2R10A

Structure of an acetylated rsc4 tandem bromodomain histone chimera
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
292
Chain Sequence
RPKYLPGHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin structure-remodeling complex protein RSC4, LINKER,
publication title Autoregulation of the rsc4 tandem bromodomain by gcn5 acetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 102
structure length 292
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r10A01
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r10A02
5CQTA 4BHWA 5L98A 5E9KA 3IU6A 3DWYA 4KV1A 5A82A 5HCLA 5F60A 2R0YA 2D9EA 5L8TA 4F3IA 4MR6A 5CUDA 5CGPA 5EPRA 4PCEA 5HFRA 4YK0A 4HXRA 3TLPA 4N4FA 4MR4A 5C7NA 4A9MA 3QZSA 5KTUA 3P1FA 5AD2A 5E9IA 4QUTA 5EICA 4O7EA 4QSRA 5EISA 4QSWA 4A9EA 5FE6A 5D3JA 5EWWA 5CTLA 4J0SA 5DYAA 3IU5A 2OUOA 5I40A 5ETBA 4KV4A 3D7CA 5D3LA 5ENFA 4N4GA 5FE4A 5FH8A 5F61A 4YYKA 2F6JA 2E7OA 4NR7A 4MEQA 4YC9A 5A5OA 5L8UA 4TS8A 4YY4A 4XY9A 4WHUA 4FLPA 4LZRA 4A9IA 4O7CA 5LJ0A 5E9YA 4MR5A 4O77A 5EV9A 2G4AA 4MEPA 5DYXA 5EPSA 2E3KA 5I89A 5HM0A 4HBWA 5CQ3A 3P5OA 5A5NA 5EWHA 4CL9A 4XYAA 5HQ6A 5DYUA 2RO1A 3UVWA 3HMEA 4BW4A 2YEKA 4IOOA 5ACYA 4HBVA 2DWWA 3RCWA 3HMHA 4NR4A 4Y03A 4CUPA 4YYGA 4YBTA 5ENBA 5FE1A 3MB4A 2FSAA 5DLXA 4Z6HA 4A9HA 1WUGA 4CLBA 5E9VA 2YYNA 4YAXA 5C8GA 5EWCA 1WUMA 5A5PA 4NR6A 5C87A 4IORA 5E9LA 5EM3A 4N4IA 4A9LA 4ALHA 1ZS5A 2DVRA 4QUUA 4HBXA 5I88A 4PCIA 5ENIA 4QSQA 4QSSA 3SVHA 3LXJA 5DFCA 5FE7A 5FE9A 5F1HA 4O72A 4UIZA 4O7AA 5BT5A 4QSVA 3MXFA 5CUBA 5H1UA 3P1EA 2LSPB 3ONIA 4BW3A 4YH4A 3P1DA 4XUAA 4ZC9A 5E73A 2YW5A 5TB6A 5I7XA 4LZSA 5KO4A 2OO1A 5LJ2A 5L99A 5CQ6A 5FG5A 5D3PA 5CUCA 2L5EA 5COIA 4YYIA 4ALGA 4TT4A 4YYHA 5A5RA 2RI7A 5KTWA 5BT3A 2I7KA 4YATA 3JVMA 4LZ2A 4NYWA 4PS5A 5I29A 5LVQA 5D3RA 5ETDA 5CRZA 5KU3A 4HXSA 2F6NA 3UV2A 4NUDA 4NUEA 4TU4A 5CUGA 5LKUA 5FDZA 4TYLA 5CU8A 4TZ2A 2D82A 4Z93A 4QSXA 5D25A 3UV4A 2RNYA 2R0SA 4QSPA 5DFBA 4BW1A 2RNWA 5ENHA 5DBMA 5HEMA 5DW1A 1JSPB 3DAIA 5EWVA 4LYSA 3U5OA 5FFYA 5DY7A 4QYLA 2R10A 2RNXA 2L84A 5EA1A 5LUUA 5LKZA 4A9OA 5FE2A 5FG4A 4UIYA 4HXMA 5F36A 2DATA 4CUQA 2OSSA 4O7BA 2N9GA 5F62A 4HXPA 5JWMA 5CQ8A 2RS9B 4TT2A 5G4SA 2I8NA 5EGUA 3HMFA 5H1VA 4BW2A 4J3IA 5I86A 5FG6A 4RVRA 4CFKA 5E0RA 4YH3A 4Q0OA 4QEVA 5F1LA 4A9JA 4NRCA 3ZYUA 4X2IA 4O75A 4QR3A 4O74A 4CUTA 4YADA 5FFVA 4BJXA 4NRAA 4HBYA 4QEUA 4Q0NA 3O36A 4QSUA 5E3GA 5CQAA 3QZTA 4PKLA 4QY4A 4CURA 5A5QA 4NR9A 5G4RA 3K2JA 4YYNA 4HXOA 5D26A 5FE3A 5F5ZA 5HRVA 4NS5A 4IR6A 5CRMA 5IBNA 4IR4A 4TU6A 3UVYA 3MB3A 5FB1A 4ZQLA 3UV5A 4WHWA 5DKCA 4J1PA 5CUEA 3UVXA 3SVFA 4YYDA 5D3TA 5L97A 4MEOA 3MUKA 3O35A 2R0VA 4O78A 5E9MA 5IGNA 3JVKA 4IR5A 5IIDA 4DONA 4E96A 5D3HA 4NQNA 4GPJA 4NRBA 3U5PA 3U5KA 3S92A 4TTEA 4UYHA 3S91A 3AADA 4A9FA 5FE8A 4NUCA 3MQMA 4Z1SA 5HQ5A 4QR4A 2E7NA 5A85A 4QC1A 5IGMA 4XUBA 4ZW1A 3G0LA 2MJVB 5DW2A 3UW9A 3O33A 2YELA 4HXKA 5E74A 3JVLA 4YYMA 5BT4A 4CUSA 4UIWA 3LQJA 3Q2EA 4UYFA 5AD3A 4NYXA 5CZGA 4QC3A 4HXLA 5D3SA 4IOQA 5D7XA 5DFDA 3U5LA 5C4QA 4WIVA 5F25A 4C66A 5CQ5A 4LYIA 5CQ4A 4PTBA 5F2PA 5KTXA 3G0JA 5D3NA 5DYCA 5H85A 5A83A 4QSTA 4AKNA 5HRXA 3U5JA 3U5NA 5FBXA 5EWDA 4CUUA 4LRGA 4IR3A 5A7CA 2WP2A 3AQAA 5AMEA 5FB0A 5D0CA 5J0DA 4HXNA 4MENA 5IGLA 4N4HA 4QBMA 5CUAA 5CPEA 2NXBA 4QB3A 4OUFA 4A9KA 5IGKA 3LQIA 5EQ1A 1E6IA 5DKDA 5I1QA 4UYDA 5ENEA 4XY8A 5II2A 4UIXA 2L85A 5A5SA 3O37A 2WP1A 5KHMA 3O34A 4NQMA 5EK9A 5FE5A 2DVVA 5HENA 1F68A 4A9NA 4YYJA 5LKXA 4QNSA 4QEWA 4O70A 4UYFB 2DVSA 3LJWA 5LVRA 5A81A 5HELA 4NR8A 5DX4A 2DVQA 2YEMA 3JVJA 4N3WA 5F63A 5F3AA 5DKHA 2KTBB 5FH6A 4QYDA 5CQ7A 2DKWA 3SVGA 5HLSA 4J0RA 4YBSA 4O76A 4CFLA 5L96A 5C85A 3U5MA 5HJCA 5ENGA 5CY9A 5CS8A 4LDFA 5IG6A 5CFWA 5HRWA 4O7FA 5I83A 5LJ1A 5K29A 4Z6IA 5ENCA 4KCXA 3LQHA 2GRCA 3UVDA 3Q2FA 3NXBA 3I3JA 2YQDA 5E3DA 5EVAA 5FH7A 1EQFA 4MR3A 1JM4B 4PY6A 5I7YA 4UITA 5EP7A 4QR5A 5AMFA 4LC2A 5TCMA 5HFQA 4YBMA 4QZSA 3P1CA 5JI8A 5HQ7A 4UYEA 5FE0A 5I80A 4OGIA 4UIVA 5LKTA 4TT6A 5EI4A 4LYWA 4TZ8A 5DLZA 4YY6A 4LR6A 4NYVA 4TQNA 3FKMX 3QZVA 4Z1QA 5CP5A 4NR5A 5E7DA 3GG3A 4O71A 5D24A 5EPBA 4C67A 5FFWA 1X0JA 4UIUA 5C89A 2H60A 4YABA 4OGJA 2YDWA 5ENJA 2RFJA 1N72A 5II1A 4UYGA 5H1TA 3MULA 4NXJA 5EU1A
chains in the Genus database with same CATH superfamily
5CQTA 4BHWA 5L98A 5E9KA 3IU6A 3DWYA 4KV1A 5A82A 5HCLA 5F60A 2R0YA 2D9EA 5L8TA 4F3IA 4MR6A 5CUDA 5CGPA 5EPRA 4PCEA 5HFRA 4YK0A 4HXRA 3TLPA 4N4FA 1ZKRA 4MR4A 5C7NA 4A9MA 3QZSA 5KTUA 3P1FA 5AD2A 5E9IA 4QUTA 5EICA 4O7EA 4QSRA 5EISA 4QSWA 4A9EA 5FE6A 5D3JA 5EWWA 5CTLA 4J0SA 5DYAA 3IU5A 2OUOA 5I40A 5ETBA 4KV4A 3D7CA 5D3LA 5ENFA 4N4GA 5FE4A 5FH8A 5F61A 4YYKA 2F6JA 2E7OA 4NR7A 4MEQA 4YC9A 5A5OA 5L8UA 4TS8A 4YY4A 4XY9A 4WHUA 4FLPA 4LZRA 4A9IA 4O7CA 5LJ0A 5E9YA 4MR5A 4O77A 5EV9A 2G4AA 4MEPA 5DYXA 5EPSA 2E3KA 5I89A 5HM0A 4HBWA 5CQ3A 3P5OA 5A5NA 5EWHA 4CL9A 4XYAA 5HQ6A 5DYUA 2RO1A 3UVWA 3HMEA 4BW4A 2YEKA 4IOOA 5ACYA 4HBVA 2DWWA 3RCWA 3HMHA 4NR4A 4Y03A 4CUPA 4YYGA 4YBTA 5ENBA 5FE1A 3MB4A 2FSAA 5DLXA 4Z6HA 4A9HA 1WUGA 4CLBA 5E9VA 2YYNA 4YAXA 5C8GA 5EWCA 1WUMA 5A5PA 4NR6A 5C87A 4IORA 5E9LA 5EM3A 4N4IA 4A9LA 4ALHA 1ZS5A 2DVRA 4QUUA 4HBXA 5I88A 4PCIA 5ENIA 4QSQA 4QSSA 3SVHA 3LXJA 5DFCA 5FE7A 5FE9A 5F1HA 4O72A 4UIZA 4O7AA 5BT5A 4QSVA 2EJNA 3MXFA 5CUBA 5H1UA 3P1EA 2LSPB 3ONIA 4BW3A 4YH4A 3VKHA 3P1DA 4XUAA 4ZC9A 5E73A 2YW5A 5TB6A 5I7XA 4LZSA 5KO4A 2OO1A 5LJ2A 5L99A 5CQ6A 5FG5A 5D3PA 5CUCA 2L5EA 5COIA 4YYIA 4ALGA 4TT4A 4YYHA 5A5RA 2RI7A 5KTWA 5BT3A 2I7KA 4YATA 3JVMA 4LZ2A 4NYWA 4PS5A 5I29A 5LVQA 5D3RA 5ETDA 5CRZA 5KU3A 4AI6A 4HXSA 2F6NA 3UV2A 4NUDA 4NUEA 4TU4A 5CUGA 5LKUA 5FDZA 4TYLA 5CU8A 4TZ2A 2D82A 4Z93A 4QSXA 5D25A 3UV4A 2RNYA 2R0SA 4QSPA 5DFBA 4BW1A 2RNWA 5ENHA 5DBMA 5HEMA 3D1BA 5DW1A 1JSPB 3DAIA 5EWVA 4LYSA 3U5OA 5FFYA 5DY7A 4QYLA 2R10A 2RNXA 2L84A 5EA1A 5LUUA 5LKZA 4A9OA 5FE2A 5FG4A 4UIYA 4HXMA 5F36A 2DATA 4CUQA 2OSSA 4O7BA 2N9GA 5F62A 4HXPA 5JWMA 5CQ8A 2RS9B 4TT2A 5G4SA 2I8NA 5EGUA 3HMFA 5H1VA 4BW2A 4J3IA 5I86A 5FG6A 4RVRA 4CFKA 5E0RA 4YH3A 4Q0OA 4QEVA 5F1LA 4A9JA 4NRCA 3ZYUA 4X2IA 4O75A 4QR3A 4O74A 4CUTA 4YADA 5FFVA 4AKGA 4BJXA 4NRAA 4HBYA 4QEUA 4Q0NA 3O36A 4QSUA 5E3GA 1PUOA 5CQAA 3QZTA 4PKLA 4QY4A 4CURA 5A5QA 4NR9A 5G4RA 3K2JA 4YYNA 4HXOA 5D26A 5FE3A 5F5ZA 5HRVA 4NS5A 4IR6A 5CRMA 5IBNA 4IR4A 4TU6A 3UVYA 3MB3A 5FB1A 4ZQLA 3UV5A 4WHWA 5DKCA 4J1PA 5CUEA 3UVXA 3SVFA 4YYDA 5D3TA 5L97A 4MEOA 3MUKA 3O35A 2R0VA 4O78A 5E9MA 5IGNA 3JVKA 4IR5A 5IIDA 4DONA 4E96A 5D3HA 4NQNA 4GPJA 4NRBA 3U5PA 3U5KA 3S92A 4TTEA 4UYHA 3S91A 3AADA 4A9FA 5FE8A 4NUCA 3MQMA 4Z1SA 5HQ5A 4QR4A 2E7NA 5A85A 4QC1A 5IGMA 4XUBA 4ZW1A 3G0LA 2MJVB 5DW2A 3UW9A 3O33A 2YELA 4HXKA 5E74A 3JVLA 4YYMA 5BT4A 4CUSA 4UIWA 4AKIA 3LQJA 3Q2EA 4UYFA 5AD3A 4NYXA 5CZGA 4QC3A 4HXLA 5D3SA 4IOQA 5D7XA 5DFDA 3U5LA 5C4QA 4WIVA 5F25A 4C66A 5CQ5A 4LYIA 5CQ4A 4PTBA 5F2PA 5KTXA 3G0JA 5D3NA 5DYCA 5H85A 5A83A 4QSTA 4AKNA 5HRXA 3U5JA 3U5NA 5FBXA 5EWDA 4CUUA 4LRGA 4IR3A 5A7CA 3D1DA 2WP2A 3AQAA 5AMEA 5FB0A 5D0CA 5J0DA 4HXNA 4MENA 5IGLA 4N4HA 4QBMA 5CUAA 5CPEA 2NXBA 4QB3A 4OUFA 4A9KA 5IGKA 3LQIA 5EQ1A 1E6IA 5DKDA 5I1QA 4UYDA 5ENEA 4XY8A 5II2A 4UIXA 2L85A 5A5SA 3O37A 2WP1A 5KHMA 3O34A 4NQMA 5EK9A 5FE5A 2DVVA 5HENA 1F68A 4A9NA 4YYJA 5LKXA 4QNSA 4QEWA 4O70A 4UYFB 2DVSA 3LJWA 3VKGA 5LVRA 5A81A 5HELA 4NR8A 5DX4A 2DVQA 2YEMA 3JVJA 4N3WA 5F63A 5F3AA 5DKHA 2KTBB 5FH6A 4QYDA 5CQ7A 2DKWA 3SVGA 5HLSA 4J0RA 4YBSA 4O76A 4CFLA 5L96A 5C85A 3U5MA 5HJCA 5ENGA 5CY9A 5CS8A 4LDFA 5IG6A 5CFWA 5HRWA 4O7FA 5I83A 5LJ1A 5K29A 4Z6IA 5ENCA 4KCXA 3LQHA 2GRCA 3UVDA 3Q2FA 3NXBA 3I3JA 2YQDA 5E3DA 5EVAA 5FH7A 1EQFA 4MR3A 1JM4B 4PY6A 5I7YA 4UITA 5EP7A 4QR5A 5AMFA 4LC2A 5TCMA 5HFQA 4YBMA 4QZSA 3P1CA 5JI8A 5HQ7A 4UYEA 5FE0A 5I80A 4OGIA 4UIVA 5LKTA 4TT6A 5EI4A 4LYWA 4TZ8A 5DLZA 4YY6A 4LR6A 4NYVA 4TQNA 3FKMX 3QZVA 4Z1QA 5CP5A 4NR5A 5E7DA 3GG3A 4O71A 5D24A 5EPBA 4C67A 5FFWA 1X0JA 4UIUA 5C89A 2H60A 4YABA 4OGJA 2YDWA 5ENJA 2RFJA 1N72A 5II1A 3ERRA 4UYGA 5H1TA 3MULA 4NXJA 5EU1A 4AKHA
chains in the Genus database with same CATH topology
5CQTA 4BHWA 5L98A 5E9KA 3IU6A 3DWYA 4KV1A 5A82A 5HCLA 5F60A 2R0YA 2D9EA 5L8TA 4F3IA 4MR6A 5CUDA 5CGPA 5EPRA 4PCEA 5HFRA 4YK0A 4HXRA 3TLPA 4N4FA 4MR4A 5C7NA 4A9MA 3QZSA 5KTUA 3P1FA 5AD2A 5E9IA 4QUTA 5EICA 4O7EA 4QSRA 5EISA 4QSWA 4A9EA 5FE6A 5D3JA 5EWWA 5CTLA 4J0SA 5DYAA 3IU5A 2OUOA 5I40A 5ETBA 4KV4A 3D7CA 5D3LA 5ENFA 4N4GA 5FE4A 5FH8A 5F61A 4YYKA 2F6JA 2E7OA 4NR7A 4MEQA 4YC9A 5A5OA 5L8UA 4TS8A 4YY4A 4XY9A 4WHUA 4FLPA 4LZRA 4A9IA 4O7CA 5LJ0A 5E9YA 4MR5A 4O77A 5EV9A 2G4AA 4MEPA 5DYXA 5EPSA 2E3KA 5I89A 5HM0A 4HBWA 5CQ3A 3P5OA 5A5NA 5EWHA 4CL9A 4XYAA 5HQ6A 5DYUA 2RO1A 3UVWA 3HMEA 4BW4A 2YEKA 4IOOA 5ACYA 4HBVA 2DWWA 3RCWA 3HMHA 4NR4A 4Y03A 4CUPA 4YYGA 4YBTA 5ENBA 5FE1A 3MB4A 2FSAA 5DLXA 4Z6HA 4A9HA 1WUGA 4CLBA 5E9VA 2YYNA 4YAXA 5C8GA 5EWCA 1WUMA 5A5PA 4NR6A 5C87A 4IORA 5E9LA 5EM3A 4N4IA 4A9LA 4ALHA 1ZS5A 2DVRA 4QUUA 4HBXA 5I88A 4PCIA 5ENIA 4QSQA 4QSSA 3SVHA 3LXJA 5DFCA 5FE7A 5FE9A 5F1HA 4O72A 4UIZA 4O7AA 5BT5A 4QSVA 3MXFA 5CUBA 5H1UA 3P1EA 2LSPB 3ONIA 4BW3A 4YH4A 3P1DA 4XUAA 4ZC9A 5E73A 2YW5A 5TB6A 5I7XA 4LZSA 5KO4A 2OO1A 5LJ2A 5L99A 5CQ6A 5FG5A 5D3PA 5CUCA 2L5EA 5COIA 4YYIA 4ALGA 4TT4A 4YYHA 5A5RA 2RI7A 5KTWA 5BT3A 2I7KA 4YATA 3JVMA 4LZ2A 4NYWA 4PS5A 5I29A 5LVQA 5D3RA 5ETDA 5CRZA 5KU3A 4HXSA 2F6NA 3UV2A 4NUDA 4NUEA 4TU4A 5CUGA 5LKUA 5FDZA 4TYLA 5CU8A 4TZ2A 2D82A 4Z93A 4QSXA 5D25A 3UV4A 2RNYA 2R0SA 4QSPA 5DFBA 4BW1A 2RNWA 5ENHA 5DBMA 5HEMA 5DW1A 1JSPB 3DAIA 5EWVA 4LYSA 3U5OA 5FFYA 5DY7A 4QYLA 2R10A 2RNXA 2L84A 5EA1A 5LUUA 5LKZA 4A9OA 5FE2A 5FG4A 4UIYA 4HXMA 5F36A 2DATA 4CUQA 2OSSA 4O7BA 2N9GA 5F62A 4HXPA 5JWMA 5CQ8A 2RS9B 4TT2A 5G4SA 2I8NA 5EGUA 3HMFA 5H1VA 4BW2A 4J3IA 5I86A 5FG6A 4RVRA 4CFKA 5E0RA 4YH3A 4Q0OA 4QEVA 5F1LA 4A9JA 4NRCA 3ZYUA 4X2IA 4O75A 4QR3A 4O74A 4CUTA 4YADA 5FFVA 4BJXA 4NRAA 4HBYA 4QEUA 4Q0NA 3O36A 4QSUA 5E3GA 5CQAA 3QZTA 4PKLA 4QY4A 4CURA 5A5QA 4NR9A 5G4RA 3K2JA 4YYNA 4HXOA 5D26A 5FE3A 5F5ZA 5HRVA 4NS5A 4IR6A 5CRMA 5IBNA 4IR4A 4TU6A 3UVYA 3MB3A 5FB1A 4ZQLA 3UV5A 4WHWA 5DKCA 4J1PA 5CUEA 3UVXA 3SVFA 4YYDA 5D3TA 5L97A 4MEOA 3MUKA 3O35A 2R0VA 4O78A 5E9MA 5IGNA 3JVKA 4IR5A 5IIDA 4DONA 4E96A 5D3HA 4NQNA 4GPJA 4NRBA 3U5PA 3U5KA 3S92A 4TTEA 4UYHA 3S91A 3AADA 4A9FA 5FE8A 4NUCA 3MQMA 4Z1SA 5HQ5A 4QR4A 2E7NA 5A85A 4QC1A 5IGMA 4XUBA 4ZW1A 3G0LA 2MJVB 5DW2A 3UW9A 3O33A 2YELA 4HXKA 5E74A 3JVLA 4YYMA 5BT4A 4CUSA 4UIWA 3LQJA 3Q2EA 4UYFA 5AD3A 4NYXA 5CZGA 4QC3A 4HXLA 5D3SA 4IOQA 5D7XA 5DFDA 3U5LA 5C4QA 4WIVA 5F25A 4C66A 5CQ5A 4LYIA 5CQ4A 4PTBA 5F2PA 5KTXA 3G0JA 5D3NA 5DYCA 5H85A 5A83A 4QSTA 4AKNA 5HRXA 3U5JA 3U5NA 5FBXA 5EWDA 4CUUA 4LRGA 4IR3A 5A7CA 2WP2A 3AQAA 5AMEA 5FB0A 5D0CA 5J0DA 4HXNA 4MENA 5IGLA 4N4HA 4QBMA 5CUAA 5CPEA 2NXBA 4QB3A 4OUFA 4A9KA 5IGKA 3LQIA 5EQ1A 1E6IA 5DKDA 5I1QA 4UYDA 5ENEA 4XY8A 5II2A 4UIXA 2L85A 5A5SA 3O37A 2WP1A 5KHMA 3O34A 4NQMA 5EK9A 5FE5A 2DVVA 5HENA 1F68A 4A9NA 4YYJA 5LKXA 4QNSA 4QEWA 4O70A 4UYFB 2DVSA 3LJWA 5LVRA 5A81A 5HELA 4NR8A 5DX4A 2DVQA 2YEMA 3JVJA 4N3WA 5F63A 5F3AA 5DKHA 2KTBB 5FH6A 4QYDA 5CQ7A 2DKWA 3SVGA 5HLSA 4J0RA 4YBSA 4O76A 4CFLA 5L96A 5C85A 3U5MA 5HJCA 5ENGA 5CY9A 5CS8A 4LDFA 5IG6A 5CFWA 5HRWA 4O7FA 5I83A 5LJ1A 5K29A 4Z6IA 5ENCA 4KCXA 3LQHA 2GRCA 3UVDA 3Q2FA 3NXBA 3I3JA 2YQDA 5E3DA 5EVAA 5FH7A 1EQFA 4MR3A 1JM4B 4PY6A 5I7YA 4UITA 5EP7A 4QR5A 5AMFA 4LC2A 5TCMA 5HFQA 4YBMA 4QZSA 3P1CA 5JI8A 5HQ7A 4UYEA 5FE0A 5I80A 4OGIA 4UIVA 5LKTA 4TT6A 5EI4A 4LYWA 4TZ8A 5DLZA 4YY6A 4LR6A 4NYVA 4TQNA 3FKMX 3QZVA 4Z1QA 5CP5A 4NR5A 5E7DA 3GG3A 4O71A 5D24A 5EPBA 4C67A 5FFWA 1X0JA 4UIUA 5C89A 2H60A 4YABA 4OGJA 2YDWA 5ENJA 2RFJA 1N72A 5II1A 4UYGA 5H1TA 3MULA 4NXJA 5EU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQT A;  4BHW A;  5L98 A;  5E9K A;  3IU6 A;  3DWY A;  4KV1 A;  5A82 A;  5HCL A;  5F60 A;  2R0Y A;  2D9E A;  5L8T A;  4F3I A;  4MR6 A;  5CUD A;  5CGP A;  5EPR A;  4PCE A;  5HFR A;  4YK0 A;  4HXR A;  3TLP A;  4N4F A;  4MR4 A;  5C7N A;  4A9M A;  3QZS A;  5KTU A;  3P1F A;  5AD2 A;  5E9I A;  4QUT A;  5EIC A;  4O7E A;  4QSR A;  5EIS A;  4QSW A;  4A9E A;  5FE6 A;  5D3J A;  5EWW A;  5CTL A;  4J0S A;  5DYA A;  3IU5 A;  2OUO A;  5I40 A;  5ETB A;  4KV4 A;  3D7C A;  5D3L A;  5ENF A;  4N4G A;  5FE4 A;  5FH8 A;  5F61 A;  4YYK A;  2F6J A;  2E7O A;  4NR7 A;  4MEQ A;  4YC9 A;  5A5O A;  5L8U A;  4TS8 A;  4YY4 A;  4XY9 A;  4WHU A;  4FLP A;  4LZR A;  4A9I A;  4O7C A;  5LJ0 A;  5E9Y A;  4MR5 A;  4O77 A;  5EV9 A;  2G4A A;  4MEP A;  5DYX A;  5EPS A;  2E3K A;  5I89 A;  5HM0 A;  4HBW A;  5CQ3 A;  3P5O A;  5A5N A;  5EWH A;  4CL9 A;  4XYA A;  5HQ6 A;  5DYU A;  2RO1 A;  3UVW A;  3HME A;  4BW4 A;  2YEK A;  4IOO A;  5ACY A;  4HBV A;  2DWW A;  3RCW A;  3HMH A;  4NR4 A;  4Y03 A;  4CUP A;  4YYG A;  4YBT A;  5ENB A;  5FE1 A;  3MB4 A;  2FSA A;  5DLX A;  4Z6H A;  4A9H A;  1WUG A;  4CLB A;  5E9V A;  2YYN A;  4YAX A;  5C8G A;  5EWC A;  1WUM A;  5A5P A;  4NR6 A;  5C87 A;  4IOR A;  5E9L A;  5EM3 A;  4N4I A;  4A9L A;  4ALH A;  1ZS5 A;  2DVR A;  4QUU A;  4HBX A;  5I88 A;  4PCI A;  5ENI A;  4QSQ A;  4QSS A;  3SVH A;  3LXJ A;  5DFC A;  5FE7 A;  5FE9 A;  5F1H A;  4O72 A;  4UIZ A;  4O7A A;  5BT5 A;  4QSV A;  3MXF A;  5CUB A;  5H1U A;  3P1E A;  2LSP B;  3ONI A;  4BW3 A;  4YH4 A;  3P1D A;  4XUA A;  4ZC9 A;  5E73 A;  2YW5 A;  5TB6 A;  5I7X A;  4LZS A;  5KO4 A;  2OO1 A;  5LJ2 A;  5L99 A;  5CQ6 A;  5FG5 A;  5D3P A;  5CUC A;  2L5E A;  5COI A;  4YYI A;  4ALG A;  4TT4 A;  4YYH A;  5A5R A;  2RI7 A;  5KTW A;  5BT3 A;  2I7K A;  4YAT A;  3JVM A;  4LZ2 A;  4NYW A;  4PS5 A;  5I29 A;  5LVQ A;  5D3R A;  5ETD A;  5CRZ A;  5KU3 A;  4HXS A;  2F6N A;  3UV2 A;  4NUD A;  4NUE A;  4TU4 A;  5CUG A;  5LKU A;  5FDZ A;  4TYL A;  5CU8 A;  4TZ2 A;  2D82 A;  4Z93 A;  4QSX A;  5D25 A;  3UV4 A;  2RNY A;  2R0S A;  4QSP A;  5DFB A;  4BW1 A;  2RNW A;  5ENH A;  5DBM A;  5HEM A;  5DW1 A;  1JSP B;  3DAI A;  5EWV A;  4LYS A;  3U5O A;  5FFY A;  5DY7 A;  4QYL A;  2R10 A;  2RNX A;  2L84 A;  5EA1 A;  5LUU A;  5LKZ A;  4A9O A;  5FE2 A;  5FG4 A;  4UIY A;  4HXM A;  5F36 A;  2DAT A;  4CUQ A;  2OSS A;  4O7B A;  2N9G A;  5F62 A;  4HXP A;  5JWM A;  5CQ8 A;  2RS9 B;  4TT2 A;  5G4S A;  2I8N A;  5EGU A;  3HMF A;  5H1V A;  4BW2 A;  4J3I A;  5I86 A;  5FG6 A;  4RVR A;  4CFK A;  5E0R A;  4YH3 A;  4Q0O A;  4QEV A;  5F1L A;  4A9J A;  4NRC A;  3ZYU A;  4X2I A;  4O75 A;  4QR3 A;  4O74 A;  4CUT A;  4YAD A;  5FFV A;  4BJX A;  4NRA A;  4HBY A;  4QEU A;  4Q0N A;  3O36 A;  4QSU A;  5E3G A;  5CQA A;  3QZT A;  4PKL A;  4QY4 A;  4CUR A;  5A5Q A;  4NR9 A;  5G4R A;  3K2J A;  4YYN A;  4HXO A;  5D26 A;  5FE3 A;  5F5Z A;  5HRV A;  4NS5 A;  4IR6 A;  5CRM A;  5IBN A;  4IR4 A;  4TU6 A;  3UVY A;  3MB3 A;  5FB1 A;  4ZQL A;  3UV5 A;  4WHW A;  5DKC A;  4J1P A;  5CUE A;  3UVX A;  3SVF A;  4YYD A;  5D3T A;  5L97 A;  4MEO A;  3MUK A;  3O35 A;  2R0V A;  4O78 A;  5E9M A;  5IGN A;  3JVK A;  4IR5 A;  5IID A;  4DON A;  4E96 A;  5D3H A;  4NQN A;  4GPJ A;  4NRB A;  3U5P A;  3U5K A;  3S92 A;  4TTE A;  4UYH A;  3S91 A;  3AAD A;  4A9F A;  5FE8 A;  4NUC A;  3MQM A;  4Z1S A;  5HQ5 A;  4QR4 A;  2E7N A;  5A85 A;  4QC1 A;  5IGM A;  4XUB A;  4ZW1 A;  3G0L A;  2MJV B;  5DW2 A;  3UW9 A;  3O33 A;  2YEL A;  4HXK A;  5E74 A;  3JVL A;  4YYM A;  5BT4 A;  4CUS A;  4UIW A;  3LQJ A;  3Q2E A;  4UYF A;  5AD3 A;  4NYX A;  5CZG A;  4QC3 A;  4HXL A;  5D3S A;  4IOQ A;  5D7X A;  5DFD A;  3U5L A;  5C4Q A;  4WIV A;  5F25 A;  4C66 A;  5CQ5 A;  4LYI A;  5CQ4 A;  4PTB A;  5F2P A;  5KTX A;  3G0J A;  5D3N A;  5DYC A;  5H85 A;  5A83 A;  4QST A;  4AKN A;  5HRX A;  3U5J A;  3U5N A;  5FBX A;  5EWD A;  4CUU A;  4LRG A;  4IR3 A;  5A7C A;  2WP2 A;  3AQA A;  5AME A;  5FB0 A;  5D0C A;  5J0D A;  4HXN A;  4MEN A;  5IGL A;  4N4H A;  4QBM A;  5CUA A;  5CPE A;  2NXB A;  4QB3 A;  4OUF A;  4A9K A;  5IGK A;  3LQI A;  5EQ1 A;  1E6I A;  5DKD A;  5I1Q A;  4UYD A;  5ENE A;  4XY8 A;  5II2 A;  4UIX A;  2L85 A;  5A5S A;  3O37 A;  2WP1 A;  5KHM A;  3O34 A;  4NQM A;  5EK9 A;  5FE5 A;  2DVV A;  5HEN A;  1F68 A;  4A9N A;  4YYJ A;  5LKX A;  4QNS A;  4QEW A;  4O70 A;  4UYF B;  2DVS A;  3LJW A;  5LVR A;  5A81 A;  5HEL A;  4NR8 A;  5DX4 A;  2DVQ A;  2YEM A;  3JVJ A;  4N3W A;  5F63 A;  5F3A A;  5DKH A;  2KTB B;  5FH6 A;  4QYD A;  5CQ7 A;  2DKW A;  3SVG A;  5HLS A;  4J0R A;  4YBS A;  4O76 A;  4CFL A;  5L96 A;  5C85 A;  3U5M A;  5HJC A;  5ENG A;  5CY9 A;  5CS8 A;  4LDF A;  5IG6 A;  5CFW A;  5HRW A;  4O7F A;  5I83 A;  5LJ1 A;  5K29 A;  4Z6I A;  5ENC A;  4KCX A;  3LQH A;  2GRC A;  3UVD A;  3Q2F A;  3NXB A;  3I3J A;  2YQD A;  5E3D A;  5EVA A;  5FH7 A;  1EQF A;  4MR3 A;  1JM4 B;  4PY6 A;  5I7Y A;  4UIT A;  5EP7 A;  4QR5 A;  5AMF A;  4LC2 A;  5TCM A;  5HFQ A;  4YBM A;  4QZS A;  3P1C A;  5JI8 A;  5HQ7 A;  4UYE A;  5FE0 A;  5I80 A;  4OGI A;  4UIV A;  5LKT A;  4TT6 A;  5EI4 A;  4LYW A;  4TZ8 A;  5DLZ A;  4YY6 A;  4LR6 A;  4NYV A;  4TQN A;  3FKM X;  3QZV A;  4Z1Q A;  5CP5 A;  4NR5 A;  5E7D A;  3GG3 A;  4O71 A;  5D24 A;  5EPB A;  4C67 A;  5FFW A;  1X0J A;  4UIU A;  5C89 A;  2H60 A;  4YAB A;  4OGJ A;  2YDW A;  5ENJ A;  2RFJ A;  1N72 A;  5II1 A;  4UYG A;  5H1T A;  3MUL A;  4NXJ A;  5EU1 A; 
#chains in the Genus database with same CATH topology
 5CQT A;  4BHW A;  5L98 A;  5E9K A;  3IU6 A;  3DWY A;  4KV1 A;  5A82 A;  5HCL A;  5F60 A;  2R0Y A;  2D9E A;  5L8T A;  4F3I A;  4MR6 A;  5CUD A;  5CGP A;  5EPR A;  4PCE A;  5HFR A;  4YK0 A;  4HXR A;  3TLP A;  4N4F A;  1ZKR A;  4MR4 A;  5C7N A;  4A9M A;  3QZS A;  5KTU A;  3P1F A;  5AD2 A;  5E9I A;  4QUT A;  5EIC A;  4O7E A;  4QSR A;  5EIS A;  4QSW A;  4A9E A;  5FE6 A;  5D3J A;  5EWW A;  5CTL A;  4J0S A;  5DYA A;  3IU5 A;  2OUO A;  5I40 A;  5ETB A;  4KV4 A;  3D7C A;  5D3L A;  5ENF A;  4N4G A;  5FE4 A;  5FH8 A;  5F61 A;  4YYK A;  2F6J A;  2E7O A;  4NR7 A;  4MEQ A;  4YC9 A;  5A5O A;  5L8U A;  4TS8 A;  4YY4 A;  4XY9 A;  4WHU A;  4FLP A;  4LZR A;  4A9I A;  4O7C A;  5LJ0 A;  5E9Y A;  4MR5 A;  4O77 A;  5EV9 A;  2G4A A;  4MEP A;  5DYX A;  5EPS A;  2E3K A;  5I89 A;  5HM0 A;  4HBW A;  5CQ3 A;  3P5O A;  5A5N A;  5EWH A;  4CL9 A;  4XYA A;  5HQ6 A;  5DYU A;  2RO1 A;  3UVW A;  3HME A;  4BW4 A;  2YEK A;  4IOO A;  5ACY A;  4HBV A;  2DWW A;  3RCW A;  3HMH A;  4NR4 A;  4Y03 A;  4CUP A;  4YYG A;  4YBT A;  5ENB A;  5FE1 A;  3MB4 A;  2FSA A;  5DLX A;  4Z6H A;  4A9H A;  1WUG A;  4CLB A;  5E9V A;  2YYN A;  4YAX A;  5C8G A;  5EWC A;  1WUM A;  5A5P A;  4NR6 A;  5C87 A;  4IOR A;  5E9L A;  5EM3 A;  4N4I A;  4A9L A;  4ALH A;  1ZS5 A;  2DVR A;  4QUU A;  4HBX A;  5I88 A;  4PCI A;  5ENI A;  4QSQ A;  4QSS A;  3SVH A;  3LXJ A;  5DFC A;  5FE7 A;  5FE9 A;  5F1H A;  4O72 A;  4UIZ A;  4O7A A;  5BT5 A;  4QSV A;  2EJN A;  3MXF A;  5CUB A;  5H1U A;  3P1E A;  2LSP B;  3ONI A;  4BW3 A;  4YH4 A;  3VKH A;  3P1D A;  4XUA A;  4ZC9 A;  5E73 A;  2YW5 A;  5TB6 A;  5I7X A;  4LZS A;  5KO4 A;  2OO1 A;  5LJ2 A;  5L99 A;  5CQ6 A;  5FG5 A;  5D3P A;  5CUC A;  2L5E A;  5COI A;  4YYI A;  4ALG A;  4TT4 A;  4YYH A;  5A5R A;  2RI7 A;  5KTW A;  5BT3 A;  2I7K A;  4YAT A;  3JVM A;  4LZ2 A;  4NYW A;  4PS5 A;  5I29 A;  5LVQ A;  5D3R A;  5ETD A;  5CRZ A;  5KU3 A;  4AI6 A;  4HXS A;  2F6N A;  3UV2 A;  4NUD A;  4NUE A;  4TU4 A;  5CUG A;  5LKU A;  5FDZ A;  4TYL A;  5CU8 A;  4TZ2 A;  2D82 A;  4Z93 A;  4QSX A;  5D25 A;  3UV4 A;  2RNY A;  2R0S A;  4QSP A;  5DFB A;  4BW1 A;  2RNW A;  5ENH A;  5DBM A;  5HEM A;  3D1B A;  5DW1 A;  1JSP B;  3DAI A;  5EWV A;  4LYS A;  3U5O A;  5FFY A;  5DY7 A;  4QYL A;  2R10 A;  2RNX A;  2L84 A;  5EA1 A;  5LUU A;  5LKZ A;  4A9O A;  5FE2 A;  5FG4 A;  4UIY A;  4HXM A;  5F36 A;  2DAT A;  4CUQ A;  2OSS A;  4O7B A;  2N9G A;  5F62 A;  4HXP A;  5JWM A;  5CQ8 A;  2RS9 B;  4TT2 A;  5G4S A;  2I8N A;  5EGU A;  3HMF A;  5H1V A;  4BW2 A;  4J3I A;  5I86 A;  5FG6 A;  4RVR A;  4CFK A;  5E0R A;  4YH3 A;  4Q0O A;  4QEV A;  5F1L A;  4A9J A;  4NRC A;  3ZYU A;  4X2I A;  4O75 A;  4QR3 A;  4O74 A;  4CUT A;  4YAD A;  5FFV A;  4AKG A;  4BJX A;  4NRA A;  4HBY A;  4QEU A;  4Q0N A;  3O36 A;  4QSU A;  5E3G A;  1PUO A;  5CQA A;  3QZT A;  4PKL A;  4QY4 A;  4CUR A;  5A5Q A;  4NR9 A;  5G4R A;  3K2J A;  4YYN A;  4HXO A;  5D26 A;  5FE3 A;  5F5Z A;  5HRV A;  4NS5 A;  4IR6 A;  5CRM A;  5IBN A;  4IR4 A;  4TU6 A;  3UVY A;  3MB3 A;  5FB1 A;  4ZQL A;  3UV5 A;  4WHW A;  5DKC A;  4J1P A;  5CUE A;  3UVX A;  3SVF A;  4YYD A;  5D3T A;  5L97 A;  4MEO A;  3MUK A;  3O35 A;  2R0V A;  4O78 A;  5E9M A;  5IGN A;  3JVK A;  4IR5 A;  5IID A;  4DON A;  4E96 A;  5D3H A;  4NQN A;  4GPJ A;  4NRB A;  3U5P A;  3U5K A;  3S92 A;  4TTE A;  4UYH A;  3S91 A;  3AAD A;  4A9F A;  5FE8 A;  4NUC A;  3MQM A;  4Z1S A;  5HQ5 A;  4QR4 A;  2E7N A;  5A85 A;  4QC1 A;  5IGM A;  4XUB A;  4ZW1 A;  3G0L A;  2MJV B;  5DW2 A;  3UW9 A;  3O33 A;  2YEL A;  4HXK A;  5E74 A;  3JVL A;  4YYM A;  5BT4 A;  4CUS A;  4UIW A;  4AKI A;  3LQJ A;  3Q2E A;  4UYF A;  5AD3 A;  4NYX A;  5CZG A;  4QC3 A;  4HXL A;  5D3S A;  4IOQ A;  5D7X A;  5DFD A;  3U5L A;  5C4Q A;  4WIV A;  5F25 A;  4C66 A;  5CQ5 A;  4LYI A;  5CQ4 A;  4PTB A;  5F2P A;  5KTX A;  3G0J A;  5D3N A;  5DYC A;  5H85 A;  5A83 A;  4QST A;  4AKN A;  5HRX A;  3U5J A;  3U5N A;  5FBX A;  5EWD A;  4CUU A;  4LRG A;  4IR3 A;  5A7C A;  3D1D A;  2WP2 A;  3AQA A;  5AME A;  5FB0 A;  5D0C A;  5J0D A;  4HXN A;  4MEN A;  5IGL A;  4N4H A;  4QBM A;  5CUA A;  5CPE A;  2NXB A;  4QB3 A;  4OUF A;  4A9K A;  5IGK A;  3LQI A;  5EQ1 A;  1E6I A;  5DKD A;  5I1Q A;  4UYD A;  5ENE A;  4XY8 A;  5II2 A;  4UIX A;  2L85 A;  5A5S A;  3O37 A;  2WP1 A;  5KHM A;  3O34 A;  4NQM A;  5EK9 A;  5FE5 A;  2DVV A;  5HEN A;  1F68 A;  4A9N A;  4YYJ A;  5LKX A;  4QNS A;  4QEW A;  4O70 A;  4UYF B;  2DVS A;  3LJW A;  3VKG A;  5LVR A;  5A81 A;  5HEL A;  4NR8 A;  5DX4 A;  2DVQ A;  2YEM A;  3JVJ A;  4N3W A;  5F63 A;  5F3A A;  5DKH A;  2KTB B;  5FH6 A;  4QYD A;  5CQ7 A;  2DKW A;  3SVG A;  5HLS A;  4J0R A;  4YBS A;  4O76 A;  4CFL A;  5L96 A;  5C85 A;  3U5M A;  5HJC A;  5ENG A;  5CY9 A;  5CS8 A;  4LDF A;  5IG6 A;  5CFW A;  5HRW A;  4O7F A;  5I83 A;  5LJ1 A;  5K29 A;  4Z6I A;  5ENC A;  4KCX A;  3LQH A;  2GRC A;  3UVD A;  3Q2F A;  3NXB A;  3I3J A;  2YQD A;  5E3D A;  5EVA A;  5FH7 A;  1EQF A;  4MR3 A;  1JM4 B;  4PY6 A;  5I7Y A;  4UIT A;  5EP7 A;  4QR5 A;  5AMF A;  4LC2 A;  5TCM A;  5HFQ A;  4YBM A;  4QZS A;  3P1C A;  5JI8 A;  5HQ7 A;  4UYE A;  5FE0 A;  5I80 A;  4OGI A;  4UIV A;  5LKT A;  4TT6 A;  5EI4 A;  4LYW A;  4TZ8 A;  5DLZ A;  4YY6 A;  4LR6 A;  4NYV A;  4TQN A;  3FKM X;  3QZV A;  4Z1Q A;  5CP5 A;  4NR5 A;  5E7D A;  3GG3 A;  4O71 A;  5D24 A;  5EPB A;  4C67 A;  5FFW A;  1X0J A;  4UIU A;  5C89 A;  2H60 A;  4YAB A;  4OGJ A;  2YDW A;  5ENJ A;  2RFJ A;  1N72 A;  5II1 A;  3ERR A;  4UYG A;  5H1T A;  3MUL A;  4NXJ A;  5EU1 A;  4AKH A; 
#chains in the Genus database with same CATH homology
 5CQT A;  4BHW A;  5L98 A;  5E9K A;  3IU6 A;  3DWY A;  4KV1 A;  5A82 A;  5HCL A;  5F60 A;  2R0Y A;  2D9E A;  5L8T A;  4F3I A;  4MR6 A;  5CUD A;  5CGP A;  5EPR A;  4PCE A;  5HFR A;  4YK0 A;  4HXR A;  3TLP A;  4N4F A;  4MR4 A;  5C7N A;  4A9M A;  3QZS A;  5KTU A;  3P1F A;  5AD2 A;  5E9I A;  4QUT A;  5EIC A;  4O7E A;  4QSR A;  5EIS A;  4QSW A;  4A9E A;  5FE6 A;  5D3J A;  5EWW A;  5CTL A;  4J0S A;  5DYA A;  3IU5 A;  2OUO A;  5I40 A;  5ETB A;  4KV4 A;  3D7C A;  5D3L A;  5ENF A;  4N4G A;  5FE4 A;  5FH8 A;  5F61 A;  4YYK A;  2F6J A;  2E7O A;  4NR7 A;  4MEQ A;  4YC9 A;  5A5O A;  5L8U A;  4TS8 A;  4YY4 A;  4XY9 A;  4WHU A;  4FLP A;  4LZR A;  4A9I A;  4O7C A;  5LJ0 A;  5E9Y A;  4MR5 A;  4O77 A;  5EV9 A;  2G4A A;  4MEP A;  5DYX A;  5EPS A;  2E3K A;  5I89 A;  5HM0 A;  4HBW A;  5CQ3 A;  3P5O A;  5A5N A;  5EWH A;  4CL9 A;  4XYA A;  5HQ6 A;  5DYU A;  2RO1 A;  3UVW A;  3HME A;  4BW4 A;  2YEK A;  4IOO A;  5ACY A;  4HBV A;  2DWW A;  3RCW A;  3HMH A;  4NR4 A;  4Y03 A;  4CUP A;  4YYG A;  4YBT A;  5ENB A;  5FE1 A;  3MB4 A;  2FSA A;  5DLX A;  4Z6H A;  4A9H A;  1WUG A;  4CLB A;  5E9V A;  2YYN A;  4YAX A;  5C8G A;  5EWC A;  1WUM A;  5A5P A;  4NR6 A;  5C87 A;  4IOR A;  5E9L A;  5EM3 A;  4N4I A;  4A9L A;  4ALH A;  1ZS5 A;  2DVR A;  4QUU A;  4HBX A;  5I88 A;  4PCI A;  5ENI A;  4QSQ A;  4QSS A;  3SVH A;  3LXJ A;  5DFC A;  5FE7 A;  5FE9 A;  5F1H A;  4O72 A;  4UIZ A;  4O7A A;  5BT5 A;  4QSV A;  3MXF A;  5CUB A;  5H1U A;  3P1E A;  2LSP B;  3ONI A;  4BW3 A;  4YH4 A;  3P1D A;  4XUA A;  4ZC9 A;  5E73 A;  2YW5 A;  5TB6 A;  5I7X A;  4LZS A;  5KO4 A;  2OO1 A;  5LJ2 A;  5L99 A;  5CQ6 A;  5FG5 A;  5D3P A;  5CUC A;  2L5E A;  5COI A;  4YYI A;  4ALG A;  4TT4 A;  4YYH A;  5A5R A;  2RI7 A;  5KTW A;  5BT3 A;  2I7K A;  4YAT A;  3JVM A;  4LZ2 A;  4NYW A;  4PS5 A;  5I29 A;  5LVQ A;  5D3R A;  5ETD A;  5CRZ A;  5KU3 A;  4HXS A;  2F6N A;  3UV2 A;  4NUD A;  4NUE A;  4TU4 A;  5CUG A;  5LKU A;  5FDZ A;  4TYL A;  5CU8 A;  4TZ2 A;  2D82 A;  4Z93 A;  4QSX A;  5D25 A;  3UV4 A;  2RNY A;  2R0S A;  4QSP A;  5DFB A;  4BW1 A;  2RNW A;  5ENH A;  5DBM A;  5HEM A;  5DW1 A;  1JSP B;  3DAI A;  5EWV A;  4LYS A;  3U5O A;  5FFY A;  5DY7 A;  4QYL A;  2R10 A;  2RNX A;  2L84 A;  5EA1 A;  5LUU A;  5LKZ A;  4A9O A;  5FE2 A;  5FG4 A;  4UIY A;  4HXM A;  5F36 A;  2DAT A;  4CUQ A;  2OSS A;  4O7B A;  2N9G A;  5F62 A;  4HXP A;  5JWM A;  5CQ8 A;  2RS9 B;  4TT2 A;  5G4S A;  2I8N A;  5EGU A;  3HMF A;  5H1V A;  4BW2 A;  4J3I A;  5I86 A;  5FG6 A;  4RVR A;  4CFK A;  5E0R A;  4YH3 A;  4Q0O A;  4QEV A;  5F1L A;  4A9J A;  4NRC A;  3ZYU A;  4X2I A;  4O75 A;  4QR3 A;  4O74 A;  4CUT A;  4YAD A;  5FFV A;  4BJX A;  4NRA A;  4HBY A;  4QEU A;  4Q0N A;  3O36 A;  4QSU A;  5E3G A;  5CQA A;  3QZT A;  4PKL A;  4QY4 A;  4CUR A;  5A5Q A;  4NR9 A;  5G4R A;  3K2J A;  4YYN A;  4HXO A;  5D26 A;  5FE3 A;  5F5Z A;  5HRV A;  4NS5 A;  4IR6 A;  5CRM A;  5IBN A;  4IR4 A;  4TU6 A;  3UVY A;  3MB3 A;  5FB1 A;  4ZQL A;  3UV5 A;  4WHW A;  5DKC A;  4J1P A;  5CUE A;  3UVX A;  3SVF A;  4YYD A;  5D3T A;  5L97 A;  4MEO A;  3MUK A;  3O35 A;  2R0V A;  4O78 A;  5E9M A;  5IGN A;  3JVK A;  4IR5 A;  5IID A;  4DON A;  4E96 A;  5D3H A;  4NQN A;  4GPJ A;  4NRB A;  3U5P A;  3U5K A;  3S92 A;  4TTE A;  4UYH A;  3S91 A;  3AAD A;  4A9F A;  5FE8 A;  4NUC A;  3MQM A;  4Z1S A;  5HQ5 A;  4QR4 A;  2E7N A;  5A85 A;  4QC1 A;  5IGM A;  4XUB A;  4ZW1 A;  3G0L A;  2MJV B;  5DW2 A;  3UW9 A;  3O33 A;  2YEL A;  4HXK A;  5E74 A;  3JVL A;  4YYM A;  5BT4 A;  4CUS A;  4UIW A;  3LQJ A;  3Q2E A;  4UYF A;  5AD3 A;  4NYX A;  5CZG A;  4QC3 A;  4HXL A;  5D3S A;  4IOQ A;  5D7X A;  5DFD A;  3U5L A;  5C4Q A;  4WIV A;  5F25 A;  4C66 A;  5CQ5 A;  4LYI A;  5CQ4 A;  4PTB A;  5F2P A;  5KTX A;  3G0J A;  5D3N A;  5DYC A;  5H85 A;  5A83 A;  4QST A;  4AKN A;  5HRX A;  3U5J A;  3U5N A;  5FBX A;  5EWD A;  4CUU A;  4LRG A;  4IR3 A;  5A7C A;  2WP2 A;  3AQA A;  5AME A;  5FB0 A;  5D0C A;  5J0D A;  4HXN A;  4MEN A;  5IGL A;  4N4H A;  4QBM A;  5CUA A;  5CPE A;  2NXB A;  4QB3 A;  4OUF A;  4A9K A;  5IGK A;  3LQI A;  5EQ1 A;  1E6I A;  5DKD A;  5I1Q A;  4UYD A;  5ENE A;  4XY8 A;  5II2 A;  4UIX A;  2L85 A;  5A5S A;  3O37 A;  2WP1 A;  5KHM A;  3O34 A;  4NQM A;  5EK9 A;  5FE5 A;  2DVV A;  5HEN A;  1F68 A;  4A9N A;  4YYJ A;  5LKX A;  4QNS A;  4QEW A;  4O70 A;  4UYF B;  2DVS A;  3LJW A;  5LVR A;  5A81 A;  5HEL A;  4NR8 A;  5DX4 A;  2DVQ A;  2YEM A;  3JVJ A;  4N3W A;  5F63 A;  5F3A A;  5DKH A;  2KTB B;  5FH6 A;  4QYD A;  5CQ7 A;  2DKW A;  3SVG A;  5HLS A;  4J0R A;  4YBS A;  4O76 A;  4CFL A;  5L96 A;  5C85 A;  3U5M A;  5HJC A;  5ENG A;  5CY9 A;  5CS8 A;  4LDF A;  5IG6 A;  5CFW A;  5HRW A;  4O7F A;  5I83 A;  5LJ1 A;  5K29 A;  4Z6I A;  5ENC A;  4KCX A;  3LQH A;  2GRC A;  3UVD A;  3Q2F A;  3NXB A;  3I3J A;  2YQD A;  5E3D A;  5EVA A;  5FH7 A;  1EQF A;  4MR3 A;  1JM4 B;  4PY6 A;  5I7Y A;  4UIT A;  5EP7 A;  4QR5 A;  5AMF A;  4LC2 A;  5TCM A;  5HFQ A;  4YBM A;  4QZS A;  3P1C A;  5JI8 A;  5HQ7 A;  4UYE A;  5FE0 A;  5I80 A;  4OGI A;  4UIV A;  5LKT A;  4TT6 A;  5EI4 A;  4LYW A;  4TZ8 A;  5DLZ A;  4YY6 A;  4LR6 A;  4NYV A;  4TQN A;  3FKM X;  3QZV A;  4Z1Q A;  5CP5 A;  4NR5 A;  5E7D A;  3GG3 A;  4O71 A;  5D24 A;  5EPB A;  4C67 A;  5FFW A;  1X0J A;  4UIU A;  5C89 A;  2H60 A;  4YAB A;  4OGJ A;  2YDW A;  5ENJ A;  2RFJ A;  1N72 A;  5II1 A;  4UYG A;  5H1T A;  3MUL A;  4NXJ A;  5EU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...