2R10A

Structure of an acetylated rsc4 tandem bromodomain histone chimera
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
292
Chain Sequence
RPKYLPGHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromatin structure-remodeling complex protein RSC4, LINKER,
publication title Autoregulation of the rsc4 tandem bromodomain by gcn5 acetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 102
structure length 292
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r10A01
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r10A02
2R0YA 3UV5A 5EISA 4LZSA 5ENFA 4LZRA 3LQHA 4ALGA 4WHUA 4N4GA 5CUDA 4MEOA 4YH3A 5FE9A 1X0JA 5IGMA 4QSPA 4CURA 4HXOA 3K2JA 4QY4A 5KHMA 2D82A 4O7FA 5EM3A 5FFWA 2E3KA 5EPBA 5D3RA 3O34A 2DVVA 5BT5A 5JI8A 4IOQA 5HJCA 5C87A 2LSPB 5FB1A 2OUOA 4LYIA 5E3GA 1JSPB 1ZS5A 4BW2A 5KTWA 4UIYA 4O78A 4NR8A 4QR4A 4QSWA 3U5PA 2KTBB 4HBVA 4QR5A 4J0SA 4YYDA 5I7YA 3U5MA 5L97A 4F3IA 4YH4A 3DWYA 5F1LA 5FBXA 3S91A 4UIWA 5LVQA 5DFDA 4QSSA 4FLPA 5EGUA 5E74A 5CQ8A 4YYNA 5AD2A 3MXFA 3HMFA 5DYCA 3HMEA 5FFVA 4YBTA 4IOOA 2R10A 4PCIA 2E7NA 5CPEA 5TCMA 5IGLA 5ACYA 4YYMA 5CS8A 4Z6IA 5H1TA 5A81A 4LRGA 4QZSA 5LJ0A 4RVRA 4O76A 5HEMA 4BJXA 2F6NA 4TZ8A 4O74A 3NXBA 1F68A 3AQAA 5CQ3A 4A9EA 4YBSA 4MR6A 5EA1A 4HBXA 5KO4A 4HXSA 4Z1SA 4MEPA 5ENBA 4UYFA 3O33A 5CQ6A 5I29A 5HFRA 4GPJA 4TT4A 5DKHA 5IG6A 4A9IA 5E9VA 2I8NA 4OUFA 4TQNA 5EWCA 5F3AA 3I3JA 5E9YA 5FFYA 3UW9A 5EVAA 3ONIA 5A5QA 2DWWA 4O7EA 4MR5A 4CL9A 5EPRA 5IGKA 5LVRA 4Z93A 3G0JA 5AMFA 4QYDA 5DYAA 3LQJA 1E6IA 4IR3A 5DFCA 4CLBA 4NUCA 4TT6A 4TT2A 4CUSA 4NR9A 5C8GA 3SVGA 3JVKA 5F63A 5FE0A 1N72A 4PTBA 4YBMA 5DLXA 3UVXA 4NRAA 4QSVA 5HQ6A 5H1UA 4QC3A 2YEKA 3MULA 5ETDA 5F62A 4O75A 4UYFB 2WP1A 4C67A 5L8UA 4ALHA 3Q2FA 5E9MA 2L5EA 3O36A 5DYUA 3P1DA 4A9LA 3P1FA 3P1CA 5CQ7A 3P5OA 4YYHA 4YYKA 5F36A 3JVLA 5G4RA 5FH6A 5L98A 2RNWA 5F1HA 4NR7A 4XY8A 4WHWA 5EK9A 5H1VA 4A9JA 4LR6A 2OO1A 5HRWA 5D3NA 4ZW1A 5EI4A 4YY6A 5E73A 5G4SA 3U5KA 5HFQA 4NQMA 3MUKA 5D24A 3SVFA 5CQ4A 5H85A 4IR4A 5KTXA 2NXBA 4QUTA 5CQAA 3ZYUA 2YW5A 3QZVA 5CFWA 4NRCA 4O7AA 4BHWA 5CQTA 5I86A 5EWWA 2DKWA 5HLSA 2GRCA 4UYDA 4YYGA 4UIZA 5F60A 4A9NA 5F61A 5DBMA 4HXKA 4KV1A 3UVWA 5ENHA 3D7CA 5BT4A 4OGJA 5I83A 3RCWA 5DKDA 5I89A 4N4HA 5CP5A 4QYLA 5HM0A 5CUGA 5HQ7A 5CQ5A 5DW1A 4CUTA 5KTUA 4YATA 2YQDA 2R0SA 1WUGA 5FG6A 4QEWA 2RNYA 5E9LA 2MJVB 4Z6HA 4NQNA 5EPSA 5L96A 4A9HA 5EWHA 3U5NA 2DVRA 4TU4A 5A5OA 4HXMA 3IU5A 2RNXA 5L8TA 4AKNA 5HRXA 4HXPA 2N9GA 2H60A 4MR4A 2OSSA 4WIVA 5CUAA 5DX4A 3JVMA 4QSXA 5EWVA 4N3WA 4PY6A 5ENJA 2DATA 4Q0OA 5FE7A 5C7NA 5II1A 5D3HA 4HXNA 5LUUA 4C66A 5D3TA 3LJWA 4O70A 5F25A 5FH7A 2RS9B 4KCXA 3AADA 4MENA 4O72A 4PCEA 4PKLA 4UIXA 5IBNA 5IGNA 4CFKA 5BT3A 4LYSA 5CRMA 5FE2A 4TU6A 5FE1A 4A9FA 5CRZA 4A9OA 5AMEA 4Z1QA 5D3PA 5I1QA 5CU8A 2L84A 4YC9A 4ZC9A 5LKUA 3O37A 4QB3A 4NR5A 5II2A 3S92A 4YABA 5ENCA 5HENA 2D9EA 2G4AA 5FE8A 4TS8A 5EWDA 4NXJA 5CUBA 4HXLA 5DYXA 5A85A 4QEUA 4LZ2A 5CUEA 3U5JA 4XYAA 3UV4A 3IU6A 5DY7A 4ZQLA 5FG4A 5E3DA 5DFBA 4QSRA 4UIUA 3LXJA 3QZSA 1JM4B 4J1PA 4UYHA 5ENEA 5EICA 4QR3A 5HRVA 2YEMA 4OGIA 4QSTA 1WUMA 5L99A 5LJ2A 5E7DA 4CUPA 5F5ZA 4HXRA 4BW4A 4E96A 5A5SA 4MEQA 4QBMA 5LKTA 5D25A 5CTLA 3U5LA 3LQIA 4HBYA 5E9KA 5CGPA 4QEVA 2RO1A 5A83A 5EV9A 5A5NA 5A5RA 5IIDA 5D3LA 3P1EA 2DVQA 5D0CA 2R0VA 5FE5A 2L85A 3HMHA 4NYVA 5D3JA 1EQFA 4J0RA 4TTEA 3UVDA 5FE4A 3GG3A 4QSUA 4QSQA 4MR3A 4NYWA 3SVHA 4DONA 5CZGA 2WP2A 5DKCA 4O7BA 5EQ1A 5FDZA 5A5PA 4A9MA 5TB6A 5E0RA 5D7XA 5J0DA 2I7KA 5I7XA 4NRBA 5D26A 5DW2A 5HQ5A 5HCLA 4NS5A 2F6JA 4O7CA 5ENGA 5A82A 4XY9A 3DAIA 5FE6A 4LDFA 3Q2EA 4LC2A 4QNSA 4IORA 3QZTA 4NUEA 2YDWA 4YK0A 2E7OA 5FH8A 4YYIA 4UIVA 3U5OA 4NYXA 5C85A 4PS5A 5A7CA 4QC1A 4YADA 4O77A 5EU1A 3UV2A 4IR5A 2RI7A 4Y03A 5FG5A 3MB3A 5I40A 5FE3A 4NR6A 4NUDA 4QUUA 4N4IA 4Q0NA 5CY9A 2YYNA 4N4FA 4YAXA 4TZ2A 5LKXA 5LJ1A 4BW1A 4CFLA 2YELA 4J3IA 4UYEA 5FB0A 3JVJA 4KV4A 5D3SA 4XUAA 5I80A 4CUQA 3G0LA 2FSAA 5F2PA 5EP7A 4O71A 4YYJA 5I88A 5C4QA 5HELA 5E9IA 2DVSA 3FKMX 4IR6A 5ETBA 5DLZA 4A9KA 5JWMA 5COIA 4UYGA 4LYWA 5LKZA 5K29A 4UITA 3O35A 4BW3A 4TYLA 3MQMA 5ENIA 5C89A 4HBWA 5AD3A 2RFJA 3UVYA 5CUCA 4XUBA 4X2IA 5KU3A 3MB4A 3TLPA 4YY4A 4CUUA 4NR4A
chains in the Genus database with same CATH superfamily
2R0YA 3UV5A 5EISA 4LZSA 5ENFA 4LZRA 3LQHA 4ALGA 4WHUA 4N4GA 5CUDA 4MEOA 4YH3A 5FE9A 1X0JA 5IGMA 4QSPA 4CURA 4HXOA 3K2JA 4QY4A 5KHMA 3VKHA 2D82A 4O7FA 5EM3A 5FFWA 2E3KA 5EPBA 5D3RA 3O34A 2DVVA 5BT5A 5JI8A 4IOQA 5HJCA 5C87A 2LSPB 5FB1A 2OUOA 4LYIA 5E3GA 1JSPB 1ZS5A 4BW2A 5KTWA 4UIYA 4O78A 4NR8A 4QR4A 4QSWA 4AKIA 3U5PA 2KTBB 4HBVA 4QR5A 4J0SA 4YYDA 5I7YA 3U5MA 5L97A 4F3IA 3VKGA 4YH4A 3DWYA 3D1BA 5F1LA 5FBXA 3S91A 4UIWA 5LVQA 5DFDA 4QSSA 4FLPA 1ZKRA 5EGUA 5E74A 5CQ8A 4YYNA 5AD2A 3MXFA 3HMFA 5DYCA 3HMEA 5FFVA 4YBTA 4IOOA 2R10A 4PCIA 2E7NA 5CPEA 5TCMA 5IGLA 5ACYA 4YYMA 5CS8A 4Z6IA 5H1TA 5A81A 4LRGA 4QZSA 5LJ0A 4RVRA 4O76A 5HEMA 4BJXA 2F6NA 4TZ8A 4O74A 3NXBA 1F68A 3AQAA 5CQ3A 4A9EA 4YBSA 4MR6A 5EA1A 4HBXA 5KO4A 4HXSA 4Z1SA 4MEPA 5ENBA 4UYFA 3O33A 5CQ6A 5I29A 5HFRA 4GPJA 4TT4A 5DKHA 5IG6A 4A9IA 5E9VA 2I8NA 4OUFA 4TQNA 5EWCA 5F3AA 3I3JA 5E9YA 5FFYA 3UW9A 5EVAA 3ONIA 5A5QA 2DWWA 4O7EA 3ERRA 4MR5A 4CL9A 5EPRA 5IGKA 5LVRA 4Z93A 3G0JA 5AMFA 4QYDA 5DYAA 3LQJA 1E6IA 4IR3A 5DFCA 4CLBA 4NUCA 4TT6A 4TT2A 4CUSA 4NR9A 5C8GA 3SVGA 3JVKA 5F63A 5FE0A 1N72A 1PUOA 4PTBA 4YBMA 5DLXA 3UVXA 4NRAA 4QSVA 5HQ6A 5H1UA 4QC3A 2YEKA 3MULA 5ETDA 5F62A 4O75A 4UYFB 2WP1A 4C67A 5L8UA 4ALHA 3Q2FA 5E9MA 2L5EA 3O36A 5DYUA 3P1DA 4A9LA 3P1FA 3P1CA 5CQ7A 3P5OA 4YYHA 4YYKA 5F36A 3JVLA 5G4RA 5FH6A 5L98A 2RNWA 5F1HA 4NR7A 4XY8A 4WHWA 5EK9A 5H1VA 4A9JA 4LR6A 2OO1A 5HRWA 5D3NA 4ZW1A 5EI4A 4YY6A 5E73A 5G4SA 3U5KA 5HFQA 4NQMA 3MUKA 5D24A 3SVFA 5CQ4A 5H85A 4IR4A 5KTXA 2NXBA 4QUTA 5CQAA 3ZYUA 2YW5A 3QZVA 5CFWA 4NRCA 4O7AA 4BHWA 5CQTA 5I86A 5EWWA 2DKWA 5HLSA 2GRCA 4UYDA 4YYGA 4UIZA 5F60A 3D1DA 4A9NA 5F61A 5DBMA 4HXKA 4KV1A 3UVWA 5ENHA 3D7CA 5BT4A 4OGJA 5I83A 3RCWA 5DKDA 5I89A 4N4HA 5CP5A 4QYLA 5HM0A 5CUGA 5HQ7A 5CQ5A 5DW1A 4CUTA 5KTUA 4YATA 2YQDA 2R0SA 1WUGA 5FG6A 4QEWA 2RNYA 5E9LA 2MJVB 4Z6HA 4NQNA 5EPSA 5L96A 4A9HA 5EWHA 3U5NA 2DVRA 4TU4A 5A5OA 4HXMA 3IU5A 2RNXA 5L8TA 4AKNA 5HRXA 4HXPA 2N9GA 2H60A 4MR4A 2OSSA 4WIVA 5CUAA 5DX4A 3JVMA 4QSXA 5EWVA 4N3WA 4PY6A 5ENJA 2DATA 4Q0OA 5FE7A 5C7NA 5II1A 5D3HA 4HXNA 5LUUA 4C66A 5D3TA 3LJWA 4O70A 5F25A 5FH7A 2RS9B 4KCXA 3AADA 4MENA 4O72A 4PCEA 4PKLA 4UIXA 5IBNA 5IGNA 4CFKA 5BT3A 4LYSA 5CRMA 5FE2A 4TU6A 5FE1A 4A9FA 5CRZA 4A9OA 5AMEA 4Z1QA 5D3PA 5I1QA 5CU8A 2L84A 4YC9A 4ZC9A 5LKUA 3O37A 4QB3A 4NR5A 5II2A 3S92A 4YABA 5ENCA 5HENA 2D9EA 2G4AA 5FE8A 4TS8A 5EWDA 4NXJA 5CUBA 4HXLA 5DYXA 5A85A 4QEUA 4LZ2A 5CUEA 3U5JA 4XYAA 3UV4A 3IU6A 5DY7A 4ZQLA 5FG4A 5E3DA 5DFBA 4QSRA 4UIUA 3LXJA 3QZSA 1JM4B 4J1PA 4UYHA 5ENEA 5EICA 4QR3A 5HRVA 2YEMA 4OGIA 4QSTA 1WUMA 5L99A 5LJ2A 5E7DA 4CUPA 5F5ZA 4HXRA 4BW4A 4E96A 5A5SA 4MEQA 4QBMA 5LKTA 5D25A 5CTLA 3U5LA 3LQIA 4HBYA 5E9KA 5CGPA 4QEVA 2RO1A 5A83A 5EV9A 5A5NA 5A5RA 5IIDA 5D3LA 3P1EA 2DVQA 5D0CA 2R0VA 5FE5A 2L85A 3HMHA 4NYVA 5D3JA 1EQFA 4J0RA 4TTEA 3UVDA 5FE4A 3GG3A 4QSUA 4QSQA 4MR3A 4NYWA 4AI6A 3SVHA 4DONA 5CZGA 2WP2A 5DKCA 4O7BA 5EQ1A 5FDZA 5A5PA 4A9MA 5TB6A 5E0RA 5D7XA 5J0DA 2I7KA 5I7XA 4NRBA 5D26A 5DW2A 5HQ5A 5HCLA 4NS5A 2F6JA 4O7CA 5ENGA 5A82A 4XY9A 3DAIA 5FE6A 4LDFA 3Q2EA 4LC2A 4QNSA 4IORA 3QZTA 4NUEA 2YDWA 4YK0A 2E7OA 5FH8A 4YYIA 4UIVA 2EJNA 3U5OA 4NYXA 5C85A 4PS5A 5A7CA 4QC1A 4AKHA 4YADA 4O77A 5EU1A 3UV2A 4IR5A 2RI7A 4Y03A 5FG5A 3MB3A 5I40A 5FE3A 4NR6A 4NUDA 4QUUA 4N4IA 4Q0NA 5CY9A 2YYNA 4AKGA 4N4FA 4YAXA 4TZ2A 5LKXA 5LJ1A 4BW1A 4CFLA 2YELA 4J3IA 4UYEA 5FB0A 3JVJA 4KV4A 5D3SA 4XUAA 5I80A 4CUQA 3G0LA 2FSAA 5F2PA 5EP7A 4O71A 4YYJA 5I88A 5C4QA 5HELA 5E9IA 2DVSA 3FKMX 4IR6A 5ETBA 5DLZA 4A9KA 5JWMA 5COIA 4UYGA 4LYWA 5LKZA 5K29A 4UITA 3O35A 4BW3A 4TYLA 3MQMA 5ENIA 5C89A 4HBWA 5AD3A 2RFJA 3UVYA 5CUCA 4XUBA 4X2IA 5KU3A 3MB4A 3TLPA 4YY4A 4CUUA 4NR4A
chains in the Genus database with same CATH topology
2R0YA 3UV5A 5EISA 4LZSA 5ENFA 4LZRA 3LQHA 4ALGA 4WHUA 4N4GA 5CUDA 4MEOA 4YH3A 5FE9A 1X0JA 5IGMA 4QSPA 4CURA 4HXOA 3K2JA 4QY4A 5KHMA 2D82A 4O7FA 5EM3A 5FFWA 2E3KA 5EPBA 5D3RA 3O34A 2DVVA 5BT5A 5JI8A 4IOQA 5HJCA 5C87A 2LSPB 5FB1A 2OUOA 4LYIA 5E3GA 1JSPB 1ZS5A 4BW2A 5KTWA 4UIYA 4O78A 4NR8A 4QR4A 4QSWA 3U5PA 2KTBB 4HBVA 4QR5A 4J0SA 4YYDA 5I7YA 3U5MA 5L97A 4F3IA 4YH4A 3DWYA 5F1LA 5FBXA 3S91A 4UIWA 5LVQA 5DFDA 4QSSA 4FLPA 5EGUA 5E74A 5CQ8A 4YYNA 5AD2A 3MXFA 3HMFA 5DYCA 3HMEA 5FFVA 4YBTA 4IOOA 2R10A 4PCIA 2E7NA 5CPEA 5TCMA 5IGLA 5ACYA 4YYMA 5CS8A 4Z6IA 5H1TA 5A81A 4LRGA 4QZSA 5LJ0A 4RVRA 4O76A 5HEMA 4BJXA 2F6NA 4TZ8A 4O74A 3NXBA 1F68A 3AQAA 5CQ3A 4A9EA 4YBSA 4MR6A 5EA1A 4HBXA 5KO4A 4HXSA 4Z1SA 4MEPA 5ENBA 4UYFA 3O33A 5CQ6A 5I29A 5HFRA 4GPJA 4TT4A 5DKHA 5IG6A 4A9IA 5E9VA 2I8NA 4OUFA 4TQNA 5EWCA 5F3AA 3I3JA 5E9YA 5FFYA 3UW9A 5EVAA 3ONIA 5A5QA 2DWWA 4O7EA 4MR5A 4CL9A 5EPRA 5IGKA 5LVRA 4Z93A 3G0JA 5AMFA 4QYDA 5DYAA 3LQJA 1E6IA 4IR3A 5DFCA 4CLBA 4NUCA 4TT6A 4TT2A 4CUSA 4NR9A 5C8GA 3SVGA 3JVKA 5F63A 5FE0A 1N72A 4PTBA 4YBMA 5DLXA 3UVXA 4NRAA 4QSVA 5HQ6A 5H1UA 4QC3A 2YEKA 3MULA 5ETDA 5F62A 4O75A 4UYFB 2WP1A 4C67A 5L8UA 4ALHA 3Q2FA 5E9MA 2L5EA 3O36A 5DYUA 3P1DA 4A9LA 3P1FA 3P1CA 5CQ7A 3P5OA 4YYHA 4YYKA 5F36A 3JVLA 5G4RA 5FH6A 5L98A 2RNWA 5F1HA 4NR7A 4XY8A 4WHWA 5EK9A 5H1VA 4A9JA 4LR6A 2OO1A 5HRWA 5D3NA 4ZW1A 5EI4A 4YY6A 5E73A 5G4SA 3U5KA 5HFQA 4NQMA 3MUKA 5D24A 3SVFA 5CQ4A 5H85A 4IR4A 5KTXA 2NXBA 4QUTA 5CQAA 3ZYUA 2YW5A 3QZVA 5CFWA 4NRCA 4O7AA 4BHWA 5CQTA 5I86A 5EWWA 2DKWA 5HLSA 2GRCA 4UYDA 4YYGA 4UIZA 5F60A 4A9NA 5F61A 5DBMA 4HXKA 4KV1A 3UVWA 5ENHA 3D7CA 5BT4A 4OGJA 5I83A 3RCWA 5DKDA 5I89A 4N4HA 5CP5A 4QYLA 5HM0A 5CUGA 5HQ7A 5CQ5A 5DW1A 4CUTA 5KTUA 4YATA 2YQDA 2R0SA 1WUGA 5FG6A 4QEWA 2RNYA 5E9LA 2MJVB 4Z6HA 4NQNA 5EPSA 5L96A 4A9HA 5EWHA 3U5NA 2DVRA 4TU4A 5A5OA 4HXMA 3IU5A 2RNXA 5L8TA 4AKNA 5HRXA 4HXPA 2N9GA 2H60A 4MR4A 2OSSA 4WIVA 5CUAA 5DX4A 3JVMA 4QSXA 5EWVA 4N3WA 4PY6A 5ENJA 2DATA 4Q0OA 5FE7A 5C7NA 5II1A 5D3HA 4HXNA 5LUUA 4C66A 5D3TA 3LJWA 4O70A 5F25A 5FH7A 2RS9B 4KCXA 3AADA 4MENA 4O72A 4PCEA 4PKLA 4UIXA 5IBNA 5IGNA 4CFKA 5BT3A 4LYSA 5CRMA 5FE2A 4TU6A 5FE1A 4A9FA 5CRZA 4A9OA 5AMEA 4Z1QA 5D3PA 5I1QA 5CU8A 2L84A 4YC9A 4ZC9A 5LKUA 3O37A 4QB3A 4NR5A 5II2A 3S92A 4YABA 5ENCA 5HENA 2D9EA 2G4AA 5FE8A 4TS8A 5EWDA 4NXJA 5CUBA 4HXLA 5DYXA 5A85A 4QEUA 4LZ2A 5CUEA 3U5JA 4XYAA 3UV4A 3IU6A 5DY7A 4ZQLA 5FG4A 5E3DA 5DFBA 4QSRA 4UIUA 3LXJA 3QZSA 1JM4B 4J1PA 4UYHA 5ENEA 5EICA 4QR3A 5HRVA 2YEMA 4OGIA 4QSTA 1WUMA 5L99A 5LJ2A 5E7DA 4CUPA 5F5ZA 4HXRA 4BW4A 4E96A 5A5SA 4MEQA 4QBMA 5LKTA 5D25A 5CTLA 3U5LA 3LQIA 4HBYA 5E9KA 5CGPA 4QEVA 2RO1A 5A83A 5EV9A 5A5NA 5A5RA 5IIDA 5D3LA 3P1EA 2DVQA 5D0CA 2R0VA 5FE5A 2L85A 3HMHA 4NYVA 5D3JA 1EQFA 4J0RA 4TTEA 3UVDA 5FE4A 3GG3A 4QSUA 4QSQA 4MR3A 4NYWA 3SVHA 4DONA 5CZGA 2WP2A 5DKCA 4O7BA 5EQ1A 5FDZA 5A5PA 4A9MA 5TB6A 5E0RA 5D7XA 5J0DA 2I7KA 5I7XA 4NRBA 5D26A 5DW2A 5HQ5A 5HCLA 4NS5A 2F6JA 4O7CA 5ENGA 5A82A 4XY9A 3DAIA 5FE6A 4LDFA 3Q2EA 4LC2A 4QNSA 4IORA 3QZTA 4NUEA 2YDWA 4YK0A 2E7OA 5FH8A 4YYIA 4UIVA 3U5OA 4NYXA 5C85A 4PS5A 5A7CA 4QC1A 4YADA 4O77A 5EU1A 3UV2A 4IR5A 2RI7A 4Y03A 5FG5A 3MB3A 5I40A 5FE3A 4NR6A 4NUDA 4QUUA 4N4IA 4Q0NA 5CY9A 2YYNA 4N4FA 4YAXA 4TZ2A 5LKXA 5LJ1A 4BW1A 4CFLA 2YELA 4J3IA 4UYEA 5FB0A 3JVJA 4KV4A 5D3SA 4XUAA 5I80A 4CUQA 3G0LA 2FSAA 5F2PA 5EP7A 4O71A 4YYJA 5I88A 5C4QA 5HELA 5E9IA 2DVSA 3FKMX 4IR6A 5ETBA 5DLZA 4A9KA 5JWMA 5COIA 4UYGA 4LYWA 5LKZA 5K29A 4UITA 3O35A 4BW3A 4TYLA 3MQMA 5ENIA 5C89A 4HBWA 5AD3A 2RFJA 3UVYA 5CUCA 4XUBA 4X2IA 5KU3A 3MB4A 3TLPA 4YY4A 4CUUA 4NR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R0Y A;  3UV5 A;  5EIS A;  4LZS A;  5ENF A;  4LZR A;  3LQH A;  4ALG A;  4WHU A;  4N4G A;  5CUD A;  4MEO A;  4YH3 A;  5FE9 A;  1X0J A;  5IGM A;  4QSP A;  4CUR A;  4HXO A;  3K2J A;  4QY4 A;  5KHM A;  2D82 A;  4O7F A;  5EM3 A;  5FFW A;  2E3K A;  5EPB A;  5D3R A;  3O34 A;  2DVV A;  5BT5 A;  5JI8 A;  4IOQ A;  5HJC A;  5C87 A;  2LSP B;  5FB1 A;  2OUO A;  4LYI A;  5E3G A;  1JSP B;  1ZS5 A;  4BW2 A;  5KTW A;  4UIY A;  4O78 A;  4NR8 A;  4QR4 A;  4QSW A;  3U5P A;  2KTB B;  4HBV A;  4QR5 A;  4J0S A;  4YYD A;  5I7Y A;  3U5M A;  5L97 A;  4F3I A;  4YH4 A;  3DWY A;  5F1L A;  5FBX A;  3S91 A;  4UIW A;  5LVQ A;  5DFD A;  4QSS A;  4FLP A;  5EGU A;  5E74 A;  5CQ8 A;  4YYN A;  5AD2 A;  3MXF A;  3HMF A;  5DYC A;  3HME A;  5FFV A;  4YBT A;  4IOO A;  2R10 A;  4PCI A;  2E7N A;  5CPE A;  5TCM A;  5IGL A;  5ACY A;  4YYM A;  5CS8 A;  4Z6I A;  5H1T A;  5A81 A;  4LRG A;  4QZS A;  5LJ0 A;  4RVR A;  4O76 A;  5HEM A;  4BJX A;  2F6N A;  4TZ8 A;  4O74 A;  3NXB A;  1F68 A;  3AQA A;  5CQ3 A;  4A9E A;  4YBS A;  4MR6 A;  5EA1 A;  4HBX A;  5KO4 A;  4HXS A;  4Z1S A;  4MEP A;  5ENB A;  4UYF A;  3O33 A;  5CQ6 A;  5I29 A;  5HFR A;  4GPJ A;  4TT4 A;  5DKH A;  5IG6 A;  4A9I A;  5E9V A;  2I8N A;  4OUF A;  4TQN A;  5EWC A;  5F3A A;  3I3J A;  5E9Y A;  5FFY A;  3UW9 A;  5EVA A;  3ONI A;  5A5Q A;  2DWW A;  4O7E A;  4MR5 A;  4CL9 A;  5EPR A;  5IGK A;  5LVR A;  4Z93 A;  3G0J A;  5AMF A;  4QYD A;  5DYA A;  3LQJ A;  1E6I A;  4IR3 A;  5DFC A;  4CLB A;  4NUC A;  4TT6 A;  4TT2 A;  4CUS A;  4NR9 A;  5C8G A;  3SVG A;  3JVK A;  5F63 A;  5FE0 A;  1N72 A;  4PTB A;  4YBM A;  5DLX A;  3UVX A;  4NRA A;  4QSV A;  5HQ6 A;  5H1U A;  4QC3 A;  2YEK A;  3MUL A;  5ETD A;  5F62 A;  4O75 A;  4UYF B;  2WP1 A;  4C67 A;  5L8U A;  4ALH A;  3Q2F A;  5E9M A;  2L5E A;  3O36 A;  5DYU A;  3P1D A;  4A9L A;  3P1F A;  3P1C A;  5CQ7 A;  3P5O A;  4YYH A;  4YYK A;  5F36 A;  3JVL A;  5G4R A;  5FH6 A;  5L98 A;  2RNW A;  5F1H A;  4NR7 A;  4XY8 A;  4WHW A;  5EK9 A;  5H1V A;  4A9J A;  4LR6 A;  2OO1 A;  5HRW A;  5D3N A;  4ZW1 A;  5EI4 A;  4YY6 A;  5E73 A;  5G4S A;  3U5K A;  5HFQ A;  4NQM A;  3MUK A;  5D24 A;  3SVF A;  5CQ4 A;  5H85 A;  4IR4 A;  5KTX A;  2NXB A;  4QUT A;  5CQA A;  3ZYU A;  2YW5 A;  3QZV A;  5CFW A;  4NRC A;  4O7A A;  4BHW A;  5CQT A;  5I86 A;  5EWW A;  2DKW A;  5HLS A;  2GRC A;  4UYD A;  4YYG A;  4UIZ A;  5F60 A;  4A9N A;  5F61 A;  5DBM A;  4HXK A;  4KV1 A;  3UVW A;  5ENH A;  3D7C A;  5BT4 A;  4OGJ A;  5I83 A;  3RCW A;  5DKD A;  5I89 A;  4N4H A;  5CP5 A;  4QYL A;  5HM0 A;  5CUG A;  5HQ7 A;  5CQ5 A;  5DW1 A;  4CUT A;  5KTU A;  4YAT A;  2YQD A;  2R0S A;  1WUG A;  5FG6 A;  4QEW A;  2RNY A;  5E9L A;  2MJV B;  4Z6H A;  4NQN A;  5EPS A;  5L96 A;  4A9H A;  5EWH A;  3U5N A;  2DVR A;  4TU4 A;  5A5O A;  4HXM A;  3IU5 A;  2RNX A;  5L8T A;  4AKN A;  5HRX A;  4HXP A;  2N9G A;  2H60 A;  4MR4 A;  2OSS A;  4WIV A;  5CUA A;  5DX4 A;  3JVM A;  4QSX A;  5EWV A;  4N3W A;  4PY6 A;  5ENJ A;  2DAT A;  4Q0O A;  5FE7 A;  5C7N A;  5II1 A;  5D3H A;  4HXN A;  5LUU A;  4C66 A;  5D3T A;  3LJW A;  4O70 A;  5F25 A;  5FH7 A;  2RS9 B;  4KCX A;  3AAD A;  4MEN A;  4O72 A;  4PCE A;  4PKL A;  4UIX A;  5IBN A;  5IGN A;  4CFK A;  5BT3 A;  4LYS A;  5CRM A;  5FE2 A;  4TU6 A;  5FE1 A;  4A9F A;  5CRZ A;  4A9O A;  5AME A;  4Z1Q A;  5D3P A;  5I1Q A;  5CU8 A;  2L84 A;  4YC9 A;  4ZC9 A;  5LKU A;  3O37 A;  4QB3 A;  4NR5 A;  5II2 A;  3S92 A;  4YAB A;  5ENC A;  5HEN A;  2D9E A;  2G4A A;  5FE8 A;  4TS8 A;  5EWD A;  4NXJ A;  5CUB A;  4HXL A;  5DYX A;  5A85 A;  4QEU A;  4LZ2 A;  5CUE A;  3U5J A;  4XYA A;  3UV4 A;  3IU6 A;  5DY7 A;  4ZQL A;  5FG4 A;  5E3D A;  5DFB A;  4QSR A;  4UIU A;  3LXJ A;  3QZS A;  1JM4 B;  4J1P A;  4UYH A;  5ENE A;  5EIC A;  4QR3 A;  5HRV A;  2YEM A;  4OGI A;  4QST A;  1WUM A;  5L99 A;  5LJ2 A;  5E7D A;  4CUP A;  5F5Z A;  4HXR A;  4BW4 A;  4E96 A;  5A5S A;  4MEQ A;  4QBM A;  5LKT A;  5D25 A;  5CTL A;  3U5L A;  3LQI A;  4HBY A;  5E9K A;  5CGP A;  4QEV A;  2RO1 A;  5A83 A;  5EV9 A;  5A5N A;  5A5R A;  5IID A;  5D3L A;  3P1E A;  2DVQ A;  5D0C A;  2R0V A;  5FE5 A;  2L85 A;  3HMH A;  4NYV A;  5D3J A;  1EQF A;  4J0R A;  4TTE A;  3UVD A;  5FE4 A;  3GG3 A;  4QSU A;  4QSQ A;  4MR3 A;  4NYW A;  3SVH A;  4DON A;  5CZG A;  2WP2 A;  5DKC A;  4O7B A;  5EQ1 A;  5FDZ A;  5A5P A;  4A9M A;  5TB6 A;  5E0R A;  5D7X A;  5J0D A;  2I7K A;  5I7X A;  4NRB A;  5D26 A;  5DW2 A;  5HQ5 A;  5HCL A;  4NS5 A;  2F6J A;  4O7C A;  5ENG A;  5A82 A;  4XY9 A;  3DAI A;  5FE6 A;  4LDF A;  3Q2E A;  4LC2 A;  4QNS A;  4IOR A;  3QZT A;  4NUE A;  2YDW A;  4YK0 A;  2E7O A;  5FH8 A;  4YYI A;  4UIV A;  3U5O A;  4NYX A;  5C85 A;  4PS5 A;  5A7C A;  4QC1 A;  4YAD A;  4O77 A;  5EU1 A;  3UV2 A;  4IR5 A;  2RI7 A;  4Y03 A;  5FG5 A;  3MB3 A;  5I40 A;  5FE3 A;  4NR6 A;  4NUD A;  4QUU A;  4N4I A;  4Q0N A;  5CY9 A;  2YYN A;  4N4F A;  4YAX A;  4TZ2 A;  5LKX A;  5LJ1 A;  4BW1 A;  4CFL A;  2YEL A;  4J3I A;  4UYE A;  5FB0 A;  3JVJ A;  4KV4 A;  5D3S A;  4XUA A;  5I80 A;  4CUQ A;  3G0L A;  2FSA A;  5F2P A;  5EP7 A;  4O71 A;  4YYJ A;  5I88 A;  5C4Q A;  5HEL A;  5E9I A;  2DVS A;  3FKM X;  4IR6 A;  5ETB A;  5DLZ A;  4A9K A;  5JWM A;  5COI A;  4UYG A;  4LYW A;  5LKZ A;  5K29 A;  4UIT A;  3O35 A;  4BW3 A;  4TYL A;  3MQM A;  5ENI A;  5C89 A;  4HBW A;  5AD3 A;  2RFJ A;  3UVY A;  5CUC A;  4XUB A;  4X2I A;  5KU3 A;  3MB4 A;  3TLP A;  4YY4 A;  4CUU A;  4NR4 A; 
#chains in the Genus database with same CATH topology
 2R0Y A;  3UV5 A;  5EIS A;  4LZS A;  5ENF A;  4LZR A;  3LQH A;  4ALG A;  4WHU A;  4N4G A;  5CUD A;  4MEO A;  4YH3 A;  5FE9 A;  1X0J A;  5IGM A;  4QSP A;  4CUR A;  4HXO A;  3K2J A;  4QY4 A;  5KHM A;  3VKH A;  2D82 A;  4O7F A;  5EM3 A;  5FFW A;  2E3K A;  5EPB A;  5D3R A;  3O34 A;  2DVV A;  5BT5 A;  5JI8 A;  4IOQ A;  5HJC A;  5C87 A;  2LSP B;  5FB1 A;  2OUO A;  4LYI A;  5E3G A;  1JSP B;  1ZS5 A;  4BW2 A;  5KTW A;  4UIY A;  4O78 A;  4NR8 A;  4QR4 A;  4QSW A;  4AKI A;  3U5P A;  2KTB B;  4HBV A;  4QR5 A;  4J0S A;  4YYD A;  5I7Y A;  3U5M A;  5L97 A;  4F3I A;  3VKG A;  4YH4 A;  3DWY A;  3D1B A;  5F1L A;  5FBX A;  3S91 A;  4UIW A;  5LVQ A;  5DFD A;  4QSS A;  4FLP A;  1ZKR A;  5EGU A;  5E74 A;  5CQ8 A;  4YYN A;  5AD2 A;  3MXF A;  3HMF A;  5DYC A;  3HME A;  5FFV A;  4YBT A;  4IOO A;  2R10 A;  4PCI A;  2E7N A;  5CPE A;  5TCM A;  5IGL A;  5ACY A;  4YYM A;  5CS8 A;  4Z6I A;  5H1T A;  5A81 A;  4LRG A;  4QZS A;  5LJ0 A;  4RVR A;  4O76 A;  5HEM A;  4BJX A;  2F6N A;  4TZ8 A;  4O74 A;  3NXB A;  1F68 A;  3AQA A;  5CQ3 A;  4A9E A;  4YBS A;  4MR6 A;  5EA1 A;  4HBX A;  5KO4 A;  4HXS A;  4Z1S A;  4MEP A;  5ENB A;  4UYF A;  3O33 A;  5CQ6 A;  5I29 A;  5HFR A;  4GPJ A;  4TT4 A;  5DKH A;  5IG6 A;  4A9I A;  5E9V A;  2I8N A;  4OUF A;  4TQN A;  5EWC A;  5F3A A;  3I3J A;  5E9Y A;  5FFY A;  3UW9 A;  5EVA A;  3ONI A;  5A5Q A;  2DWW A;  4O7E A;  3ERR A;  4MR5 A;  4CL9 A;  5EPR A;  5IGK A;  5LVR A;  4Z93 A;  3G0J A;  5AMF A;  4QYD A;  5DYA A;  3LQJ A;  1E6I A;  4IR3 A;  5DFC A;  4CLB A;  4NUC A;  4TT6 A;  4TT2 A;  4CUS A;  4NR9 A;  5C8G A;  3SVG A;  3JVK A;  5F63 A;  5FE0 A;  1N72 A;  1PUO A;  4PTB A;  4YBM A;  5DLX A;  3UVX A;  4NRA A;  4QSV A;  5HQ6 A;  5H1U A;  4QC3 A;  2YEK A;  3MUL A;  5ETD A;  5F62 A;  4O75 A;  4UYF B;  2WP1 A;  4C67 A;  5L8U A;  4ALH A;  3Q2F A;  5E9M A;  2L5E A;  3O36 A;  5DYU A;  3P1D A;  4A9L A;  3P1F A;  3P1C A;  5CQ7 A;  3P5O A;  4YYH A;  4YYK A;  5F36 A;  3JVL A;  5G4R A;  5FH6 A;  5L98 A;  2RNW A;  5F1H A;  4NR7 A;  4XY8 A;  4WHW A;  5EK9 A;  5H1V A;  4A9J A;  4LR6 A;  2OO1 A;  5HRW A;  5D3N A;  4ZW1 A;  5EI4 A;  4YY6 A;  5E73 A;  5G4S A;  3U5K A;  5HFQ A;  4NQM A;  3MUK A;  5D24 A;  3SVF A;  5CQ4 A;  5H85 A;  4IR4 A;  5KTX A;  2NXB A;  4QUT A;  5CQA A;  3ZYU A;  2YW5 A;  3QZV A;  5CFW A;  4NRC A;  4O7A A;  4BHW A;  5CQT A;  5I86 A;  5EWW A;  2DKW A;  5HLS A;  2GRC A;  4UYD A;  4YYG A;  4UIZ A;  5F60 A;  3D1D A;  4A9N A;  5F61 A;  5DBM A;  4HXK A;  4KV1 A;  3UVW A;  5ENH A;  3D7C A;  5BT4 A;  4OGJ A;  5I83 A;  3RCW A;  5DKD A;  5I89 A;  4N4H A;  5CP5 A;  4QYL A;  5HM0 A;  5CUG A;  5HQ7 A;  5CQ5 A;  5DW1 A;  4CUT A;  5KTU A;  4YAT A;  2YQD A;  2R0S A;  1WUG A;  5FG6 A;  4QEW A;  2RNY A;  5E9L A;  2MJV B;  4Z6H A;  4NQN A;  5EPS A;  5L96 A;  4A9H A;  5EWH A;  3U5N A;  2DVR A;  4TU4 A;  5A5O A;  4HXM A;  3IU5 A;  2RNX A;  5L8T A;  4AKN A;  5HRX A;  4HXP A;  2N9G A;  2H60 A;  4MR4 A;  2OSS A;  4WIV A;  5CUA A;  5DX4 A;  3JVM A;  4QSX A;  5EWV A;  4N3W A;  4PY6 A;  5ENJ A;  2DAT A;  4Q0O A;  5FE7 A;  5C7N A;  5II1 A;  5D3H A;  4HXN A;  5LUU A;  4C66 A;  5D3T A;  3LJW A;  4O70 A;  5F25 A;  5FH7 A;  2RS9 B;  4KCX A;  3AAD A;  4MEN A;  4O72 A;  4PCE A;  4PKL A;  4UIX A;  5IBN A;  5IGN A;  4CFK A;  5BT3 A;  4LYS A;  5CRM A;  5FE2 A;  4TU6 A;  5FE1 A;  4A9F A;  5CRZ A;  4A9O A;  5AME A;  4Z1Q A;  5D3P A;  5I1Q A;  5CU8 A;  2L84 A;  4YC9 A;  4ZC9 A;  5LKU A;  3O37 A;  4QB3 A;  4NR5 A;  5II2 A;  3S92 A;  4YAB A;  5ENC A;  5HEN A;  2D9E A;  2G4A A;  5FE8 A;  4TS8 A;  5EWD A;  4NXJ A;  5CUB A;  4HXL A;  5DYX A;  5A85 A;  4QEU A;  4LZ2 A;  5CUE A;  3U5J A;  4XYA A;  3UV4 A;  3IU6 A;  5DY7 A;  4ZQL A;  5FG4 A;  5E3D A;  5DFB A;  4QSR A;  4UIU A;  3LXJ A;  3QZS A;  1JM4 B;  4J1P A;  4UYH A;  5ENE A;  5EIC A;  4QR3 A;  5HRV A;  2YEM A;  4OGI A;  4QST A;  1WUM A;  5L99 A;  5LJ2 A;  5E7D A;  4CUP A;  5F5Z A;  4HXR A;  4BW4 A;  4E96 A;  5A5S A;  4MEQ A;  4QBM A;  5LKT A;  5D25 A;  5CTL A;  3U5L A;  3LQI A;  4HBY A;  5E9K A;  5CGP A;  4QEV A;  2RO1 A;  5A83 A;  5EV9 A;  5A5N A;  5A5R A;  5IID A;  5D3L A;  3P1E A;  2DVQ A;  5D0C A;  2R0V A;  5FE5 A;  2L85 A;  3HMH A;  4NYV A;  5D3J A;  1EQF A;  4J0R A;  4TTE A;  3UVD A;  5FE4 A;  3GG3 A;  4QSU A;  4QSQ A;  4MR3 A;  4NYW A;  4AI6 A;  3SVH A;  4DON A;  5CZG A;  2WP2 A;  5DKC A;  4O7B A;  5EQ1 A;  5FDZ A;  5A5P A;  4A9M A;  5TB6 A;  5E0R A;  5D7X A;  5J0D A;  2I7K A;  5I7X A;  4NRB A;  5D26 A;  5DW2 A;  5HQ5 A;  5HCL A;  4NS5 A;  2F6J A;  4O7C A;  5ENG A;  5A82 A;  4XY9 A;  3DAI A;  5FE6 A;  4LDF A;  3Q2E A;  4LC2 A;  4QNS A;  4IOR A;  3QZT A;  4NUE A;  2YDW A;  4YK0 A;  2E7O A;  5FH8 A;  4YYI A;  4UIV A;  2EJN A;  3U5O A;  4NYX A;  5C85 A;  4PS5 A;  5A7C A;  4QC1 A;  4AKH A;  4YAD A;  4O77 A;  5EU1 A;  3UV2 A;  4IR5 A;  2RI7 A;  4Y03 A;  5FG5 A;  3MB3 A;  5I40 A;  5FE3 A;  4NR6 A;  4NUD A;  4QUU A;  4N4I A;  4Q0N A;  5CY9 A;  2YYN A;  4AKG A;  4N4F A;  4YAX A;  4TZ2 A;  5LKX A;  5LJ1 A;  4BW1 A;  4CFL A;  2YEL A;  4J3I A;  4UYE A;  5FB0 A;  3JVJ A;  4KV4 A;  5D3S A;  4XUA A;  5I80 A;  4CUQ A;  3G0L A;  2FSA A;  5F2P A;  5EP7 A;  4O71 A;  4YYJ A;  5I88 A;  5C4Q A;  5HEL A;  5E9I A;  2DVS A;  3FKM X;  4IR6 A;  5ETB A;  5DLZ A;  4A9K A;  5JWM A;  5COI A;  4UYG A;  4LYW A;  5LKZ A;  5K29 A;  4UIT A;  3O35 A;  4BW3 A;  4TYL A;  3MQM A;  5ENI A;  5C89 A;  4HBW A;  5AD3 A;  2RFJ A;  3UVY A;  5CUC A;  4XUB A;  4X2I A;  5KU3 A;  3MB4 A;  3TLP A;  4YY4 A;  4CUU A;  4NR4 A; 
#chains in the Genus database with same CATH homology
 2R0Y A;  3UV5 A;  5EIS A;  4LZS A;  5ENF A;  4LZR A;  3LQH A;  4ALG A;  4WHU A;  4N4G A;  5CUD A;  4MEO A;  4YH3 A;  5FE9 A;  1X0J A;  5IGM A;  4QSP A;  4CUR A;  4HXO A;  3K2J A;  4QY4 A;  5KHM A;  2D82 A;  4O7F A;  5EM3 A;  5FFW A;  2E3K A;  5EPB A;  5D3R A;  3O34 A;  2DVV A;  5BT5 A;  5JI8 A;  4IOQ A;  5HJC A;  5C87 A;  2LSP B;  5FB1 A;  2OUO A;  4LYI A;  5E3G A;  1JSP B;  1ZS5 A;  4BW2 A;  5KTW A;  4UIY A;  4O78 A;  4NR8 A;  4QR4 A;  4QSW A;  3U5P A;  2KTB B;  4HBV A;  4QR5 A;  4J0S A;  4YYD A;  5I7Y A;  3U5M A;  5L97 A;  4F3I A;  4YH4 A;  3DWY A;  5F1L A;  5FBX A;  3S91 A;  4UIW A;  5LVQ A;  5DFD A;  4QSS A;  4FLP A;  5EGU A;  5E74 A;  5CQ8 A;  4YYN A;  5AD2 A;  3MXF A;  3HMF A;  5DYC A;  3HME A;  5FFV A;  4YBT A;  4IOO A;  2R10 A;  4PCI A;  2E7N A;  5CPE A;  5TCM A;  5IGL A;  5ACY A;  4YYM A;  5CS8 A;  4Z6I A;  5H1T A;  5A81 A;  4LRG A;  4QZS A;  5LJ0 A;  4RVR A;  4O76 A;  5HEM A;  4BJX A;  2F6N A;  4TZ8 A;  4O74 A;  3NXB A;  1F68 A;  3AQA A;  5CQ3 A;  4A9E A;  4YBS A;  4MR6 A;  5EA1 A;  4HBX A;  5KO4 A;  4HXS A;  4Z1S A;  4MEP A;  5ENB A;  4UYF A;  3O33 A;  5CQ6 A;  5I29 A;  5HFR A;  4GPJ A;  4TT4 A;  5DKH A;  5IG6 A;  4A9I A;  5E9V A;  2I8N A;  4OUF A;  4TQN A;  5EWC A;  5F3A A;  3I3J A;  5E9Y A;  5FFY A;  3UW9 A;  5EVA A;  3ONI A;  5A5Q A;  2DWW A;  4O7E A;  4MR5 A;  4CL9 A;  5EPR A;  5IGK A;  5LVR A;  4Z93 A;  3G0J A;  5AMF A;  4QYD A;  5DYA A;  3LQJ A;  1E6I A;  4IR3 A;  5DFC A;  4CLB A;  4NUC A;  4TT6 A;  4TT2 A;  4CUS A;  4NR9 A;  5C8G A;  3SVG A;  3JVK A;  5F63 A;  5FE0 A;  1N72 A;  4PTB A;  4YBM A;  5DLX A;  3UVX A;  4NRA A;  4QSV A;  5HQ6 A;  5H1U A;  4QC3 A;  2YEK A;  3MUL A;  5ETD A;  5F62 A;  4O75 A;  4UYF B;  2WP1 A;  4C67 A;  5L8U A;  4ALH A;  3Q2F A;  5E9M A;  2L5E A;  3O36 A;  5DYU A;  3P1D A;  4A9L A;  3P1F A;  3P1C A;  5CQ7 A;  3P5O A;  4YYH A;  4YYK A;  5F36 A;  3JVL A;  5G4R A;  5FH6 A;  5L98 A;  2RNW A;  5F1H A;  4NR7 A;  4XY8 A;  4WHW A;  5EK9 A;  5H1V A;  4A9J A;  4LR6 A;  2OO1 A;  5HRW A;  5D3N A;  4ZW1 A;  5EI4 A;  4YY6 A;  5E73 A;  5G4S A;  3U5K A;  5HFQ A;  4NQM A;  3MUK A;  5D24 A;  3SVF A;  5CQ4 A;  5H85 A;  4IR4 A;  5KTX A;  2NXB A;  4QUT A;  5CQA A;  3ZYU A;  2YW5 A;  3QZV A;  5CFW A;  4NRC A;  4O7A A;  4BHW A;  5CQT A;  5I86 A;  5EWW A;  2DKW A;  5HLS A;  2GRC A;  4UYD A;  4YYG A;  4UIZ A;  5F60 A;  4A9N A;  5F61 A;  5DBM A;  4HXK A;  4KV1 A;  3UVW A;  5ENH A;  3D7C A;  5BT4 A;  4OGJ A;  5I83 A;  3RCW A;  5DKD A;  5I89 A;  4N4H A;  5CP5 A;  4QYL A;  5HM0 A;  5CUG A;  5HQ7 A;  5CQ5 A;  5DW1 A;  4CUT A;  5KTU A;  4YAT A;  2YQD A;  2R0S A;  1WUG A;  5FG6 A;  4QEW A;  2RNY A;  5E9L A;  2MJV B;  4Z6H A;  4NQN A;  5EPS A;  5L96 A;  4A9H A;  5EWH A;  3U5N A;  2DVR A;  4TU4 A;  5A5O A;  4HXM A;  3IU5 A;  2RNX A;  5L8T A;  4AKN A;  5HRX A;  4HXP A;  2N9G A;  2H60 A;  4MR4 A;  2OSS A;  4WIV A;  5CUA A;  5DX4 A;  3JVM A;  4QSX A;  5EWV A;  4N3W A;  4PY6 A;  5ENJ A;  2DAT A;  4Q0O A;  5FE7 A;  5C7N A;  5II1 A;  5D3H A;  4HXN A;  5LUU A;  4C66 A;  5D3T A;  3LJW A;  4O70 A;  5F25 A;  5FH7 A;  2RS9 B;  4KCX A;  3AAD A;  4MEN A;  4O72 A;  4PCE A;  4PKL A;  4UIX A;  5IBN A;  5IGN A;  4CFK A;  5BT3 A;  4LYS A;  5CRM A;  5FE2 A;  4TU6 A;  5FE1 A;  4A9F A;  5CRZ A;  4A9O A;  5AME A;  4Z1Q A;  5D3P A;  5I1Q A;  5CU8 A;  2L84 A;  4YC9 A;  4ZC9 A;  5LKU A;  3O37 A;  4QB3 A;  4NR5 A;  5II2 A;  3S92 A;  4YAB A;  5ENC A;  5HEN A;  2D9E A;  2G4A A;  5FE8 A;  4TS8 A;  5EWD A;  4NXJ A;  5CUB A;  4HXL A;  5DYX A;  5A85 A;  4QEU A;  4LZ2 A;  5CUE A;  3U5J A;  4XYA A;  3UV4 A;  3IU6 A;  5DY7 A;  4ZQL A;  5FG4 A;  5E3D A;  5DFB A;  4QSR A;  4UIU A;  3LXJ A;  3QZS A;  1JM4 B;  4J1P A;  4UYH A;  5ENE A;  5EIC A;  4QR3 A;  5HRV A;  2YEM A;  4OGI A;  4QST A;  1WUM A;  5L99 A;  5LJ2 A;  5E7D A;  4CUP A;  5F5Z A;  4HXR A;  4BW4 A;  4E96 A;  5A5S A;  4MEQ A;  4QBM A;  5LKT A;  5D25 A;  5CTL A;  3U5L A;  3LQI A;  4HBY A;  5E9K A;  5CGP A;  4QEV A;  2RO1 A;  5A83 A;  5EV9 A;  5A5N A;  5A5R A;  5IID A;  5D3L A;  3P1E A;  2DVQ A;  5D0C A;  2R0V A;  5FE5 A;  2L85 A;  3HMH A;  4NYV A;  5D3J A;  1EQF A;  4J0R A;  4TTE A;  3UVD A;  5FE4 A;  3GG3 A;  4QSU A;  4QSQ A;  4MR3 A;  4NYW A;  3SVH A;  4DON A;  5CZG A;  2WP2 A;  5DKC A;  4O7B A;  5EQ1 A;  5FDZ A;  5A5P A;  4A9M A;  5TB6 A;  5E0R A;  5D7X A;  5J0D A;  2I7K A;  5I7X A;  4NRB A;  5D26 A;  5DW2 A;  5HQ5 A;  5HCL A;  4NS5 A;  2F6J A;  4O7C A;  5ENG A;  5A82 A;  4XY9 A;  3DAI A;  5FE6 A;  4LDF A;  3Q2E A;  4LC2 A;  4QNS A;  4IOR A;  3QZT A;  4NUE A;  2YDW A;  4YK0 A;  2E7O A;  5FH8 A;  4YYI A;  4UIV A;  3U5O A;  4NYX A;  5C85 A;  4PS5 A;  5A7C A;  4QC1 A;  4YAD A;  4O77 A;  5EU1 A;  3UV2 A;  4IR5 A;  2RI7 A;  4Y03 A;  5FG5 A;  3MB3 A;  5I40 A;  5FE3 A;  4NR6 A;  4NUD A;  4QUU A;  4N4I A;  4Q0N A;  5CY9 A;  2YYN A;  4N4F A;  4YAX A;  4TZ2 A;  5LKX A;  5LJ1 A;  4BW1 A;  4CFL A;  2YEL A;  4J3I A;  4UYE A;  5FB0 A;  3JVJ A;  4KV4 A;  5D3S A;  4XUA A;  5I80 A;  4CUQ A;  3G0L A;  2FSA A;  5F2P A;  5EP7 A;  4O71 A;  4YYJ A;  5I88 A;  5C4Q A;  5HEL A;  5E9I A;  2DVS A;  3FKM X;  4IR6 A;  5ETB A;  5DLZ A;  4A9K A;  5JWM A;  5COI A;  4UYG A;  4LYW A;  5LKZ A;  5K29 A;  4UIT A;  3O35 A;  4BW3 A;  4TYL A;  3MQM A;  5ENI A;  5C89 A;  4HBW A;  5AD3 A;  2RFJ A;  3UVY A;  5CUC A;  4XUB A;  4X2I A;  5KU3 A;  3MB4 A;  3TLP A;  4YY4 A;  4CUU A;  4NR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...