG6 A;  5L96 A;  4QEW A;  4Z1Q A;  4PTB A;  4UIZ A;  4N4G A;  3SVF A;  4YBT A;  4LYI A;  3LXJ A;  4HXL A;  4CUS A;  5EK9 A;  4HXN A;  4NUC A;  4A9M A;  3JVM A;  5C89 A;  4YBM A;  4O7C A;  2DAT A;  5DLX A;  4CUP A;  2YEL A;  4XY9 A;  4J0S A;  5HQ6 A;  2YQD A;  5CUA A;  5C7N A;  4Z93 A;  5D3J A;  4TYL A;  4DON A;  5A5N A;  2R0V A;  4MR6 A;  3G0J A;  5EVA A;  5E7D A;  2NXB A;  5ENG A;  4YH3 A;  4TZ2 A;  4QR5 A;  5EWD A;  5C85 A;  4UIW A;  5H1T A;  5LKT A;  5EP7 A;  4TU4 A;  5CGP A;  4MR4 A;  3O33 A;  5EWH A;  5ENC A;  3LQJ A;  4LZS A;  2FSA A;  4XYA A;  3HME A;  4YYG A;  3UV2 A;  5EU1 A;  2YEK A;  4KV1 A;  5CUD A;  5KO4 A;  4NR4 A;  4A9N A;  3MUL A;  3LQH A;  4QYD A;  4BW1 A;  4A9L A;  5AD3 A;  5H85 A;  5II1 A;  3IU6 A;  5FH6 A;  5KTX A;  5EWW A;  4QUT A;  5HM0 A;  5CQ5 A;  4IR3 A;  5EWC A;  5LVQ A;  5IBN A;  5KHM A;  2R10 A;  5EQ1 A;  1E6I A;  4YAT A;  4NRC A;  4OGJ A;  5A81 A;  4BHW A;  4O74 A;  5JI8 A;  5KU3 A;  4E96 A;  2D82 A;  2GRC A;  5DYC A;  4KV4 A;  5H1V A;  5DBM A;  5A7C A;  4O7E A;  5HJC A;  4YH4 A;  2E7N A;  4HXM A;  4XUA A;  4NRB A;  5D3T A;  5DYA A;  4GPJ A;  5FE6 A;  4YBS A;  5FFW A;  5FB0 A;  5DX4 A;  2RFJ A;  4ZQL A;  5G4S A;  5LUU A;  4QSS A;  5DFC A;  5COI A;  4CUR A;  2I8N A;  2MJV B;  5HEL A;  4TT4 A;  5CUB A;  4O78 A;  4HXR A;  5DW1 A;  5ENB A;  5F63 A;  4WHU A;  5L8T A;  5CQ8 A;  3UW9 A;  2RNY A;  3JVK A;  3D7C A;  4Q0O A;  5I80 A;  3U5K A;  5HRV A;  5FE5 A;  4UIV A;  5LVR A;  2I7K A;  4MEQ A;  4QSU A;  5FG4 A;  3P1D A;  4ALG A;  4NYW A;  2RI7 A;  4RVR A;  3LQI A;  4QB3 A;  5FE9 A;  4J3I A;  4UYE A;  4YAX A;  5AME A;  5DFD A;  4MEO A;  4NQM A;  5FBX A;  1ZS5 A;  3P5O A;  4MEN A;  3DAI A;  5CUG A;  5FE1 A;  5D3R A;  1JM4 B;  5DY7 A;  1JSP B;  5CFW A;  4MR5 A;  2DKW A;  1WUG A;  5EGU A;  4Z6I A;  4CUT A;  4A9I A;  4UYD A;  5L99 A;  5FG6 A;  5HEN A;  5A5P A;  4LYW A;  4YAD A;  4NUD A;  4HXS A;  5KTW A;  4HBX A;  5EIC A;  2L84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...