4UYHA

N-terminal bromodomain of human brd2 with 1-((2r,4s)-2-methyl-4-(phenylamino)-6-(4-(piperidin-1-ylmethyl)phenyl)-3,4-dihydroquinolin-1(2h)-yl)ethanone
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
109
structure length
109
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title The Discovery of I-Bet726 (Gsk1324726A), a Potent Tetrahydroquinoline Apoa1 Up-Regulator and Selective Bet Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uyhA00
5CQTA 5FFVA 4XY9A 4LZ2A 2N9GA 3O36A 4MR6A 5ENHA 4MR4A 3UV2A 4YK0A 5A5QA 5CFWA 5LKUA 5D25A 3HMFA 5ENGA 2I8NA 4N4HA 4WIVA 3U5PA 4CFLA 4O74A 5C8GA 4LC2A 4TS8A 4QEUA 4O7AA 5F25A 5F1HA 5D3LA 5LUUA 3P1CA 5CUBA 2DWWA 4O76A 5E73A 4ZQLA 4YYMA 2RS9B 4CUPA 4HXRA 5DYCA 5D3NA 3AQAA 5L8UA 4ZC9A 3IU6A 5KO4A 4TYLA 4DONA 3U5OA 4HXMA 5CU8A 5DFCA 4IR5A 5CQ3A 4QSWA 5DX4A 4O72A 5L99A 3MB3A 5I80A 5LVRA 3P5OA 5F62A 5AMFA 5HELA 3MULA 2L5EA 4HXSA 4LYSA 5D3PA 5D3SA 4YC9A 4LZSA 2YEKA 4CLBA 4NUEA 4UIVA 5DW1A 5FE0A 3SVHA 3O35A 1JM4B 5FE6A 5IBNA 1F68A 3ZYUA 5F63A 5L97A 4NRCA 5C89A 3JVMA 4YY4A 5CRZA 5ACYA 4YYDA 4MR3A 5CGPA 3LQJA 2R0VA 5D3RA 5FH7A 4O7EA 4QSPA 4QR5A 4QYDA 5F36A 5EPRA 5C87A 3MUKA 5F5ZA 5E9YA 2DVRA 2G4AA 4N3WA 4BHWA 5E3GA 5E9MA 5DKHA 5HRVA 5HFQA 4IR3A 4GPJA 4J0SA 5DYUA 5FG4A 5KTXA 5ENFA 5CQ4A 4NR5A 4NQMA 4FLPA 4QR4A 3TLPA 5L8TA 2D82A 5KU3A 4IOQA 4YBSA 4QUTA 2LSPB 4QSUA 3P1DA 4YATA 4O75A 4XUAA 4UYEA 2R0SA 5H1UA 5A5PA 3O37A 4E96A 3QZSA 3QZVA 2RFJA 3O34A 4TT2A 4KV4A 5CUGA 4BW3A 5C85A 3AADA 5C4QA 3MB4A 5FE4A 3MXFA 4A9HA 4UITA 5EM3A 4QY4A 3LQIA 3NXBA 4O77A 5FDZA 5CUAA 4MEOA 5A82A 3G0JA 5F2PA 5FE1A 4Z1SA 4N4IA 5I88A 4MEQA 5HQ7A 3IU5A 3D7CA 4HXLA 3UV5A 4YH4A 4PCIA 5FE5A 4QC3A 4NYXA 2YYNA 5EVAA 5L96A 5L98A 5E9KA 4J3IA 4ALHA 4OUFA 4LYWA 3UW9A 4UYDA 3K2JA 5F1LA 5FH6A 5DLXA 5E74A 1E6IA 4YH3A 3SVGA 4UIUA 3G0LA 4CUTA 5FE7A 5LKXA 4A9NA 4AKNA 3I3JA 4RVRA 2MJVB 5IGMA 5A81A 4O78A 4WHUA 4BJXA 5CPEA 5COIA 3DWYA 4HXNA 3U5JA 5I83A 3UVDA 4A9FA 4QR3A 3MQMA 4LDFA 4TZ8A 4CUSA 5J0DA 5TB6A 4QYLA 4TT6A 4TZ2A 4YAXA 4BW1A 3P1FA 5FE9A 5HEMA 5A83A 4Y03A 5LJ1A 5CP5A 2RO1A 4MENA 4QC1A 2YELA 4YADA 5D3TA 4UYFB 5AD2A 5KHMA 4OGJA 5IGNA 3LQHA 5LKZA 5D7XA 5H1VA 5ENIA 5TCMA 2RI7A 5HFRA 4O7FA 5EWCA 2H60A 2RNYA 5CTLA 4N4GA 5DFDA 3Q2FA 5EK9A 3O33A 5FB0A 3UVYA 2DVQA 4ZW1A 4C67A 1X0JA 4QNSA 5DW2A 4CUUA 4TU4A 4BW2A 4O71A 4TT4A 5CY9A 2R10A 2OUOA 4PS5A 5EISA 4TU6A 4CURA 4TTEA 2OSSA 2NXBA 4QB3A 5EA1A 4LYIA 4TQNA 5LJ2A 3JVKA 1JSPB 2R0YA 5DFBA 2YEMA 5FG5A 5F60A 5I86A 5HRWA 4QSXA 5HRXA 4XYAA 4OGIA 5EWDA 5EGUA 5KTUA 5H1TA 3U5NA 4LR6A 4Q0OA 5FBXA 5G4SA 5A5RA 4O70A 2DKWA 4NUDA 5HQ5A 3UVWA 5DY7A 4HXPA 4NR9A 5HCLA 2L84A 3Q2EA 5I29A 5ENJA 5CUCA 2F6NA 5II2A 3JVLA 5CQAA 2F6JA 3HMEA 2YQDA 5JWMA 4HBXA 5DBMA 5E0RA 5D26A 5D0CA 5CQ7A 5A7CA 4UYHA 5HJCA 4QZSA 3UVXA 4QSSA 3DAIA 3SVFA 5BT5A 5FE2A 4UIYA 5ENBA 4NUCA 5K29A 3S91A 4HBYA 5EPBA 5A5SA 4KV1A 5HM0A 3UV4A 5KTWA 5C7NA 3ONIA 4F3IA 5LJ0A 2DVVA 5CZGA 4YYJA 2GRCA 5EPSA 4A9MA 3HMHA 4UIXA 5FE3A 4NR6A 5A85A 5BT4A 4A9EA 4NR4A 2RNWA 4Z93A 5I89A 4A9LA 5ETDA 3P1EA 5E3DA 5FG6A 5I40A 4QBMA 5EWVA 5H85A 4NR8A 4NYWA 4QSTA 5I7XA 4HBWA 3LJWA 4QSQA 5CQ5A 5CS8A 1N72A 5EWHA 4PCEA 5EICA 4N4FA 4Z1QA 5EI4A 5CRMA 4YYHA 4WHWA 4HXOA 2L85A 4YY6A 4QEVA 4MR5A 5E9IA 5FB1A 4NYVA 2I7KA 4A9IA 5DLZA 4Z6IA 4QEWA 5HENA 4YYKA 4A9JA 5G4RA 4HXKA 3QZTA 5CUEA 4UIZA 4Z6HA 5AD3A 5ENEA 4O7BA 5E9VA 4YYNA 4UYGA 5EP7A 4YBTA 5I7YA 5BT3A 4NRBA 5FFWA 5EQ1A 5LKTA 5E9LA 4HBVA 4XUBA 5D24A 2YW5A 5FFYA 4YBMA 4PY6A 4BW4A 5F3AA 2E3KA 2DATA 5A5OA 4C66A 4KCXA 3GG3A 4CFKA 4X2IA 4YABA 5IGLA 2WP1A 5DYAA 4J1PA 4ALGA 4MEPA 5D3HA 5DKDA 2KTBB 4UYFA 4IOOA 2E7OA 5AMEA 5CUDA 4NR7A 4QSVA 2E7NA 3JVJA 2OO1A 5CQ6A 4PKLA 5IG6A 4IR4A 5HLSA 2YDWA 4CL9A 5F61A 3U5MA 3U5KA 2WP2A 5HQ6A 4A9OA 1ZS5A 2RNXA 3FKMX 4IORA 2D9EA 3RCWA 4QUUA 5LVQA 4A9KA 4XY8A 5CQ8A 4CUQA 5ENCA 5EV9A 4NXJA 5EU1A 5E7DA 4J0RA 4NRAA 4LRGA 5D3JA 4YYGA 4IR6A 4UIWA 5DKCA 2FSAA 5EWWA 2DVSA 3U5LA 4O7CA 4Q0NA 5JI8A 4NS5A 4QSRA 5FE8A 4NQNA 5ETBA 1WUMA 1EQFA 4LZRA 5DYXA 5IIDA 5A5NA 3S92A 5FH8A 4YYIA 5I1QA 3LXJA 5IGKA 1WUGA 4PTBA 5II1A
chains in the Genus database with same CATH superfamily
5CQTA 5FFVA 4XY9A 4LZ2A 2N9GA 3O36A 4MR6A 5ENHA 4MR4A 3UV2A 4YK0A 5A5QA 5CFWA 5LKUA 5D25A 3HMFA 5ENGA 2I8NA 4N4HA 4WIVA 3U5PA 4CFLA 4O74A 5C8GA 4LC2A 4TS8A 4QEUA 3VKHA 4O7AA 5F25A 5F1HA 5D3LA 5LUUA 3P1CA 5CUBA 2DWWA 4O76A 5E73A 4ZQLA 4YYMA 2RS9B 4CUPA 4HXRA 5DYCA 5D3NA 3AQAA 5L8UA 4ZC9A 3IU6A 5KO4A 4TYLA 4DONA 3U5OA 4HXMA 5CU8A 5DFCA 4IR5A 5CQ3A 4QSWA 5DX4A 4O72A 5L99A 3MB3A 5I80A 5LVRA 3P5OA 5F62A 5AMFA 5HELA 3MULA 2L5EA 4HXSA 4LYSA 5D3PA 5D3SA 4YC9A 4LZSA 2YEKA 4CLBA 4NUEA 4UIVA 5DW1A 5FE0A 3SVHA 3O35A 1JM4B 5FE6A 5IBNA 1F68A 3ZYUA 5F63A 5L97A 4NRCA 5C89A 3JVMA 4YY4A 5CRZA 5ACYA 4YYDA 4MR3A 5CGPA 3LQJA 2R0VA 5D3RA 5FH7A 4O7EA 4QSPA 4QR5A 4QYDA 5F36A 5EPRA 5C87A 3MUKA 5F5ZA 5E9YA 2DVRA 2G4AA 4N3WA 4BHWA 5E3GA 5E9MA 5DKHA 5HRVA 5HFQA 4IR3A 4GPJA 4J0SA 5DYUA 5FG4A 5KTXA 5ENFA 5CQ4A 4NR5A 4NQMA 4FLPA 4QR4A 3TLPA 5L8TA 2D82A 2EJNA 5KU3A 4IOQA 4YBSA 4QUTA 2LSPB 4QSUA 1ZKRA 3P1DA 4YATA 4O75A 1PUOA 4XUAA 4UYEA 2R0SA 5H1UA 5A5PA 3O37A 4E96A 3QZSA 3QZVA 2RFJA 3O34A 4TT2A 4KV4A 5CUGA 4BW3A 5C85A 3AADA 5C4QA 3MB4A 5FE4A 3MXFA 4A9HA 4UITA 5EM3A 4QY4A 3LQIA 3NXBA 4O77A 5FDZA 5CUAA 4MEOA 5A82A 3G0JA 5F2PA 5FE1A 3D1BA 4Z1SA 4N4IA 5I88A 4AI6A 4MEQA 5HQ7A 3IU5A 3D7CA 4HXLA 3UV5A 4YH4A 4PCIA 5FE5A 4QC3A 4NYXA 2YYNA 5EVAA 5L96A 5L98A 5E9KA 4AKIA 4J3IA 4ALHA 4OUFA 4LYWA 3UW9A 4UYDA 3K2JA 5F1LA 5FH6A 5DLXA 5E74A 1E6IA 4YH3A 3SVGA 4UIUA 3G0LA 4CUTA 5FE7A 5LKXA 4A9NA 4AKNA 3I3JA 4RVRA 2MJVB 5IGMA 5A81A 4O78A 4WHUA 4BJXA 5CPEA 5COIA 3DWYA 4HXNA 3U5JA 5I83A 3UVDA 4A9FA 4QR3A 3MQMA 4LDFA 4TZ8A 4CUSA 5J0DA 5TB6A 4QYLA 4TT6A 4TZ2A 4YAXA 4BW1A 3P1FA 5FE9A 5HEMA 5A83A 4Y03A 5LJ1A 5CP5A 2RO1A 4MENA 4QC1A 2YELA 4YADA 5D3TA 4UYFB 5AD2A 5KHMA 4OGJA 5IGNA 3LQHA 5LKZA 5D7XA 5H1VA 5ENIA 5TCMA 2RI7A 5HFRA 4O7FA 5EWCA 2H60A 2RNYA 5CTLA 4N4GA 5DFDA 3Q2FA 5EK9A 3O33A 5FB0A 3UVYA 2DVQA 4ZW1A 4C67A 1X0JA 4AKHA 4QNSA 5DW2A 4CUUA 4TU4A 4BW2A 4O71A 4TT4A 5CY9A 2R10A 2OUOA 4PS5A 5EISA 4TU6A 4CURA 4TTEA 2OSSA 2NXBA 4QB3A 5EA1A 4LYIA 4TQNA 5LJ2A 3JVKA 1JSPB 2R0YA 5DFBA 2YEMA 5FG5A 5F60A 5I86A 5HRWA 4QSXA 5HRXA 4XYAA 4OGIA 5EWDA 5EGUA 5KTUA 5H1TA 3U5NA 4LR6A 4Q0OA 5FBXA 5G4SA 5A5RA 4O70A 2DKWA 4NUDA 5HQ5A 3UVWA 5DY7A 4HXPA 4NR9A 5HCLA 2L84A 3Q2EA 5I29A 5ENJA 5CUCA 2F6NA 5II2A 3JVLA 5CQAA 2F6JA 3HMEA 2YQDA 5JWMA 4HBXA 5DBMA 5E0RA 5D26A 5D0CA 5CQ7A 5A7CA 4UYHA 5HJCA 4QZSA 3UVXA 4QSSA 3DAIA 3SVFA 5BT5A 5FE2A 4UIYA 5ENBA 4NUCA 5K29A 3S91A 4HBYA 5EPBA 5A5SA 4KV1A 5HM0A 3UV4A 5KTWA 5C7NA 3ONIA 4F3IA 5LJ0A 2DVVA 5CZGA 4YYJA 2GRCA 5EPSA 4A9MA 3HMHA 4UIXA 5FE3A 4NR6A 5A85A 5BT4A 4A9EA 4NR4A 2RNWA 4Z93A 5I89A 4A9LA 5ETDA 3P1EA 5E3DA 5FG6A 3D1DA 4QBMA 5I40A 5EWVA 5H85A 4NR8A 4NYWA 4QSTA 5I7XA 4HBWA 3LJWA 4QSQA 5CQ5A 3VKGA 5CS8A 1N72A 5EWHA 4AKGA 4PCEA 5EICA 4N4FA 4Z1QA 5EI4A 5CRMA 4YYHA 4WHWA 4HXOA 2L85A 4YY6A 4QEVA 4MR5A 5E9IA 5FB1A 4NYVA 2I7KA 4A9IA 5DLZA 4Z6IA 4QEWA 5HENA 4YYKA 4A9JA 5G4RA 4HXKA 3QZTA 5CUEA 4UIZA 4Z6HA 5AD3A 5ENEA 4O7BA 5E9VA 4YYNA 4UYGA 5EP7A 4YBTA 5I7YA 5BT3A 4NRBA 5FFWA 5EQ1A 5LKTA 5E9LA 4HBVA 4XUBA 5D24A 2YW5A 5FFYA 4YBMA 4PY6A 4BW4A 5F3AA 2E3KA 2DATA 5A5OA 4C66A 4KCXA 3ERRA 3GG3A 4X2IA 4CFKA 4YABA 5IGLA 2WP1A 5DYAA 4J1PA 4ALGA 4MEPA 5D3HA 5DKDA 2KTBB 4UYFA 4IOOA 2E7OA 5AMEA 5CUDA 4NR7A 4QSVA 2E7NA 3JVJA 2OO1A 5CQ6A 4PKLA 5IG6A 4IR4A 5HLSA 2YDWA 4CL9A 5F61A 3U5MA 3U5KA 2WP2A 5HQ6A 4A9OA 1ZS5A 2RNXA 3FKMX 4IORA 2D9EA 3RCWA 4QUUA 5LVQA 4A9KA 4XY8A 5CQ8A 4CUQA 5ENCA 5EV9A 4NXJA 5EU1A 5E7DA 4J0RA 4NRAA 4LRGA 5D3JA 4YYGA 4IR6A 4UIWA 5DKCA 2FSAA 5EWWA 2DVSA 3U5LA 4O7CA 4Q0NA 5JI8A 4NS5A 4QSRA 5FE8A 4NQNA 5ETBA 1EQFA 1WUMA 4LZRA 5DYXA 5IIDA 5A5NA 3S92A 5FH8A 4YYIA 5I1QA 3LXJA 5IGKA 1WUGA 4PTBA 5II1A
chains in the Genus database with same CATH topology
5CQTA 5FFVA 4XY9A 4LZ2A 2N9GA 3O36A 4MR6A 5ENHA 4MR4A 3UV2A 4YK0A 5A5QA 5CFWA 5LKUA 5D25A 3HMFA 5ENGA 2I8NA 4N4HA 4WIVA 3U5PA 4CFLA 4O74A 5C8GA 4LC2A 4TS8A 4QEUA 4O7AA 5F25A 5F1HA 5D3LA 5LUUA 3P1CA 5CUBA 2DWWA 4O76A 5E73A 4ZQLA 4YYMA 2RS9B 4CUPA 4HXRA 5DYCA 5D3NA 3AQAA 5L8UA 4ZC9A 3IU6A 5KO4A 4TYLA 4DONA 3U5OA 4HXMA 5CU8A 5DFCA 4IR5A 5CQ3A 4QSWA 5DX4A 4O72A 5L99A 3MB3A 5I80A 5LVRA 3P5OA 5F62A 5AMFA 5HELA 3MULA 2L5EA 4HXSA 4LYSA 5D3PA 5D3SA 4YC9A 4LZSA 2YEKA 4CLBA 4NUEA 4UIVA 5DW1A 5FE0A 3SVHA 3O35A 1JM4B 5FE6A 5IBNA 1F68A 3ZYUA 5F63A 5L97A 4NRCA 5C89A 3JVMA 4YY4A 5CRZA 5ACYA 4YYDA 4MR3A 5CGPA 3LQJA 2R0VA 5D3RA 5FH7A 4O7EA 4QSPA 4QR5A 4QYDA 5F36A 5EPRA 5C87A 3MUKA 5F5ZA 5E9YA 2DVRA 2G4AA 4N3WA 4BHWA 5E3GA 5E9MA 5DKHA 5HRVA 5HFQA 4IR3A 4GPJA 4J0SA 5DYUA 5FG4A 5KTXA 5ENFA 5CQ4A 4NR5A 4NQMA 4FLPA 4QR4A 3TLPA 5L8TA 2D82A 5KU3A 4IOQA 4YBSA 4QUTA 2LSPB 4QSUA 3P1DA 4YATA 4O75A 4XUAA 4UYEA 2R0SA 5H1UA 5A5PA 3O37A 4E96A 3QZSA 3QZVA 2RFJA 3O34A 4TT2A 4KV4A 5CUGA 4BW3A 5C85A 3AADA 5C4QA 3MB4A 5FE4A 3MXFA 4A9HA 4UITA 5EM3A 4QY4A 3LQIA 3NXBA 4O77A 5FDZA 5CUAA 4MEOA 5A82A 3G0JA 5F2PA 5FE1A 4Z1SA 4N4IA 5I88A 4MEQA 5HQ7A 3IU5A 3D7CA 4HXLA 3UV5A 4YH4A 4PCIA 5FE5A 4QC3A 4NYXA 2YYNA 5EVAA 5L96A 5L98A 5E9KA 4J3IA 4ALHA 4OUFA 4LYWA 3UW9A 4UYDA 3K2JA 5F1LA 5FH6A 5DLXA 5E74A 1E6IA 4YH3A 3SVGA 4UIUA 3G0LA 4CUTA 5FE7A 5LKXA 4A9NA 4AKNA 3I3JA 4RVRA 2MJVB 5IGMA 5A81A 4O78A 4WHUA 4BJXA 5CPEA 5COIA 3DWYA 4HXNA 3U5JA 5I83A 3UVDA 4A9FA 4QR3A 3MQMA 4LDFA 4TZ8A 4CUSA 5J0DA 5TB6A 4QYLA 4TT6A 4TZ2A 4YAXA 4BW1A 3P1FA 5FE9A 5HEMA 5A83A 4Y03A 5LJ1A 5CP5A 2RO1A 4MENA 4QC1A 2YELA 4YADA 5D3TA 4UYFB 5AD2A 5KHMA 4OGJA 5IGNA 3LQHA 5LKZA 5D7XA 5H1VA 5ENIA 5TCMA 2RI7A 5HFRA 4O7FA 5EWCA 2H60A 2RNYA 5CTLA 4N4GA 5DFDA 3Q2FA 5EK9A 3O33A 5FB0A 3UVYA 2DVQA 4ZW1A 4C67A 1X0JA 4QNSA 5DW2A 4CUUA 4TU4A 4BW2A 4O71A 4TT4A 5CY9A 2R10A 2OUOA 4PS5A 5EISA 4TU6A 4CURA 4TTEA 2OSSA 2NXBA 4QB3A 5EA1A 4LYIA 4TQNA 5LJ2A 3JVKA 1JSPB 2R0YA 5DFBA 2YEMA 5FG5A 5F60A 5I86A 5HRWA 4QSXA 5HRXA 4XYAA 4OGIA 5EWDA 5EGUA 5KTUA 5H1TA 3U5NA 4LR6A 4Q0OA 5FBXA 5G4SA 5A5RA 4O70A 2DKWA 4NUDA 5HQ5A 3UVWA 5DY7A 4HXPA 4NR9A 5HCLA 2L84A 3Q2EA 5I29A 5ENJA 5CUCA 2F6NA 5II2A 3JVLA 5CQAA 2F6JA 3HMEA 2YQDA 5JWMA 4HBXA 5DBMA 5E0RA 5D26A 5D0CA 5CQ7A 5A7CA 4UYHA 5HJCA 4QZSA 3UVXA 4QSSA 3DAIA 3SVFA 5BT5A 5FE2A 4UIYA 5ENBA 4NUCA 5K29A 3S91A 4HBYA 5EPBA 5A5SA 4KV1A 5HM0A 3UV4A 5KTWA 5C7NA 3ONIA 4F3IA 5LJ0A 2DVVA 5CZGA 4YYJA 2GRCA 5EPSA 4A9MA 3HMHA 4UIXA 5FE3A 4NR6A 5A85A 5BT4A 4A9EA 4NR4A 2RNWA 4Z93A 5I89A 4A9LA 5ETDA 3P1EA 5E3DA 5FG6A 5I40A 4QBMA 5EWVA 5H85A 4NR8A 4NYWA 4QSTA 5I7XA 4HBWA 3LJWA 4QSQA 5CQ5A 5CS8A 1N72A 5EWHA 4PCEA 5EICA 4N4FA 4Z1QA 5EI4A 5CRMA 4YYHA 4WHWA 4HXOA 2L85A 4YY6A 4QEVA 4MR5A 5E9IA 5FB1A 4NYVA 2I7KA 4A9IA 5DLZA 4Z6IA 4QEWA 5HENA 4YYKA 4A9JA 5G4RA 4HXKA 3QZTA 5CUEA 4UIZA 4Z6HA 5AD3A 5ENEA 4O7BA 5E9VA 4YYNA 4UYGA 5EP7A 4YBTA 5I7YA 5BT3A 4NRBA 5FFWA 5EQ1A 5LKTA 5E9LA 4HBVA 4XUBA 5D24A 2YW5A 5FFYA 4YBMA 4PY6A 4BW4A 5F3AA 2E3KA 2DATA 5A5OA 4C66A 4KCXA 3GG3A 4CFKA 4X2IA 4YABA 5IGLA 2WP1A 5DYAA 4J1PA 4ALGA 4MEPA 5D3HA 5DKDA 2KTBB 4UYFA 4IOOA 2E7OA 5AMEA 5CUDA 4NR7A 4QSVA 2E7NA 3JVJA 2OO1A 5CQ6A 4PKLA 5IG6A 4IR4A 5HLSA 2YDWA 4CL9A 5F61A 3U5MA 3U5KA 2WP2A 5HQ6A 4A9OA 1ZS5A 2RNXA 3FKMX 4IORA 2D9EA 3RCWA 4QUUA 5LVQA 4A9KA 4XY8A 5CQ8A 4CUQA 5ENCA 5EV9A 4NXJA 5EU1A 5E7DA 4J0RA 4NRAA 4LRGA 5D3JA 4YYGA 4IR6A 4UIWA 5DKCA 2FSAA 5EWWA 2DVSA 3U5LA 4O7CA 4Q0NA 5JI8A 4NS5A 4QSRA 5FE8A 4NQNA 5ETBA 1WUMA 1EQFA 4LZRA 5DYXA 5IIDA 5A5NA 3S92A 5FH8A 4YYIA 5I1QA 3LXJA 5IGKA 1WUGA 4PTBA 5II1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQT A;  5FFV A;  4XY9 A;  4LZ2 A;  2N9G A;  3O36 A;  4MR6 A;  5ENH A;  4MR4 A;  3UV2 A;  4YK0 A;  5A5Q A;  5CFW A;  5LKU A;  5D25 A;  3HMF A;  5ENG A;  2I8N A;  4N4H A;  4WIV A;  3U5P A;  4CFL A;  4O74 A;  5C8G A;  4LC2 A;  4TS8 A;  4QEU A;  4O7A A;  5F25 A;  5F1H A;  5D3L A;  5LUU A;  3P1C A;  5CUB A;  2DWW A;  4O76 A;  5E73 A;  4ZQL A;  4YYM A;  2RS9 B;  4CUP A;  4HXR A;  5DYC A;  5D3N A;  3AQA A;  5L8U A;  4ZC9 A;  3IU6 A;  5KO4 A;  4TYL A;  4DON A;  3U5O A;  4HXM A;  5CU8 A;  5DFC A;  4IR5 A;  5CQ3 A;  4QSW A;  5DX4 A;  4O72 A;  5L99 A;  3MB3 A;  5I80 A;  5LVR A;  3P5O A;  5F62 A;  5AMF A;  5HEL A;  3MUL A;  2L5E A;  4HXS A;  4LYS A;  5D3P A;  5D3S A;  4YC9 A;  4LZS A;  2YEK A;  4CLB A;  4NUE A;  4UIV A;  5DW1 A;  5FE0 A;  3SVH A;  3O35 A;  1JM4 B;  5FE6 A;  5IBN A;  1F68 A;  3ZYU A;  5F63 A;  5L97 A;  4NRC A;  5C89 A;  3JVM A;  4YY4 A;  5CRZ A;  5ACY A;  4YYD A;  4MR3 A;  5CGP A;  3LQJ A;  2R0V A;  5D3R A;  5FH7 A;  4O7E A;  4QSP A;  4QR5 A;  4QYD A;  5F36 A;  5EPR A;  5C87 A;  3MUK A;  5F5Z A;  5E9Y A;  2DVR A;  2G4A A;  4N3W A;  4BHW A;  5E3G A;  5E9M A;  5DKH A;  5HRV A;  5HFQ A;  4IR3 A;  4GPJ A;  4J0S A;  5DYU A;  5FG4 A;  5KTX A;  5ENF A;  5CQ4 A;  4NR5 A;  4NQM A;  4FLP A;  4QR4 A;  3TLP A;  5L8T A;  2D82 A;  5KU3 A;  4IOQ A;  4YBS A;  4QUT A;  2LSP B;  4QSU A;  3P1D A;  4YAT A;  4O75 A;  4XUA A;  4UYE A;  2R0S A;  5H1U A;  5A5P A;  3O37 A;  4E96 A;  3QZS A;  3QZV A;  2RFJ A;  3O34 A;  4TT2 A;  4KV4 A;  5CUG A;  4BW3 A;  5C85 A;  3AAD A;  5C4Q A;  3MB4 A;  5FE4 A;  3MXF A;  4A9H A;  4UIT A;  5EM3 A;  4QY4 A;  3LQI A;  3NXB A;  4O77 A;  5FDZ A;  5CUA A;  4MEO A;  5A82 A;  3G0J A;  5F2P A;  5FE1 A;  4Z1S A;  4N4I A;  5I88 A;  4MEQ A;  5HQ7 A;  3IU5 A;  3D7C A;  4HXL A;  3UV5 A;  4YH4 A;  4PCI A;  5FE5 A;  4QC3 A;  4NYX A;  2YYN A;  5EVA A;  5L96 A;  5L98 A;  5E9K A;  4J3I A;  4ALH A;  4OUF A;  4LYW A;  3UW9 A;  4UYD A;  3K2J A;  5F1L A;  5FH6 A;  5DLX A;  5E74 A;  1E6I A;  4YH3 A;  3SVG A;  4UIU A;  3G0L A;  4CUT A;  5FE7 A;  5LKX A;  4A9N A;  4AKN A;  3I3J A;  4RVR A;  2MJV B;  5IGM A;  5A81 A;  4O78 A;  4WHU A;  4BJX A;  5CPE A;  5COI A;  3DWY A;  4HXN A;  3U5J A;  5I83 A;  3UVD A;  4A9F A;  4QR3 A;  3MQM A;  4LDF A;  4TZ8 A;  4CUS A;  5J0D A;  5TB6 A;  4QYL A;  4TT6 A;  4TZ2 A;  4YAX A;  4BW1 A;  3P1F A;  5FE9 A;  5HEM A;  5A83 A;  4Y03 A;  5LJ1 A;  5CP5 A;  2RO1 A;  4MEN A;  4QC1 A;  2YEL A;  4YAD A;  5D3T A;  4UYF B;  5AD2 A;  5KHM A;  4OGJ A;  5IGN A;  3LQH A;  5LKZ A;  5D7X A;  5H1V A;  5ENI A;  5TCM A;  2RI7 A;  5HFR A;  4O7F A;  5EWC A;  2H60 A;  2RNY A;  5CTL A;  4N4G A;  5DFD A;  3Q2F A;  5EK9 A;  3O33 A;  5FB0 A;  3UVY A;  2DVQ A;  4ZW1 A;  4C67 A;  1X0J A;  4QNS A;  5DW2 A;  4CUU A;  4TU4 A;  4BW2 A;  4O71 A;  4TT4 A;  5CY9 A;  2R10 A;  2OUO A;  4PS5 A;  5EIS A;  4TU6 A;  4CUR A;  4TTE A;  2OSS A;  2NXB A;  4QB3 A;  5EA1 A;  4LYI A;  4TQN A;  5LJ2 A;  3JVK A;  1JSP B;  2R0Y A;  5DFB A;  2YEM A;  5FG5 A;  5F60 A;  5I86 A;  5HRW A;  4QSX A;  5HRX A;  4XYA A;  4OGI A;  5EWD A;  5EGU A;  5KTU A;  5H1T A;  3U5N A;  4LR6 A;  4Q0O A;  5FBX A;  5G4S A;  5A5R A;  4O70 A;  2DKW A;  4NUD A;  5HQ5 A;  3UVW A;  5DY7 A;  4HXP A;  4NR9 A;  5HCL A;  2L84 A;  3Q2E A;  5I29 A;  5ENJ A;  5CUC A;  2F6N A;  5II2 A;  3JVL A;  5CQA A;  2F6J A;  3HME A;  2YQD A;  5JWM A;  4HBX A;  5DBM A;  5E0R A;  5D26 A;  5D0C A;  5CQ7 A;  5A7C A;  4UYH A;  5HJC A;  4QZS A;  3UVX A;  4QSS A;  3DAI A;  3SVF A;  5BT5 A;  5FE2 A;  4UIY A;  5ENB A;  4NUC A;  5K29 A;  3S91 A;  4HBY A;  5EPB A;  5A5S A;  4KV1 A;  5HM0 A;  3UV4 A;  5KTW A;  5C7N A;  3ONI A;  4F3I A;  5LJ0 A;  2DVV A;  5CZG A;  4YYJ A;  2GRC A;  5EPS A;  4A9M A;  3HMH A;  4UIX A;  5FE3 A;  4NR6 A;  5A85 A;  5BT4 A;  4A9E A;  4NR4 A;  2RNW A;  4Z93 A;  5I89 A;  4A9L A;  5ETD A;  3P1E A;  5E3D A;  5FG6 A;  5I40 A;  4QBM A;  5EWV A;  5H85 A;  4NR8 A;  4NYW A;  4QST A;  5I7X A;  4HBW A;  3LJW A;  4QSQ A;  5CQ5 A;  5CS8 A;  1N72 A;  5EWH A;  4PCE A;  5EIC A;  4N4F A;  4Z1Q A;  5EI4 A;  5CRM A;  4YYH A;  4WHW A;  4HXO A;  2L85 A;  4YY6 A;  4QEV A;  4MR5 A;  5E9I A;  5FB1 A;  4NYV A;  2I7K A;  4A9I A;  5DLZ A;  4Z6I A;  4QEW A;  5HEN A;  4YYK A;  4A9J A;  5G4R A;  4HXK A;  3QZT A;  5CUE A;  4UIZ A;  4Z6H A;  5AD3 A;  5ENE A;  4O7B A;  5E9V A;  4YYN A;  4UYG A;  5EP7 A;  4YBT A;  5I7Y A;  5BT3 A;  4NRB A;  5FFW A;  5EQ1 A;  5LKT A;  5E9L A;  4HBV A;  4XUB A;  5D24 A;  2YW5 A;  5FFY A;  4YBM A;  4PY6 A;  4BW4 A;  5F3A A;  2E3K A;  2DAT A;  5A5O A;  4C66 A;  4KCX A;  3GG3 A;  4CFK A;  4X2I A;  4YAB A;  5IGL A;  2WP1 A;  5DYA A;  4J1P A;  4ALG A;  4MEP A;  5D3H A;  5DKD A;  2KTB B;  4UYF A;  4IOO A;  2E7O A;  5AME A;  5CUD A;  4NR7 A;  4QSV A;  2E7N A;  3JVJ A;  2OO1 A;  5CQ6 A;  4PKL A;  5IG6 A;  4IR4 A;  5HLS A;  2YDW A;  4CL9 A;  5F61 A;  3U5M A;  3U5K A;  2WP2 A;  5HQ6 A;  4A9O A;  1ZS5 A;  2RNX A;  3FKM X;  4IOR A;  2D9E A;  3RCW A;  4QUU A;  5LVQ A;  4A9K A;  4XY8 A;  5CQ8 A;  4CUQ A;  5ENC A;  5EV9 A;  4NXJ A;  5EU1 A;  5E7D A;  4J0R A;  4NRA A;  4LRG A;  5D3J A;  4YYG A;  4IR6 A;  4UIW A;  5DKC A;  2FSA A;  5EWW A;  2DVS A;  3U5L A;  4O7C A;  4Q0N A;  5JI8 A;  4NS5 A;  4QSR A;  5FE8 A;  4NQN A;  5ETB A;  1WUM A;  1EQF A;  4LZR A;  5DYX A;  5IID A;  5A5N A;  3S92 A;  5FH8 A;  4YYI A;  5I1Q A;  3LXJ A;  5IGK A;  1WUG A;  4PTB A;  5II1 A; 
#chains in the Genus database with same CATH topology
 5CQT A;  5FFV A;  4XY9 A;  4LZ2 A;  2N9G A;  3O36 A;  4MR6 A;  5ENH A;  4MR4 A;  3UV2 A;  4YK0 A;  5A5Q A;  5CFW A;  5LKU A;  5D25 A;  3HMF A;  5ENG A;  2I8N A;  4N4H A;  4WIV A;  3U5P A;  4CFL A;  4O74 A;  5C8G A;  4LC2 A;  4TS8 A;  4QEU A;  3VKH A;  4O7A A;  5F25 A;  5F1H A;  5D3L A;  5LUU A;  3P1C A;  5CUB A;  2DWW A;  4O76 A;  5E73 A;  4ZQL A;  4YYM A;  2RS9 B;  4CUP A;  4HXR A;  5DYC A;  5D3N A;  3AQA A;  5L8U A;  4ZC9 A;  3IU6 A;  5KO4 A;  4TYL A;  4DON A;  3U5O A;  4HXM A;  5CU8 A;  5DFC A;  4IR5 A;  5CQ3 A;  4QSW A;  5DX4 A;  4O72 A;  5L99 A;  3MB3 A;  5I80 A;  5LVR A;  3P5O A;  5F62 A;  5AMF A;  5HEL A;  3MUL A;  2L5E A;  4HXS A;  4LYS A;  5D3P A;  5D3S A;  4YC9 A;  4LZS A;  2YEK A;  4CLB A;  4NUE A;  4UIV A;  5DW1 A;  5FE0 A;  3SVH A;  3O35 A;  1JM4 B;  5FE6 A;  5IBN A;  1F68 A;  3ZYU A;  5F63 A;  5L97 A;  4NRC A;  5C89 A;  3JVM A;  4YY4 A;  5CRZ A;  5ACY A;  4YYD A;  4MR3 A;  5CGP A;  3LQJ A;  2R0V A;  5D3R A;  5FH7 A;  4O7E A;  4QSP A;  4QR5 A;  4QYD A;  5F36 A;  5EPR A;  5C87 A;  3MUK A;  5F5Z A;  5E9Y A;  2DVR A;  2G4A A;  4N3W A;  4BHW A;  5E3G A;  5E9M A;  5DKH A;  5HRV A;  5HFQ A;  4IR3 A;  4GPJ A;  4J0S A;  5DYU A;  5FG4 A;  5KTX A;  5ENF A;  5CQ4 A;  4NR5 A;  4NQM A;  4FLP A;  4QR4 A;  3TLP A;  5L8T A;  2D82 A;  2EJN A;  5KU3 A;  4IOQ A;  4YBS A;  4QUT A;  2LSP B;  4QSU A;  1ZKR A;  3P1D A;  4YAT A;  4O75 A;  1PUO A;  4XUA A;  4UYE A;  2R0S A;  5H1U A;  5A5P A;  3O37 A;  4E96 A;  3QZS A;  3QZV A;  2RFJ A;  3O34 A;  4TT2 A;  4KV4 A;  5CUG A;  4BW3 A;  5C85 A;  3AAD A;  5C4Q A;  3MB4 A;  5FE4 A;  3MXF A;  4A9H A;  4UIT A;  5EM3 A;  4QY4 A;  3LQI A;  3NXB A;  4O77 A;  5FDZ A;  5CUA A;  4MEO A;  5A82 A;  3G0J A;  5F2P A;  5FE1 A;  3D1B A;  4Z1S A;  4N4I A;  5I88 A;  4AI6 A;  4MEQ A;  5HQ7 A;  3IU5 A;  3D7C A;  4HXL A;  3UV5 A;  4YH4 A;  4PCI A;  5FE5 A;  4QC3 A;  4NYX A;  2YYN A;  5EVA A;  5L96 A;  5L98 A;  5E9K A;  4AKI A;  4J3I A;  4ALH A;  4OUF A;  4LYW A;  3UW9 A;  4UYD A;  3K2J A;  5F1L A;  5FH6 A;  5DLX A;  5E74 A;  1E6I A;  4YH3 A;  3SVG A;  4UIU A;  3G0L A;  4CUT A;  5FE7 A;  5LKX A;  4A9N A;  4AKN A;  3I3J A;  4RVR A;  2MJV B;  5IGM A;  5A81 A;  4O78 A;  4WHU A;  4BJX A;  5CPE A;  5COI A;  3DWY A;  4HXN A;  3U5J A;  5I83 A;  3UVD A;  4A9F A;  4QR3 A;  3MQM A;  4LDF A;  4TZ8 A;  4CUS A;  5J0D A;  5TB6 A;  4QYL A;  4TT6 A;  4TZ2 A;  4YAX A;  4BW1 A;  3P1F A;  5FE9 A;  5HEM A;  5A83 A;  4Y03 A;  5LJ1 A;  5CP5 A;  2RO1 A;  4MEN A;  4QC1 A;  2YEL A;  4YAD A;  5D3T A;  4UYF B;  5AD2 A;  5KHM A;  4OGJ A;  5IGN A;  3LQH A;  5LKZ A;  5D7X A;  5H1V A;  5ENI A;  5TCM A;  2RI7 A;  5HFR A;  4O7F A;  5EWC A;  2H60 A;  2RNY A;  5CTL A;  4N4G A;  5DFD A;  3Q2F A;  5EK9 A;  3O33 A;  5FB0 A;  3UVY A;  2DVQ A;  4ZW1 A;  4C67 A;  1X0J A;  4AKH A;  4QNS A;  5DW2 A;  4CUU A;  4TU4 A;  4BW2 A;  4O71 A;  4TT4 A;  5CY9 A;  2R10 A;  2OUO A;  4PS5 A;  5EIS A;  4TU6 A;  4CUR A;  4TTE A;  2OSS A;  2NXB A;  4QB3 A;  5EA1 A;  4LYI A;  4TQN A;  5LJ2 A;  3JVK A;  1JSP B;  2R0Y A;  5DFB A;  2YEM A;  5FG5 A;  5F60 A;  5I86 A;  5HRW A;  4QSX A;  5HRX A;  4XYA A;  4OGI A;  5EWD A;  5EGU A;  5KTU A;  5H1T A;  3U5N A;  4LR6 A;  4Q0O A;  5FBX A;  5G4S A;  5A5R A;  4O70 A;  2DKW A;  4NUD A;  5HQ5 A;  3UVW A;  5DY7 A;  4HXP A;  4NR9 A;  5HCL A;  2L84 A;  3Q2E A;  5I29 A;  5ENJ A;  5CUC A;  2F6N A;  5II2 A;  3JVL A;  5CQA A;  2F6J A;  3HME A;  2YQD A;  5JWM A;  4HBX A;  5DBM A;  5E0R A;  5D26 A;  5D0C A;  5CQ7 A;  5A7C A;  4UYH A;  5HJC A;  4QZS A;  3UVX A;  4QSS A;  3DAI A;  3SVF A;  5BT5 A;  5FE2 A;  4UIY A;  5ENB A;  4NUC A;  5K29 A;  3S91 A;  4HBY A;  5EPB A;  5A5S A;  4KV1 A;  5HM0 A;  3UV4 A;  5KTW A;  5C7N A;  3ONI A;  4F3I A;  5LJ0 A;  2DVV A;  5CZG A;  4YYJ A;  2GRC A;  5EPS A;  4A9M A;  3HMH A;  4UIX A;  5FE3 A;  4NR6 A;  5A85 A;  5BT4 A;  4A9E A;  4NR4 A;  2RNW A;  4Z93 A;  5I89 A;  4A9L A;  5ETD A;  3P1E A;  5E3D A;  5FG6 A;  3D1D A;  4QBM A;  5I40 A;  5EWV A;  5H85 A;  4NR8 A;  4NYW A;  4QST A;  5I7X A;  4HBW A;  3LJW A;  4QSQ A;  5CQ5 A;  3VKG A;  5CS8 A;  1N72 A;  5EWH A;  4AKG A;  4PCE A;  5EIC A;  4N4F A;  4Z1Q A;  5EI4 A;  5CRM A;  4YYH A;  4WHW A;  4HXO A;  2L85 A;  4YY6 A;  4QEV A;  4MR5 A;  5E9I A;  5FB1 A;  4NYV A;  2I7K A;  4A9I A;  5DLZ A;  4Z6I A;  4QEW A;  5HEN A;  4YYK A;  4A9J A;  5G4R A;  4HXK A;  3QZT A;  5CUE A;  4UIZ A;  4Z6H A;  5AD3 A;  5ENE A;  4O7B A;  5E9V A;  4YYN A;  4UYG A;  5EP7 A;  4YBT A;  5I7Y A;  5BT3 A;  4NRB A;  5FFW A;  5EQ1 A;  5LKT A;  5E9L A;  4HBV A;  4XUB A;  5D24 A;  2YW5 A;  5FFY A;  4YBM A;  4PY6 A;  4BW4 A;  5F3A A;  2E3K A;  2DAT A;  5A5O A;  4C66 A;  4KCX A;  3ERR A;  3GG3 A;  4X2I A;  4CFK A;  4YAB A;  5IGL A;  2WP1 A;  5DYA A;  4J1P A;  4ALG A;  4MEP A;  5D3H A;  5DKD A;  2KTB B;  4UYF A;  4IOO A;  2E7O A;  5AME A;  5CUD A;  4NR7 A;  4QSV A;  2E7N A;  3JVJ A;  2OO1 A;  5CQ6 A;  4PKL A;  5IG6 A;  4IR4 A;  5HLS A;  2YDW A;  4CL9 A;  5F61 A;  3U5M A;  3U5K A;  2WP2 A;  5HQ6 A;  4A9O A;  1ZS5 A;  2RNX A;  3FKM X;  4IOR A;  2D9E A;  3RCW A;  4QUU A;  5LVQ A;  4A9K A;  4XY8 A;  5CQ8 A;  4CUQ A;  5ENC A;  5EV9 A;  4NXJ A;  5EU1 A;  5E7D A;  4J0R A;  4NRA A;  4LRG A;  5D3J A;  4YYG A;  4IR6 A;  4UIW A;  5DKC A;  2FSA A;  5EWW A;  2DVS A;  3U5L A;  4O7C A;  4Q0N A;  5JI8 A;  4NS5 A;  4QSR A;  5FE8 A;  4NQN A;  5ETB A;  1EQF A;  1WUM A;  4LZR A;  5DYX A;  5IID A;  5A5N A;  3S92 A;  5FH8 A;  4YYI A;  5I1Q A;  3LXJ A;  5IGK A;  1WUG A;  4PTB A;  5II1 A; 
#chains in the Genus database with same CATH homology
 5CQT A;  5FFV A;  4XY9 A;  4LZ2 A;  2N9G A;  3O36 A;  4MR6 A;  5ENH A;  4MR4 A;  3UV2 A;  4YK0 A;  5A5Q A;  5CFW A;  5LKU A;  5D25 A;  3HMF A;  5ENG A;  2I8N A;  4N4H A;  4WIV A;  3U5P A;  4CFL A;  4O74 A;  5C8G A;  4LC2 A;  4TS8 A;  4QEU A;  4O7A A;  5F25 A;  5F1H A;  5D3L A;  5LUU A;  3P1C A;  5CUB A;  2DWW A;  4O76 A;  5E73 A;  4ZQL A;  4YYM A;  2RS9 B;  4CUP A;  4HXR A;  5DYC A;  5D3N A;  3AQA A;  5L8U A;  4ZC9 A;  3IU6 A;  5KO4 A;  4TYL A;  4DON A;  3U5O A;  4HXM A;  5CU8 A;  5DFC A;  4IR5 A;  5CQ3 A;  4QSW A;  5DX4 A;  4O72 A;  5L99 A;  3MB3 A;  5I80 A;  5LVR A;  3P5O A;  5F62 A;  5AMF A;  5HEL A;  3MUL A;  2L5E A;  4HXS A;  4LYS A;  5D3P A;  5D3S A;  4YC9 A;  4LZS A;  2YEK A;  4CLB A;  4NUE A;  4UIV A;  5DW1 A;  5FE0 A;  3SVH A;  3O35 A;  1JM4 B;  5FE6 A;  5IBN A;  1F68 A;  3ZYU A;  5F63 A;  5L97 A;  4NRC A;  5C89 A;  3JVM A;  4YY4 A;  5CRZ A;  5ACY A;  4YYD A;  4MR3 A;  5CGP A;  3LQJ A;  2R0V A;  5D3R A;  5FH7 A;  4O7E A;  4QSP A;  4QR5 A;  4QYD A;  5F36 A;  5EPR A;  5C87 A;  3MUK A;  5F5Z A;  5E9Y A;  2DVR A;  2G4A A;  4N3W A;  4BHW A;  5E3G A;  5E9M A;  5DKH A;  5HRV A;  5HFQ A;  4IR3 A;  4GPJ A;  4J0S A;  5DYU A;  5FG4 A;  5KTX A;  5ENF A;  5CQ4 A;  4NR5 A;  4NQM A;  4FLP A;  4QR4 A;  3TLP A;  5L8T A;  2D82 A;  5KU3 A;  4IOQ A;  4YBS A;  4QUT A;  2LSP B;  4QSU A;  3P1D A;  4YAT A;  4O75 A;  4XUA A;  4UYE A;  2R0S A;  5H1U A;  5A5P A;  3O37 A;  4E96 A;  3QZS A;  3QZV A;  2RFJ A;  3O34 A;  4TT2 A;  4KV4 A;  5CUG A;  4BW3 A;  5C85 A;  3AAD A;  5C4Q A;  3MB4 A;  5FE4 A;  3MXF A;  4A9H A;  4UIT A;  5EM3 A;  4QY4 A;  3LQI A;  3NXB A;  4O77 A;  5FDZ A;  5CUA A;  4MEO A;  5A82 A;  3G0J A;  5F2P A;  5FE1 A;  4Z1S A;  4N4I A;  5I88 A;  4MEQ A;  5HQ7 A;  3IU5 A;  3D7C A;  4HXL A;  3UV5 A;  4YH4 A;  4PCI A;  5FE5 A;  4QC3 A;  4NYX A;  2YYN A;  5EVA A;  5L96 A;  5L98 A;  5E9K A;  4J3I A;  4ALH A;  4OUF A;  4LYW A;  3UW9 A;  4UYD A;  3K2J A;  5F1L A;  5FH6 A;  5DLX A;  5E74 A;  1E6I A;  4YH3 A;  3SVG A;  4UIU A;  3G0L A;  4CUT A;  5FE7 A;  5LKX A;  4A9N A;  4AKN A;  3I3J A;  4RVR A;  2MJV B;  5IGM A;  5A81 A;  4O78 A;  4WHU A;  4BJX A;  5CPE A;  5COI A;  3DWY A;  4HXN A;  3U5J A;  5I83 A;  3UVD A;  4A9F A;  4QR3 A;  3MQM A;  4LDF A;  4TZ8 A;  4CUS A;  5J0D A;  5TB6 A;  4QYL A;  4TT6 A;  4TZ2 A;  4YAX A;  4BW1 A;  3P1F A;  5FE9 A;  5HEM A;  5A83 A;  4Y03 A;  5LJ1 A;  5CP5 A;  2RO1 A;  4MEN A;  4QC1 A;  2YEL A;  4YAD A;  5D3T A;  4UYF B;  5AD2 A;  5KHM A;  4OGJ A;  5IGN A;  3LQH A;  5LKZ A;  5D7X A;  5H1V A;  5ENI A;  5TCM A;  2RI7 A;  5HFR A;  4O7F A;  5EWC A;  2H60 A;  2RNY A;  5CTL A;  4N4G A;  5DFD A;  3Q2F A;  5EK9 A;  3O33 A;  5FB0 A;  3UVY A;  2DVQ A;  4ZW1 A;  4C67 A;  1X0J A;  4QNS A;  5DW2 A;  4CUU A;  4TU4 A;  4BW2 A;  4O71 A;  4TT4 A;  5CY9 A;  2R10 A;  2OUO A;  4PS5 A;  5EIS A;  4TU6 A;  4CUR A;  4TTE A;  2OSS A;  2NXB A;  4QB3 A;  5EA1 A;  4LYI A;  4TQN A;  5LJ2 A;  3JVK A;  1JSP B;  2R0Y A;  5DFB A;  2YEM A;  5FG5 A;  5F60 A;  5I86 A;  5HRW A;  4QSX A;  5HRX A;  4XYA A;  4OGI A;  5EWD A;  5EGU A;  5KTU A;  5H1T A;  3U5N A;  4LR6 A;  4Q0O A;  5FBX A;  5G4S A;  5A5R A;  4O70 A;  2DKW A;  4NUD A;  5HQ5 A;  3UVW A;  5DY7 A;  4HXP A;  4NR9 A;  5HCL A;  2L84 A;  3Q2E A;  5I29 A;  5ENJ A;  5CUC A;  2F6N A;  5II2 A;  3JVL A;  5CQA A;  2F6J A;  3HME A;  2YQD A;  5JWM A;  4HBX A;  5DBM A;  5E0R A;  5D26 A;  5D0C A;  5CQ7 A;  5A7C A;  4UYH A;  5HJC A;  4QZS A;  3UVX A;  4QSS A;  3DAI A;  3SVF A;  5BT5 A;  5FE2 A;  4UIY A;  5ENB A;  4NUC A;  5K29 A;  3S91 A;  4HBY A;  5EPB A;  5A5S A;  4KV1 A;  5HM0 A;  3UV4 A;  5KTW A;  5C7N A;  3ONI A;  4F3I A;  5LJ0 A;  2DVV A;  5CZG A;  4YYJ A;  2GRC A;  5EPS A;  4A9M A;  3HMH A;  4UIX A;  5FE3 A;  4NR6 A;  5A85 A;  5BT4 A;  4A9E A;  4NR4 A;  2RNW A;  4Z93 A;  5I89 A;  4A9L A;  5ETD A;  3P1E A;  5E3D A;  5FG6 A;  5I40 A;  4QBM A;  5EWV A;  5H85 A;  4NR8 A;  4NYW A;  4QST A;  5I7X A;  4HBW A;  3LJW A;  4QSQ A;  5CQ5 A;  5CS8 A;  1N72 A;  5EWH A;  4PCE A;  5EIC A;  4N4F A;  4Z1Q A;  5EI4 A;  5CRM A;  4YYH A;  4WHW A;  4HXO A;  2L85 A;  4YY6 A;  4QEV A;  4MR5 A;  5E9I A;  5FB1 A;  4NYV A;  2I7K A;  4A9I A;  5DLZ A;  4Z6I A;  4QEW A;  5HEN A;  4YYK A;  4A9J A;  5G4R A;  4HXK A;  3QZT A;  5CUE A;  4UIZ A;  4Z6H A;  5AD3 A;  5ENE A;  4O7B A;  5E9V A;  4YYN A;  4UYG A;  5EP7 A;  4YBT A;  5I7Y A;  5BT3 A;  4NRB A;  5FFW A;  5EQ1 A;  5LKT A;  5E9L A;  4HBV A;  4XUB A;  5D24 A;  2YW5 A;  5FFY A;  4YBM A;  4PY6 A;  4BW4 A;  5F3A A;  2E3K A;  2DAT A;  5A5O A;  4C66 A;  4KCX A;  3GG3 A;  4CFK A;  4X2I A;  4YAB A;  5IGL A;  2WP1 A;  5DYA A;  4J1P A;  4ALG A;  4MEP A;  5D3H A;  5DKD A;  2KTB B;  4UYF A;  4IOO A;  2E7O A;  5AME A;  5CUD A;  4NR7 A;  4QSV A;  2E7N A;  3JVJ A;  2OO1 A;  5CQ6 A;  4PKL A;  5IG6 A;  4IR4 A;  5HLS A;  2YDW A;  4CL9 A;  5F61 A;  3U5M A;  3U5K A;  2WP2 A;  5HQ6 A;  4A9O A;  1ZS5 A;  2RNX A;  3FKM X;  4IOR A;  2D9E A;  3RCW A;  4QUU A;  5LVQ A;  4A9K A;  4XY8 A;  5CQ8 A;  4CUQ A;  5ENC A;  5EV9 A;  4NXJ A;  5EU1 A;  5E7D A;  4J0R A;  4NRA A;  4LRG A;  5D3J A;  4YYG A;  4IR6 A;  4UIW A;  5DKC A;  2FSA A;  5EWW A;  2DVS A;  3U5L A;  4O7C A;  4Q0N A;  5JI8 A;  4NS5 A;  4QSR A;  5FE8 A;  4NQN A;  5ETB A;  1WUM A;  1EQF A;  4LZR A;  5DYX A;  5IID A;  5A5N A;  3S92 A;  5FH8 A;  4YYI A;  5I1Q A;  3LXJ A;  5IGK A;  1WUG A;  4PTB A;  5II1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...