5IIDA

Crystal structure of the fifth bromodomain of human polybromo (pb1) in complex with 2-(3,4-dihydroxyphenyl)-5-hydroxy-4h-chromen-4-one
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Discovery and Optimization of a Selective Ligand for the Switch/Sucrose Nonfermenting-Related Bromodomains of Polybromo Protein-1 by the Use of Virtual Screening and Hydration Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5iidA00
5KU3A 4CUQA 3ONIA 3AQAA 4HXSA 4NUDA 5DYUA 4HXMA 5KTWA 4ZC9A 5FBXA 4WIVA 5FFYA 1WUGA 5FFWA 4Z1SA 3TLPA 4Z93A 4N4FA 4YYDA 5ENIA 5FE3A 4YAXA 4O71A 5CUEA 4QSXA 4HXPA 4QEVA 5H1UA 3O37A 4QYDA 4MEOA 5HEMA 5LKZA 5L8TA 4YYNA 4E96A 5E3DA 2LSPB 5FE1A 5G4SA 2YEKA 5ACYA 5DFDA 5CQ7A 4QNSA 4J3IA 2RS9B 4CUTA 4CUUA 3MB3A 5CU8A 4PKLA 5E9KA 4O75A 5FH8A 3K2JA 4YYJA 5DYAA 4J1PA 5I86A 5FE7A 5TCMA 4TYLA 4YADA 4YABA 5D25A 5CRMA 5D26A 4QEWA 1X0JA 5D0CA 5EPSA 2RNXA 5EVAA 5H1VA 4HBVA 5IGKA 5CPEA 3UVYA 3U5LA 4NUEA 4QSVA 5ENCA 5A5PA 5EISA 4Q0NA 2GRCA 5FE6A 5A5OA 4QSRA 5LKXA 4YY6A 5KTXA 4UITA 5I88A 5HJCA 5HQ6A 5IIDA 4TU4A 5EICA 5EI4A 5EWDA 3JVLA 5EWVA 5DKHA 2KTBB 5D3RA 5F61A 5FH7A 4AKNA 2I8NA 5DFBA 5CFWA 5DFCA 4MR6A 3HMFA 2D9EA 3SVHA 4QC1A 5I83A 5EQ1A 4QY4A 5C85A 4NYWA 5CUCA 3U5KA 2WP1A 4MEPA 4NR6A 3UW9A 5F36A 4UYDA 5E9VA 5IBNA 4O74A 5COIA 4NQMA 5EPBA 4UIZA 3Q2EA 4O76A 3P5OA 4LZSA 4MENA 4DONA 2N9GA 4A9FA 4A9EA 3O33A 5DYXA 4QB3A 5CRZA 5BT3A 4BW4A 4O7EA 4NR8A 3MB4A 1EQFA 5D3SA 5FB1A 5A5QA 2YYNA 2DVQA 5EWWA 4HBYA 5F25A 4YYKA 5F1HA 4IOQA 3MULA 4MR4A 5H85A 5L96A 4QUUA 3UVDA 4IOOA 5EK9A 5ENHA 2OO1A 2RNWA 4XUAA 5EWCA 3U5JA 5ENFA 4UIVA 3MXFA 3P1DA 5EV9A 5HCLA 4YC9A 4CURA 4QBMA 3FKMX 2DVSA 4NQNA 1ZS5A 4NS5A 5F5ZA 2YEMA 4A9IA 5AMEA 4CUSA 4F3IA 4LC2A 5D3TA 4HXLA 4QSWA 5CUBA 5HFRA 4WHUA 4LYWA 5FE8A 4TT4A 4Z6HA 4Z1QA 5DLXA 3UVXA 4QZSA 4O7AA 5C89A 5DY7A 4CL9A 4N4GA 2YW5A 5E0RA 4KV4A 3DAIA 3GG3A 4TT2A 3U5OA 4YY4A 2RNYA 3QZVA 4O78A 3JVMA 4QSSA 4WHWA 4Q0OA 4YH3A 5HENA 5A83A 5F1LA 5AD2A 5I29A 4UYFB 5F60A 4NR7A 4N4IA 4NRAA 4ZW1A 5CQTA 4YATA 5LUUA 5ENBA 4LR6A 4Z6IA 1E6IA 4Y03A 5C4QA 3MQMA 5C8GA 4LZ2A 2RFJA 5I89A 5DX4A 3RCWA 5DKCA 4LRGA 3Q2FA 2H60A 5CS8A 5L8UA 5C87A 2L5EA 2YQDA 4OGIA 3O35A 4PS5A 3UV4A 5CQ3A 5HELA 3P1CA 4YBSA 4A9HA 4YK0A 5HQ7A 5EA1A 5FFVA 5LKTA 4HXNA 3G0JA 3UV2A 3IU5A 2L85A 4CUPA 4O72A 4HBXA 4HXKA 5I7YA 2NXBA 5EWHA 3HMHA 2YDWA 3AADA 5ENGA 3U5NA 4BHWA 3SVGA 4A9NA 5G4RA 5DBMA 5FDZA 5A5SA 4MR5A 4C67A 4XY8A 4MEQA 5D3HA 4O77A 4XUBA 3IU6A 5CQ4A 3QZTA 4O7CA 1JSPB 4KV1A 5FG6A 2I7KA 3P1EA 3P1FA 5ETBA 4QUTA 5H1TA 4NRCA 4UIWA 2RI7A 5I40A 5HM0A 3O34A 4ZQLA 3O36A 2OSSA 2R0SA 4PTBA 5L99A 3D7CA 5KHMA 3JVKA 4XY9A 4J0SA 4UIUA 4BJXA 4TT6A 4IR4A 4NR4A 5FE4A 5JWMA 4QYLA 5CUAA 5ENEA 5BT4A 2R0VA 5FE2A 5II1A 3S91A 5FE9A 2E3KA 3LXJA 5EGUA 3LQHA 5FB0A 4KCXA 5IGLA 2DKWA 5II2A 5TB6A 2E7OA 2YELA 4UIYA 5CUGA 4HXRA 3UVWA 5IG6A 4ALHA 4HBWA 4ALGA 2WP2A 5LJ2A 5LJ1A 5CUDA 4NR5A 4QSQA 4UYFA 5A5RA 4QR5A 4QSUA 4YYHA 5C7NA 3SVFA 4NYVA 4YBTA 4UYGA 4OGJA 4A9KA 4N3WA 5DKDA 3MUKA 5BT5A 2FSAA 4QR3A 5LVQA 2F6NA 2G4AA 5I7XA 4TZ8A 5F62A 3UV5A 5I1QA 4PCEA 4GPJA 4YBMA 5HFQA 2F6JA 5D3LA 5ENJA 5F2PA 4C66A 5FE0A 5E73A 3HMEA 2DWWA 4O7FA 5D7XA 5D3JA 4NXJA 2OUOA 4O70A 5ETDA 4O7BA 3DWYA 4BW1A 5CZGA 5DLZA 4IR6A 5J0DA 5FG5A 4TZ2A 4OUFA 5HRWA 4NRBA 4LZRA 5A7CA 2R10A 4J0RA 2L84A 4A9MA 2D82A 5A82A 2MJVB 3JVJA 4N4HA 5E7DA 5CQ6A 1F68A 4UYEA 5CQAA 4A9JA 5CGPA 5AMFA 2RO1A 5A81A 4BW2A 3U5PA 5EPRA 5EU1A 5CY9A 5L98A 4NUCA 5K29A 5AD3A 5D24A 4PY6A 5E9LA 4FLPA 2E7NA 3LQIA 4YYMA 5HRVA 4PCIA 3S92A 5E9YA 5JI8A 4QSTA 1WUMA 2R0YA 4TTEA 2DVVA 5F3AA 5FH6A 3G0LA 4IR5A 4IR3A 5KO4A 4CFKA 4LDFA 3NXBA 5CQ5A 4TQNA 4CFLA 5DW1A 3I3JA 5IGMA 5EP7A 5IGNA 2DATA 5HLSA 3LJWA 5KTUA 3LQJA 4BW3A 5D3PA 4QC3A 5CP5A 5DYCA 4A9LA 1N72A 4TU6A 5EM3A 4IORA 5LVRA 4LYSA 4TS8A 5CQ8A 2DVRA 4LYIA 4UIXA 5HQ5A 5DW2A 4YH4A 5L97A 5FG4A 4YYIA 4UYHA 5E9MA 5E74A 4YYGA 5A85A 5CTLA 4QR4A 4RVRA 5FE5A 5D3NA 3U5MA 4A9OA 4QSPA 5E9IA 5LKUA 4CLBA 4HXOA 4QEUA 4XYAA 5I80A 3ZYUA 4NYXA 5HRXA 5F63A 3QZSA 4MR3A 5LJ0A 4NR9A 5E3GA 5A5NA 4X2IA 1JM4B
chains in the Genus database with same CATH superfamily
5KU3A 4CUQA 3ONIA 3AQAA 4HXSA 4NUDA 5DYUA 4HXMA 5KTWA 4ZC9A 5FBXA 4WIVA 5FFYA 1WUGA 5FFWA 4Z1SA 3TLPA 4Z93A 4N4FA 4YYDA 5ENIA 5FE3A 4YAXA 4O71A 5CUEA 4QSXA 4HXPA 4QEVA 5H1UA 3O37A 4QYDA 4MEOA 5HEMA 5LKZA 5L8TA 4YYNA 4E96A 5E3DA 2LSPB 5FE1A 5G4SA 2YEKA 5ACYA 5DFDA 5CQ7A 4QNSA 4J3IA 2RS9B 4CUTA 4CUUA 3MB3A 5CU8A 4PKLA 5E9KA 4O75A 5FH8A 3K2JA 4YYJA 5DYAA 4J1PA 5I86A 5FE7A 5TCMA 4TYLA 4YADA 4YABA 5D25A 5CRMA 5D26A 4QEWA 1X0JA 5D0CA 5EPSA 2RNXA 5EVAA 5H1VA 4HBVA 5IGKA 5CPEA 3UVYA 3U5LA 4NUEA 4QSVA 5ENCA 5A5PA 5EISA 4Q0NA 3ERRA 2GRCA 5FE6A 5A5OA 4QSRA 5LKXA 4YY6A 5KTXA 4UITA 5I88A 5HJCA 5HQ6A 5IIDA 4TU4A 5EICA 5EI4A 5EWDA 3JVLA 5EWVA 5DKHA 2KTBB 5D3RA 5F61A 5FH7A 4AKNA 2I8NA 5DFBA 5CFWA 5DFCA 4MR6A 3HMFA 2D9EA 3SVHA 4QC1A 5I83A 5EQ1A 4QY4A 5C85A 4NYWA 5CUCA 3U5KA 2WP1A 4MEPA 4NR6A 3UW9A 5F36A 4UYDA 5E9VA 5IBNA 4O74A 5COIA 4NQMA 5EPBA 4UIZA 3Q2EA 4O76A 3P5OA 4LZSA 4MENA 4DONA 2N9GA 4A9FA 4A9EA 3O33A 5DYXA 4QB3A 5CRZA 5BT3A 4BW4A 4O7EA 4NR8A 3MB4A 1EQFA 5D3SA 5FB1A 5A5QA 2YYNA 2DVQA 5EWWA 4HBYA 5F25A 4YYKA 5F1HA 4IOQA 3MULA 4MR4A 5H85A 5L96A 4QUUA 3UVDA 4IOOA 1ZKRA 5EK9A 5ENHA 2OO1A 2RNWA 4XUAA 5EWCA 3U5JA 5ENFA 4UIVA 3MXFA 3P1DA 5EV9A 5HCLA 4YC9A 4CURA 4QBMA 3FKMX 2DVSA 3D1BA 4NQNA 1ZS5A 4NS5A 5F5ZA 2YEMA 4A9IA 5AMEA 4CUSA 4F3IA 4LC2A 5D3TA 4HXLA 4QSWA 5CUBA 5HFRA 4WHUA 4LYWA 5FE8A 4TT4A 4Z6HA 4Z1QA 5DLXA 3UVXA 4QZSA 4O7AA 5C89A 5DY7A 4CL9A 4N4GA 2YW5A 5E0RA 4KV4A 3GG3A 3DAIA 4TT2A 3U5OA 4YY4A 2RNYA 3QZVA 4O78A 3JVMA 4QSSA 4WHWA 4Q0OA 4YH3A 5HENA 5A83A 5F1LA 5AD2A 5I29A 4UYFB 5F60A 4NR7A 4N4IA 4NRAA 4ZW1A 5CQTA 4YATA 5LUUA 5ENBA 4LR6A 4Z6IA 1E6IA 4Y03A 5C4QA 3MQMA 5C8GA 4LZ2A 2RFJA 5I89A 5DX4A 3RCWA 5DKCA 4LRGA 3Q2FA 2H60A 5CS8A 5L8UA 5C87A 2L5EA 2YQDA 4OGIA 3O35A 4PS5A 3UV4A 5CQ3A 5HELA 3P1CA 4YBSA 4A9HA 4YK0A 5HQ7A 5EA1A 5FFVA 5LKTA 4HXNA 3G0JA 3UV2A 3IU5A 2L85A 4CUPA 4O72A 2EJNA 4HBXA 4HXKA 5I7YA 2NXBA 5EWHA 3HMHA 3VKHA 2YDWA 3AADA 5ENGA 3U5NA 4BHWA 3SVGA 4A9NA 5G4RA 3D1DA 5DBMA 5FDZA 5A5SA 4MR5A 4C67A 4XY8A 4MEQA 5D3HA 4O77A 4XUBA 3VKGA 3IU6A 5CQ4A 3QZTA 4O7CA 1JSPB 4KV1A 5FG6A 2I7KA 3P1EA 3P1FA 5ETBA 4QUTA 5H1TA 4NRCA 4UIWA 2RI7A 5I40A 5HM0A 3O34A 4ZQLA 3O36A 2OSSA 2R0SA 4PTBA 5L99A 3D7CA 5KHMA 3JVKA 4XY9A 4J0SA 4UIUA 4AKHA 4BJXA 4TT6A 4IR4A 4NR4A 5FE4A 5JWMA 4QYLA 5CUAA 5ENEA 5BT4A 2R0VA 5FE2A 5II1A 3S91A 5FE9A 2E3KA 3LXJA 5EGUA 3LQHA 5FB0A 4KCXA 5IGLA 2DKWA 5II2A 5TB6A 2E7OA 2YELA 4UIYA 5CUGA 4HXRA 3UVWA 5IG6A 4ALHA 4HBWA 4ALGA 2WP2A 5LJ2A 5LJ1A 5CUDA 4NR5A 4QSQA 4UYFA 5A5RA 4QR5A 4QSUA 4YYHA 5C7NA 3SVFA 4NYVA 4YBTA 4UYGA 4OGJA 4A9KA 4N3WA 5DKDA 3MUKA 5BT5A 2FSAA 4QR3A 5LVQA 2F6NA 2G4AA 5I7XA 4TZ8A 5F62A 3UV5A 1PUOA 5I1QA 4PCEA 4GPJA 4YBMA 5HFQA 2F6JA 5D3LA 5ENJA 5F2PA 4C66A 5FE0A 5E73A 3HMEA 2DWWA 4O7FA 5D7XA 5D3JA 4NXJA 2OUOA 4O70A 5ETDA 4O7BA 3DWYA 4BW1A 5CZGA 5DLZA 4IR6A 5J0DA 5FG5A 4TZ2A 4OUFA 5HRWA 4NRBA 4AKGA 4LZRA 5A7CA 2R10A 4J0RA 2L84A 4A9MA 2D82A 5A82A 2MJVB 3JVJA 4N4HA 5E7DA 5CQ6A 1F68A 4UYEA 5CQAA 4A9JA 5CGPA 5AMFA 2RO1A 5A81A 4BW2A 3U5PA 5EPRA 5EU1A 5CY9A 5L98A 4NUCA 5K29A 5AD3A 5D24A 4PY6A 5E9LA 4FLPA 2E7NA 3LQIA 4YYMA 5HRVA 4PCIA 3S92A 5E9YA 5JI8A 4QSTA 1WUMA 2R0YA 4TTEA 2DVVA 5F3AA 5FH6A 3G0LA 4IR5A 4IR3A 5KO4A 4CFKA 4LDFA 3NXBA 5CQ5A 4TQNA 4CFLA 5DW1A 3I3JA 5IGMA 5EP7A 5IGNA 2DATA 5HLSA 3LJWA 5KTUA 3LQJA 4BW3A 5D3PA 4QC3A 5CP5A 5DYCA 4A9LA 1N72A 4TU6A 5EM3A 4IORA 5LVRA 4LYSA 4TS8A 5CQ8A 2DVRA 4LYIA 4UIXA 5HQ5A 5DW2A 4YH4A 5L97A 5FG4A 4YYIA 4UYHA 5E9MA 5E74A 4YYGA 5A85A 4AI6A 5CTLA 4QR4A 4RVRA 5FE5A 5D3NA 3U5MA 4A9OA 4QSPA 5E9IA 5LKUA 4CLBA 4HXOA 4AKIA 4QEUA 4XYAA 5I80A 3ZYUA 4NYXA 5HRXA 5F63A 3QZSA 4MR3A 5LJ0A 4NR9A 5E3GA 5A5NA 4X2IA 1JM4B
chains in the Genus database with same CATH topology
5KU3A 4CUQA 3ONIA 3AQAA 4HXSA 4NUDA 5DYUA 4HXMA 5KTWA 4ZC9A 5FBXA 4WIVA 5FFYA 1WUGA 5FFWA 4Z1SA 3TLPA 4Z93A 4N4FA 4YYDA 5ENIA 5FE3A 4YAXA 4O71A 5CUEA 4QSXA 4HXPA 4QEVA 5H1UA 3O37A 4QYDA 4MEOA 5HEMA 5LKZA 5L8TA 4YYNA 4E96A 5E3DA 2LSPB 5FE1A 5G4SA 2YEKA 5ACYA 5DFDA 5CQ7A 4QNSA 4J3IA 2RS9B 4CUTA 4CUUA 3MB3A 5CU8A 4PKLA 5E9KA 4O75A 5FH8A 3K2JA 4YYJA 5DYAA 4J1PA 5I86A 5FE7A 5TCMA 4TYLA 4YADA 4YABA 5D25A 5CRMA 5D26A 4QEWA 1X0JA 5D0CA 5EPSA 2RNXA 5EVAA 5H1VA 4HBVA 5IGKA 5CPEA 3UVYA 3U5LA 4NUEA 4QSVA 5ENCA 5A5PA 5EISA 4Q0NA 2GRCA 5FE6A 5A5OA 4QSRA 5LKXA 4YY6A 5KTXA 4UITA 5I88A 5HJCA 5HQ6A 5IIDA 4TU4A 5EICA 5EI4A 5EWDA 3JVLA 5EWVA 5DKHA 2KTBB 5D3RA 5F61A 5FH7A 4AKNA 2I8NA 5DFBA 5CFWA 5DFCA 4MR6A 3HMFA 2D9EA 3SVHA 4QC1A 5I83A 5EQ1A 4QY4A 5C85A 4NYWA 5CUCA 3U5KA 2WP1A 4MEPA 4NR6A 3UW9A 5F36A 4UYDA 5E9VA 5IBNA 4O74A 5COIA 4NQMA 5EPBA 4UIZA 3Q2EA 4O76A 3P5OA 4LZSA 4MENA 4DONA 2N9GA 4A9FA 4A9EA 3O33A 5DYXA 4QB3A 5CRZA 5BT3A 4BW4A 4O7EA 4NR8A 3MB4A 1EQFA 5D3SA 5FB1A 5A5QA 2YYNA 2DVQA 5EWWA 4HBYA 5F25A 4YYKA 5F1HA 4IOQA 3MULA 4MR4A 5H85A 5L96A 4QUUA 3UVDA 4IOOA 5EK9A 5ENHA 2OO1A 2RNWA 4XUAA 5EWCA 3U5JA 5ENFA 4UIVA 3MXFA 3P1DA 5EV9A 5HCLA 4YC9A 4CURA 4QBMA 3FKMX 2DVSA 4NQNA 1ZS5A 4NS5A 5F5ZA 2YEMA 4A9IA 5AMEA 4CUSA 4F3IA 4LC2A 5D3TA 4HXLA 4QSWA 5CUBA 5HFRA 4WHUA 4LYWA 5FE8A 4TT4A 4Z6HA 4Z1QA 5DLXA 3UVXA 4QZSA 4O7AA 5C89A 5DY7A 4CL9A 4N4GA 2YW5A 5E0RA 4KV4A 3DAIA 3GG3A 4TT2A 3U5OA 4YY4A 2RNYA 3QZVA 4O78A 3JVMA 4QSSA 4WHWA 4Q0OA 4YH3A 5HENA 5A83A 5F1LA 5AD2A 5I29A 4UYFB 5F60A 4NR7A 4N4IA 4NRAA 4ZW1A 5CQTA 4YATA 5LUUA 5ENBA 4LR6A 4Z6IA 1E6IA 4Y03A 5C4QA 3MQMA 5C8GA 4LZ2A 2RFJA 5I89A 5DX4A 3RCWA 5DKCA 4LRGA 3Q2FA 2H60A 5CS8A 5L8UA 5C87A 2L5EA 2YQDA 4OGIA 3O35A 4PS5A 3UV4A 5CQ3A 5HELA 3P1CA 4YBSA 4A9HA 4YK0A 5HQ7A 5EA1A 5FFVA 5LKTA 4HXNA 3G0JA 3UV2A 3IU5A 2L85A 4CUPA 4O72A 4HBXA 4HXKA 5I7YA 2NXBA 5EWHA 3HMHA 2YDWA 3AADA 5ENGA 3U5NA 4BHWA 3SVGA 4A9NA 5G4RA 5DBMA 5FDZA 5A5SA 4MR5A 4C67A 4XY8A 4MEQA 5D3HA 4O77A 4XUBA 3IU6A 5CQ4A 3QZTA 4O7CA 1JSPB 4KV1A 5FG6A 2I7KA 3P1EA 3P1FA 5ETBA 4QUTA 5H1TA 4NRCA 4UIWA 2RI7A 5I40A 5HM0A 3O34A 4ZQLA 3O36A 2OSSA 2R0SA 4PTBA 5L99A 3D7CA 5KHMA 3JVKA 4XY9A 4J0SA 4UIUA 4BJXA 4TT6A 4IR4A 4NR4A 5FE4A 5JWMA 4QYLA 5CUAA 5ENEA 5BT4A 2R0VA 5FE2A 5II1A 3S91A 5FE9A 2E3KA 3LXJA 5EGUA 3LQHA 5FB0A 4KCXA 5IGLA 2DKWA 5II2A 5TB6A 2E7OA 2YELA 4UIYA 5CUGA 4HXRA 3UVWA 5IG6A 4ALHA 4HBWA 4ALGA 2WP2A 5LJ2A 5LJ1A 5CUDA 4NR5A 4QSQA 4UYFA 5A5RA 4QR5A 4QSUA 4YYHA 5C7NA 3SVFA 4NYVA 4YBTA 4UYGA 4OGJA 4A9KA 4N3WA 5DKDA 3MUKA 5BT5A 2FSAA 4QR3A 5LVQA 2F6NA 2G4AA 5I7XA 4TZ8A 5F62A 3UV5A 5I1QA 4PCEA 4GPJA 4YBMA 5HFQA 2F6JA 5D3LA 5ENJA 5F2PA 4C66A 5FE0A 5E73A 3HMEA 2DWWA 4O7FA 5D7XA 5D3JA 4NXJA 2OUOA 4O70A 5ETDA 4O7BA 3DWYA 4BW1A 5CZGA 5DLZA 4IR6A 5J0DA 5FG5A 4TZ2A 4OUFA 5HRWA 4NRBA 4LZRA 5A7CA 2R10A 4J0RA 2L84A 4A9MA 2D82A 5A82A 2MJVB 3JVJA 4N4HA 5E7DA 5CQ6A 1F68A 4UYEA 5CQAA 4A9JA 5CGPA 5AMFA 2RO1A 5A81A 4BW2A 3U5PA 5EPRA 5EU1A 5CY9A 5L98A 4NUCA 5K29A 5AD3A 5D24A 4PY6A 5E9LA 4FLPA 2E7NA 3LQIA 4YYMA 5HRVA 4PCIA 3S92A 5E9YA 5JI8A 4QSTA 1WUMA 2R0YA 4TTEA 2DVVA 5F3AA 5FH6A 3G0LA 4IR5A 4IR3A 5KO4A 4CFKA 4LDFA 3NXBA 5CQ5A 4TQNA 4CFLA 5DW1A 3I3JA 5IGMA 5EP7A 5IGNA 2DATA 5HLSA 3LJWA 5KTUA 3LQJA 4BW3A 5D3PA 4QC3A 5CP5A 5DYCA 4A9LA 1N72A 4TU6A 5EM3A 4IORA 5LVRA 4LYSA 4TS8A 5CQ8A 2DVRA 4LYIA 4UIXA 5HQ5A 5DW2A 4YH4A 5L97A 5FG4A 4YYIA 4UYHA 5E9MA 5E74A 4YYGA 5A85A 5CTLA 4QR4A 4RVRA 5FE5A 5D3NA 3U5MA 4A9OA 4QSPA 5E9IA 5LKUA 4CLBA 4HXOA 4QEUA 4XYAA 5I80A 3ZYUA 4NYXA 5HRXA 5F63A 3QZSA 4MR3A 5LJ0A 4NR9A 5E3GA 5A5NA 4X2IA 1JM4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KU3 A;  4CUQ A;  3ONI A;  3AQA A;  4HXS A;  4NUD A;  5DYU A;  4HXM A;  5KTW A;  4ZC9 A;  5FBX A;  4WIV A;  5FFY A;  1WUG A;  5FFW A;  4Z1S A;  3TLP A;  4Z93 A;  4N4F A;  4YYD A;  5ENI A;  5FE3 A;  4YAX A;  4O71 A;  5CUE A;  4QSX A;  4HXP A;  4QEV A;  5H1U A;  3O37 A;  4QYD A;  4MEO A;  5HEM A;  5LKZ A;  5L8T A;  4YYN A;  4E96 A;  5E3D A;  2LSP B;  5FE1 A;  5G4S A;  2YEK A;  5ACY A;  5DFD A;  5CQ7 A;  4QNS A;  4J3I A;  2RS9 B;  4CUT A;  4CUU A;  3MB3 A;  5CU8 A;  4PKL A;  5E9K A;  4O75 A;  5FH8 A;  3K2J A;  4YYJ A;  5DYA A;  4J1P A;  5I86 A;  5FE7 A;  5TCM A;  4TYL A;  4YAD A;  4YAB A;  5D25 A;  5CRM A;  5D26 A;  4QEW A;  1X0J A;  5D0C A;  5EPS A;  2RNX A;  5EVA A;  5H1V A;  4HBV A;  5IGK A;  5CPE A;  3UVY A;  3U5L A;  4NUE A;  4QSV A;  5ENC A;  5A5P A;  5EIS A;  4Q0N A;  2GRC A;  5FE6 A;  5A5O A;  4QSR A;  5LKX A;  4YY6 A;  5KTX A;  4UIT A;  5I88 A;  5HJC A;  5HQ6 A;  5IID A;  4TU4 A;  5EIC A;  5EI4 A;  5EWD A;  3JVL A;  5EWV A;  5DKH A;  2KTB B;  5D3R A;  5F61 A;  5FH7 A;  4AKN A;  2I8N A;  5DFB A;  5CFW A;  5DFC A;  4MR6 A;  3HMF A;  2D9E A;  3SVH A;  4QC1 A;  5I83 A;  5EQ1 A;  4QY4 A;  5C85 A;  4NYW A;  5CUC A;  3U5K A;  2WP1 A;  4MEP A;  4NR6 A;  3UW9 A;  5F36 A;  4UYD A;  5E9V A;  5IBN A;  4O74 A;  5COI A;  4NQM A;  5EPB A;  4UIZ A;  3Q2E A;  4O76 A;  3P5O A;  4LZS A;  4MEN A;  4DON A;  2N9G A;  4A9F A;  4A9E A;  3O33 A;  5DYX A;  4QB3 A;  5CRZ A;  5BT3 A;  4BW4 A;  4O7E A;  4NR8 A;  3MB4 A;  1EQF A;  5D3S A;  5FB1 A;  5A5Q A;  2YYN A;  2DVQ A;  5EWW A;  4HBY A;  5F25 A;  4YYK A;  5F1H A;  4IOQ A;  3MUL A;  4MR4 A;  5H85 A;  5L96 A;  4QUU A;  3UVD A;  4IOO A;  5EK9 A;  5ENH A;  2OO1 A;  2RNW A;  4XUA A;  5EWC A;  3U5J A;  5ENF A;  4UIV A;  3MXF A;  3P1D A;  5EV9 A;  5HCL A;  4YC9 A;  4CUR A;  4QBM A;  3FKM X;  2DVS A;  4NQN A;  1ZS5 A;  4NS5 A;  5F5Z A;  2YEM A;  4A9I A;  5AME A;  4CUS A;  4F3I A;  4LC2 A;  5D3T A;  4HXL A;  4QSW A;  5CUB A;  5HFR A;  4WHU A;  4LYW A;  5FE8 A;  4TT4 A;  4Z6H A;  4Z1Q A;  5DLX A;  3UVX A;  4QZS A;  4O7A A;  5C89 A;  5DY7 A;  4CL9 A;  4N4G A;  2YW5 A;  5E0R A;  4KV4 A;  3DAI A;  3GG3 A;  4TT2 A;  3U5O A;  4YY4 A;  2RNY A;  3QZV A;  4O78 A;  3JVM A;  4QSS A;  4WHW A;  4Q0O A;  4YH3 A;  5HEN A;  5A83 A;  5F1L A;  5AD2 A;  5I29 A;  4UYF B;  5F60 A;  4NR7 A;  4N4I A;  4NRA A;  4ZW1 A;  5CQT A;  4YAT A;  5LUU A;  5ENB A;  4LR6 A;  4Z6I A;  1E6I A;  4Y03 A;  5C4Q A;  3MQM A;  5C8G A;  4LZ2 A;  2RFJ A;  5I89 A;  5DX4 A;  3RCW A;  5DKC A;  4LRG A;  3Q2F A;  2H60 A;  5CS8 A;  5L8U A;  5C87 A;  2L5E A;  2YQD A;  4OGI A;  3O35 A;  4PS5 A;  3UV4 A;  5CQ3 A;  5HEL A;  3P1C A;  4YBS A;  4A9H A;  4YK0 A;  5HQ7 A;  5EA1 A;  5FFV A;  5LKT A;  4HXN A;  3G0J A;  3UV2 A;  3IU5 A;  2L85 A;  4CUP A;  4O72 A;  4HBX A;  4HXK A;  5I7Y A;  2NXB A;  5EWH A;  3HMH A;  2YDW A;  3AAD A;  5ENG A;  3U5N A;  4BHW A;  3SVG A;  4A9N A;  5G4R A;  5DBM A;  5FDZ A;  5A5S A;  4MR5 A;  4C67 A;  4XY8 A;  4MEQ A;  5D3H A;  4O77 A;  4XUB A;  3IU6 A;  5CQ4 A;  3QZT A;  4O7C A;  1JSP B;  4KV1 A;  5FG6 A;  2I7K A;  3P1E A;  3P1F A;  5ETB A;  4QUT A;  5H1T A;  4NRC A;  4UIW A;  2RI7 A;  5I40 A;  5HM0 A;  3O34 A;  4ZQL A;  3O36 A;  2OSS A;  2R0S A;  4PTB A;  5L99 A;  3D7C A;  5KHM A;  3JVK A;  4XY9 A;  4J0S A;  4UIU A;  4BJX A;  4TT6 A;  4IR4 A;  4NR4 A;  5FE4 A;  5JWM A;  4QYL A;  5CUA A;  5ENE A;  5BT4 A;  2R0V A;  5FE2 A;  5II1 A;  3S91 A;  5FE9 A;  2E3K A;  3LXJ A;  5EGU A;  3LQH A;  5FB0 A;  4KCX A;  5IGL A;  2DKW A;  5II2 A;  5TB6 A;  2E7O A;  2YEL A;  4UIY A;  5CUG A;  4HXR A;  3UVW A;  5IG6 A;  4ALH A;  4HBW A;  4ALG A;  2WP2 A;  5LJ2 A;  5LJ1 A;  5CUD A;  4NR5 A;  4QSQ A;  4UYF A;  5A5R A;  4QR5 A;  4QSU A;  4YYH A;  5C7N A;  3SVF A;  4NYV A;  4YBT A;  4UYG A;  4OGJ A;  4A9K A;  4N3W A;  5DKD A;  3MUK A;  5BT5 A;  2FSA A;  4QR3 A;  5LVQ A;  2F6N A;  2G4A A;  5I7X A;  4TZ8 A;  5F62 A;  3UV5 A;  5I1Q A;  4PCE A;  4GPJ A;  4YBM A;  5HFQ A;  2F6J A;  5D3L A;  5ENJ A;  5F2P A;  4C66 A;  5FE0 A;  5E73 A;  3HME A;  2DWW A;  4O7F A;  5D7X A;  5D3J A;  4NXJ A;  2OUO A;  4O70 A;  5ETD A;  4O7B A;  3DWY A;  4BW1 A;  5CZG A;  5DLZ A;  4IR6 A;  5J0D A;  5FG5 A;  4TZ2 A;  4OUF A;  5HRW A;  4NRB A;  4LZR A;  5A7C A;  2R10 A;  4J0R A;  2L84 A;  4A9M A;  2D82 A;  5A82 A;  2MJV B;  3JVJ A;  4N4H A;  5E7D A;  5CQ6 A;  1F68 A;  4UYE A;  5CQA A;  4A9J A;  5CGP A;  5AMF A;  2RO1 A;  5A81 A;  4BW2 A;  3U5P A;  5EPR A;  5EU1 A;  5CY9 A;  5L98 A;  4NUC A;  5K29 A;  5AD3 A;  5D24 A;  4PY6 A;  5E9L A;  4FLP A;  2E7N A;  3LQI A;  4YYM A;  5HRV A;  4PCI A;  3S92 A;  5E9Y A;  5JI8 A;  4QST A;  1WUM A;  2R0Y A;  4TTE A;  2DVV A;  5F3A A;  5FH6 A;  3G0L A;  4IR5 A;  4IR3 A;  5KO4 A;  4CFK A;  4LDF A;  3NXB A;  5CQ5 A;  4TQN A;  4CFL A;  5DW1 A;  3I3J A;  5IGM A;  5EP7 A;  5IGN A;  2DAT A;  5HLS A;  3LJW A;  5KTU A;  3LQJ A;  4BW3 A;  5D3P A;  4QC3 A;  5CP5 A;  5DYC A;  4A9L A;  1N72 A;  4TU6 A;  5EM3 A;  4IOR A;  5LVR A;  4LYS A;  4TS8 A;  5CQ8 A;  2DVR A;  4LYI A;  4UIX A;  5HQ5 A;  5DW2 A;  4YH4 A;  5L97 A;  5FG4 A;  4YYI A;  4UYH A;  5E9M A;  5E74 A;  4YYG A;  5A85 A;  5CTL A;  4QR4 A;  4RVR A;  5FE5 A;  5D3N A;  3U5M A;  4A9O A;  4QSP A;  5E9I A;  5LKU A;  4CLB A;  4HXO A;  4QEU A;  4XYA A;  5I80 A;  3ZYU A;  4NYX A;  5HRX A;  5F63 A;  3QZS A;  4MR3 A;  5LJ0 A;  4NR9 A;  5E3G A;  5A5N A;  4X2I A;  1JM4 B; 
#chains in the Genus database with same CATH topology
 5KU3 A;  4CUQ A;  3ONI A;  3AQA A;  4HXS A;  4NUD A;  5DYU A;  4HXM A;  5KTW A;  4ZC9 A;  5FBX A;  4WIV A;  5FFY A;  1WUG A;  5FFW A;  4Z1S A;  3TLP A;  4Z93 A;  4N4F A;  4YYD A;  5ENI A;  5FE3 A;  4YAX A;  4O71 A;  5CUE A;  4QSX A;  4HXP A;  4QEV A;  5H1U A;  3O37 A;  4QYD A;  4MEO A;  5HEM A;  5LKZ A;  5L8T A;  4YYN A;  4E96 A;  5E3D A;  2LSP B;  5FE1 A;  5G4S A;  2YEK A;  5ACY A;  5DFD A;  5CQ7 A;  4QNS A;  4J3I A;  2RS9 B;  4CUT A;  4CUU A;  3MB3 A;  5CU8 A;  4PKL A;  5E9K A;  4O75 A;  5FH8 A;  3K2J A;  4YYJ A;  5DYA A;  4J1P A;  5I86 A;  5FE7 A;  5TCM A;  4TYL A;  4YAD A;  4YAB A;  5D25 A;  5CRM A;  5D26 A;  4QEW A;  1X0J A;  5D0C A;  5EPS A;  2RNX A;  5EVA A;  5H1V A;  4HBV A;  5IGK A;  5CPE A;  3UVY A;  3U5L A;  4NUE A;  4QSV A;  5ENC A;  5A5P A;  5EIS A;  4Q0N A;  3ERR A;  2GRC A;  5FE6 A;  5A5O A;  4QSR A;  5LKX A;  4YY6 A;  5KTX A;  4UIT A;  5I88 A;  5HJC A;  5HQ6 A;  5IID A;  4TU4 A;  5EIC A;  5EI4 A;  5EWD A;  3JVL A;  5EWV A;  5DKH A;  2KTB B;  5D3R A;  5F61 A;  5FH7 A;  4AKN A;  2I8N A;  5DFB A;  5CFW A;  5DFC A;  4MR6 A;  3HMF A;  2D9E A;  3SVH A;  4QC1 A;  5I83 A;  5EQ1 A;  4QY4 A;  5C85 A;  4NYW A;  5CUC A;  3U5K A;  2WP1 A;  4MEP A;  4NR6 A;  3UW9 A;  5F36 A;  4UYD A;  5E9V A;  5IBN A;  4O74 A;  5COI A;  4NQM A;  5EPB A;  4UIZ A;  3Q2E A;  4O76 A;  3P5O A;  4LZS A;  4MEN A;  4DON A;  2N9G A;  4A9F A;  4A9E A;  3O33 A;  5DYX A;  4QB3 A;  5CRZ A;  5BT3 A;  4BW4 A;  4O7E A;  4NR8 A;  3MB4 A;  1EQF A;  5D3S A;  5FB1 A;  5A5Q A;  2YYN A;  2DVQ A;  5EWW A;  4HBY A;  5F25 A;  4YYK A;  5F1H A;  4IOQ A;  3MUL A;  4MR4 A;  5H85 A;  5L96 A;  4QUU A;  3UVD A;  4IOO A;  1ZKR A;  5EK9 A;  5ENH A;  2OO1 A;  2RNW A;  4XUA A;  5EWC A;  3U5J A;  5ENF A;  4UIV A;  3MXF A;  3P1D A;  5EV9 A;  5HCL A;  4YC9 A;  4CUR A;  4QBM A;  3FKM X;  2DVS A;  3D1B A;  4NQN A;  1ZS5 A;  4NS5 A;  5F5Z A;  2YEM A;  4A9I A;  5AME A;  4CUS A;  4F3I A;  4LC2 A;  5D3T A;  4HXL A;  4QSW A;  5CUB A;  5HFR A;  4WHU A;  4LYW A;  5FE8 A;  4TT4 A;  4Z6H A;  4Z1Q A;  5DLX A;  3UVX A;  4QZS A;  4O7A A;  5C89 A;  5DY7 A;  4CL9 A;  4N4G A;  2YW5 A;  5E0R A;  4KV4 A;  3GG3 A;  3DAI A;  4TT2 A;  3U5O A;  4YY4 A;  2RNY A;  3QZV A;  4O78 A;  3JVM A;  4QSS A;  4WHW A;  4Q0O A;  4YH3 A;  5HEN A;  5A83 A;  5F1L A;  5AD2 A;  5I29 A;  4UYF B;  5F60 A;  4NR7 A;  4N4I A;  4NRA A;  4ZW1 A;  5CQT A;  4YAT A;  5LUU A;  5ENB A;  4LR6 A;  4Z6I A;  1E6I A;  4Y03 A;  5C4Q A;  3MQM A;  5C8G A;  4LZ2 A;  2RFJ A;  5I89 A;  5DX4 A;  3RCW A;  5DKC A;  4LRG A;  3Q2F A;  2H60 A;  5CS8 A;  5L8U A;  5C87 A;  2L5E A;  2YQD A;  4OGI A;  3O35 A;  4PS5 A;  3UV4 A;  5CQ3 A;  5HEL A;  3P1C A;  4YBS A;  4A9H A;  4YK0 A;  5HQ7 A;  5EA1 A;  5FFV A;  5LKT A;  4HXN A;  3G0J A;  3UV2 A;  3IU5 A;  2L85 A;  4CUP A;  4O72 A;  2EJN A;  4HBX A;  4HXK A;  5I7Y A;  2NXB A;  5EWH A;  3HMH A;  3VKH A;  2YDW A;  3AAD A;  5ENG A;  3U5N A;  4BHW A;  3SVG A;  4A9N A;  5G4R A;  3D1D A;  5DBM A;  5FDZ A;  5A5S A;  4MR5 A;  4C67 A;  4XY8 A;  4MEQ A;  5D3H A;  4O77 A;  4XUB A;  3VKG A;  3IU6 A;  5CQ4 A;  3QZT A;  4O7C A;  1JSP B;  4KV1 A;  5FG6 A;  2I7K A;  3P1E A;  3P1F A;  5ETB A;  4QUT A;  5H1T A;  4NRC A;  4UIW A;  2RI7 A;  5I40 A;  5HM0 A;  3O34 A;  4ZQL A;  3O36 A;  2OSS A;  2R0S A;  4PTB A;  5L99 A;  3D7C A;  5KHM A;  3JVK A;  4XY9 A;  4J0S A;  4UIU A;  4AKH A;  4BJX A;  4TT6 A;  4IR4 A;  4NR4 A;  5FE4 A;  5JWM A;  4QYL A;  5CUA A;  5ENE A;  5BT4 A;  2R0V A;  5FE2 A;  5II1 A;  3S91 A;  5FE9 A;  2E3K A;  3LXJ A;  5EGU A;  3LQH A;  5FB0 A;  4KCX A;  5IGL A;  2DKW A;  5II2 A;  5TB6 A;  2E7O A;  2YEL A;  4UIY A;  5CUG A;  4HXR A;  3UVW A;  5IG6 A;  4ALH A;  4HBW A;  4ALG A;  2WP2 A;  5LJ2 A;  5LJ1 A;  5CUD A;  4NR5 A;  4QSQ A;  4UYF A;  5A5R A;  4QR5 A;  4QSU A;  4YYH A;  5C7N A;  3SVF A;  4NYV A;  4YBT A;  4UYG A;  4OGJ A;  4A9K A;  4N3W A;  5DKD A;  3MUK A;  5BT5 A;  2FSA A;  4QR3 A;  5LVQ A;  2F6N A;  2G4A A;  5I7X A;  4TZ8 A;  5F62 A;  3UV5 A;  1PUO A;  5I1Q A;  4PCE A;  4GPJ A;  4YBM A;  5HFQ A;  2F6J A;  5D3L A;  5ENJ A;  5F2P A;  4C66 A;  5FE0 A;  5E73 A;  3HME A;  2DWW A;  4O7F A;  5D7X A;  5D3J A;  4NXJ A;  2OUO A;  4O70 A;  5ETD A;  4O7B A;  3DWY A;  4BW1 A;  5CZG A;  5DLZ A;  4IR6 A;  5J0D A;  5FG5 A;  4TZ2 A;  4OUF A;  5HRW A;  4NRB A;  4AKG A;  4LZR A;  5A7C A;  2R10 A;  4J0R A;  2L84 A;  4A9M A;  2D82 A;  5A82 A;  2MJV B;  3JVJ A;  4N4H A;  5E7D A;  5CQ6 A;  1F68 A;  4UYE A;  5CQA A;  4A9J A;  5CGP A;  5AMF A;  2RO1 A;  5A81 A;  4BW2 A;  3U5P A;  5EPR A;  5EU1 A;  5CY9 A;  5L98 A;  4NUC A;  5K29 A;  5AD3 A;  5D24 A;  4PY6 A;  5E9L A;  4FLP A;  2E7N A;  3LQI A;  4YYM A;  5HRV A;  4PCI A;  3S92 A;  5E9Y A;  5JI8 A;  4QST A;  1WUM A;  2R0Y A;  4TTE A;  2DVV A;  5F3A A;  5FH6 A;  3G0L A;  4IR5 A;  4IR3 A;  5KO4 A;  4CFK A;  4LDF A;  3NXB A;  5CQ5 A;  4TQN A;  4CFL A;  5DW1 A;  3I3J A;  5IGM A;  5EP7 A;  5IGN A;  2DAT A;  5HLS A;  3LJW A;  5KTU A;  3LQJ A;  4BW3 A;  5D3P A;  4QC3 A;  5CP5 A;  5DYC A;  4A9L A;  1N72 A;  4TU6 A;  5EM3 A;  4IOR A;  5LVR A;  4LYS A;  4TS8 A;  5CQ8 A;  2DVR A;  4LYI A;  4UIX A;  5HQ5 A;  5DW2 A;  4YH4 A;  5L97 A;  5FG4 A;  4YYI A;  4UYH A;  5E9M A;  5E74 A;  4YYG A;  5A85 A;  4AI6 A;  5CTL A;  4QR4 A;  4RVR A;  5FE5 A;  5D3N A;  3U5M A;  4A9O A;  4QSP A;  5E9I A;  5LKU A;  4CLB A;  4HXO A;  4AKI A;  4QEU A;  4XYA A;  5I80 A;  3ZYU A;  4NYX A;  5HRX A;  5F63 A;  3QZS A;  4MR3 A;  5LJ0 A;  4NR9 A;  5E3G A;  5A5N A;  4X2I A;  1JM4 B; 
#chains in the Genus database with same CATH homology
 5KU3 A;  4CUQ A;  3ONI A;  3AQA A;  4HXS A;  4NUD A;  5DYU A;  4HXM A;  5KTW A;  4ZC9 A;  5FBX A;  4WIV A;  5FFY A;  1WUG A;  5FFW A;  4Z1S A;  3TLP A;  4Z93 A;  4N4F A;  4YYD A;  5ENI A;  5FE3 A;  4YAX A;  4O71 A;  5CUE A;  4QSX A;  4HXP A;  4QEV A;  5H1U A;  3O37 A;  4QYD A;  4MEO A;  5HEM A;  5LKZ A;  5L8T A;  4YYN A;  4E96 A;  5E3D A;  2LSP B;  5FE1 A;  5G4S A;  2YEK A;  5ACY A;  5DFD A;  5CQ7 A;  4QNS A;  4J3I A;  2RS9 B;  4CUT A;  4CUU A;  3MB3 A;  5CU8 A;  4PKL A;  5E9K A;  4O75 A;  5FH8 A;  3K2J A;  4YYJ A;  5DYA A;  4J1P A;  5I86 A;  5FE7 A;  5TCM A;  4TYL A;  4YAD A;  4YAB A;  5D25 A;  5CRM A;  5D26 A;  4QEW A;  1X0J A;  5D0C A;  5EPS A;  2RNX A;  5EVA A;  5H1V A;  4HBV A;  5IGK A;  5CPE A;  3UVY A;  3U5L A;  4NUE A;  4QSV A;  5ENC A;  5A5P A;  5EIS A;  4Q0N A;  2GRC A;  5FE6 A;  5A5O A;  4QSR A;  5LKX A;  4YY6 A;  5KTX A;  4UIT A;  5I88 A;  5HJC A;  5HQ6 A;  5IID A;  4TU4 A;  5EIC A;  5EI4 A;  5EWD A;  3JVL A;  5EWV A;  5DKH A;  2KTB B;  5D3R A;  5F61 A;  5FH7 A;  4AKN A;  2I8N A;  5DFB A;  5CFW A;  5DFC A;  4MR6 A;  3HMF A;  2D9E A;  3SVH A;  4QC1 A;  5I83 A;  5EQ1 A;  4QY4 A;  5C85 A;  4NYW A;  5CUC A;  3U5K A;  2WP1 A;  4MEP A;  4NR6 A;  3UW9 A;  5F36 A;  4UYD A;  5E9V A;  5IBN A;  4O74 A;  5COI A;  4NQM A;  5EPB A;  4UIZ A;  3Q2E A;  4O76 A;  3P5O A;  4LZS A;  4MEN A;  4DON A;  2N9G A;  4A9F A;  4A9E A;  3O33 A;  5DYX A;  4QB3 A;  5CRZ A;  5BT3 A;  4BW4 A;  4O7E A;  4NR8 A;  3MB4 A;  1EQF A;  5D3S A;  5FB1 A;  5A5Q A;  2YYN A;  2DVQ A;  5EWW A;  4HBY A;  5F25 A;  4YYK A;  5F1H A;  4IOQ A;  3MUL A;  4MR4 A;  5H85 A;  5L96 A;  4QUU A;  3UVD A;  4IOO A;  5EK9 A;  5ENH A;  2OO1 A;  2RNW A;  4XUA A;  5EWC A;  3U5J A;  5ENF A;  4UIV A;  3MXF A;  3P1D A;  5EV9 A;  5HCL A;  4YC9 A;  4CUR A;  4QBM A;  3FKM X;  2DVS A;  4NQN A;  1ZS5 A;  4NS5 A;  5F5Z A;  2YEM A;  4A9I A;  5AME A;  4CUS A;  4F3I A;  4LC2 A;  5D3T A;  4HXL A;  4QSW A;  5CUB A;  5HFR A;  4WHU A;  4LYW A;  5FE8 A;  4TT4 A;  4Z6H A;  4Z1Q A;  5DLX A;  3UVX A;  4QZS A;  4O7A A;  5C89 A;  5DY7 A;  4CL9 A;  4N4G A;  2YW5 A;  5E0R A;  4KV4 A;  3DAI A;  3GG3 A;  4TT2 A;  3U5O A;  4YY4 A;  2RNY A;  3QZV A;  4O78 A;  3JVM A;  4QSS A;  4WHW A;  4Q0O A;  4YH3 A;  5HEN A;  5A83 A;  5F1L A;  5AD2 A;  5I29 A;  4UYF B;  5F60 A;  4NR7 A;  4N4I A;  4NRA A;  4ZW1 A;  5CQT A;  4YAT A;  5LUU A;  5ENB A;  4LR6 A;  4Z6I A;  1E6I A;  4Y03 A;  5C4Q A;  3MQM A;  5C8G A;  4LZ2 A;  2RFJ A;  5I89 A;  5DX4 A;  3RCW A;  5DKC A;  4LRG A;  3Q2F A;  2H60 A;  5CS8 A;  5L8U A;  5C87 A;  2L5E A;  2YQD A;  4OGI A;  3O35 A;  4PS5 A;  3UV4 A;  5CQ3 A;  5HEL A;  3P1C A;  4YBS A;  4A9H A;  4YK0 A;  5HQ7 A;  5EA1 A;  5FFV A;  5LKT A;  4HXN A;  3G0J A;  3UV2 A;  3IU5 A;  2L85 A;  4CUP A;  4O72 A;  4HBX A;  4HXK A;  5I7Y A;  2NXB A;  5EWH A;  3HMH A;  2YDW A;  3AAD A;  5ENG A;  3U5N A;  4BHW A;  3SVG A;  4A9N A;  5G4R A;  5DBM A;  5FDZ A;  5A5S A;  4MR5 A;  4C67 A;  4XY8 A;  4MEQ A;  5D3H A;  4O77 A;  4XUB A;  3IU6 A;  5CQ4 A;  3QZT A;  4O7C A;  1JSP B;  4KV1 A;  5FG6 A;  2I7K A;  3P1E A;  3P1F A;  5ETB A;  4QUT A;  5H1T A;  4NRC A;  4UIW A;  2RI7 A;  5I40 A;  5HM0 A;  3O34 A;  4ZQL A;  3O36 A;  2OSS A;  2R0S A;  4PTB A;  5L99 A;  3D7C A;  5KHM A;  3JVK A;  4XY9 A;  4J0S A;  4UIU A;  4BJX A;  4TT6 A;  4IR4 A;  4NR4 A;  5FE4 A;  5JWM A;  4QYL A;  5CUA A;  5ENE A;  5BT4 A;  2R0V A;  5FE2 A;  5II1 A;  3S91 A;  5FE9 A;  2E3K A;  3LXJ A;  5EGU A;  3LQH A;  5FB0 A;  4KCX A;  5IGL A;  2DKW A;  5II2 A;  5TB6 A;  2E7O A;  2YEL A;  4UIY A;  5CUG A;  4HXR A;  3UVW A;  5IG6 A;  4ALH A;  4HBW A;  4ALG A;  2WP2 A;  5LJ2 A;  5LJ1 A;  5CUD A;  4NR5 A;  4QSQ A;  4UYF A;  5A5R A;  4QR5 A;  4QSU A;  4YYH A;  5C7N A;  3SVF A;  4NYV A;  4YBT A;  4UYG A;  4OGJ A;  4A9K A;  4N3W A;  5DKD A;  3MUK A;  5BT5 A;  2FSA A;  4QR3 A;  5LVQ A;  2F6N A;  2G4A A;  5I7X A;  4TZ8 A;  5F62 A;  3UV5 A;  5I1Q A;  4PCE A;  4GPJ A;  4YBM A;  5HFQ A;  2F6J A;  5D3L A;  5ENJ A;  5F2P A;  4C66 A;  5FE0 A;  5E73 A;  3HME A;  2DWW A;  4O7F A;  5D7X A;  5D3J A;  4NXJ A;  2OUO A;  4O70 A;  5ETD A;  4O7B A;  3DWY A;  4BW1 A;  5CZG A;  5DLZ A;  4IR6 A;  5J0D A;  5FG5 A;  4TZ2 A;  4OUF A;  5HRW A;  4NRB A;  4LZR A;  5A7C A;  2R10 A;  4J0R A;  2L84 A;  4A9M A;  2D82 A;  5A82 A;  2MJV B;  3JVJ A;  4N4H A;  5E7D A;  5CQ6 A;  1F68 A;  4UYE A;  5CQA A;  4A9J A;  5CGP A;  5AMF A;  2RO1 A;  5A81 A;  4BW2 A;  3U5P A;  5EPR A;  5EU1 A;  5CY9 A;  5L98 A;  4NUC A;  5K29 A;  5AD3 A;  5D24 A;  4PY6 A;  5E9L A;  4FLP A;  2E7N A;  3LQI A;  4YYM A;  5HRV A;  4PCI A;  3S92 A;  5E9Y A;  5JI8 A;  4QST A;  1WUM A;  2R0Y A;  4TTE A;  2DVV A;  5F3A A;  5FH6 A;  3G0L A;  4IR5 A;  4IR3 A;  5KO4 A;  4CFK A;  4LDF A;  3NXB A;  5CQ5 A;  4TQN A;  4CFL A;  5DW1 A;  3I3J A;  5IGM A;  5EP7 A;  5IGN A;  2DAT A;  5HLS A;  3LJW A;  5KTU A;  3LQJ A;  4BW3 A;  5D3P A;  4QC3 A;  5CP5 A;  5DYC A;  4A9L A;  1N72 A;  4TU6 A;  5EM3 A;  4IOR A;  5LVR A;  4LYS A;  4TS8 A;  5CQ8 A;  2DVR A;  4LYI A;  4UIX A;  5HQ5 A;  5DW2 A;  4YH4 A;  5L97 A;  5FG4 A;  4YYI A;  4UYH A;  5E9M A;  5E74 A;  4YYG A;  5A85 A;  5CTL A;  4QR4 A;  4RVR A;  5FE5 A;  5D3N A;  3U5M A;  4A9O A;  4QSP A;  5E9I A;  5LKU A;  4CLB A;  4HXO A;  4QEU A;  4XYA A;  5I80 A;  3ZYU A;  4NYX A;  5HRX A;  5F63 A;  3QZS A;  4MR3 A;  5LJ0 A;  4NR9 A;  5E3G A;  5A5N A;  4X2I A;  1JM4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...