4LZ2A

Crystal structure of the bromodomain of human baz2a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
LTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 35
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lz2A00
5ENJA 4PY6A 3QZTA 4LZRA 4QSVA 4YH4A 5D26A 5DX4A 5HENA 5CY9A 5COIA 5LKXA 5ENHA 4WIVA 5DLZA 4O75A 5IBNA 5CU8A 5ETDA 5F60A 4CL9A 5CP5A 2L5EA 5CZGA 5EA1A 4QR5A 4QYDA 5AD2A 5CQ3A 2R10A 2LSPB 4CUSA 3K2JA 2DVRA 4O71A 2RFJA 4O77A 4MEOA 5F3AA 3S91A 2GRCA 2DWWA 5II2A 3IU6A 4PCEA 5CUGA 4LR6A 5CQ5A 5DY7A 2E3KA 4A9OA 2RS9B 3P5OA 4YAXA 3U5KA 4KCXA 5EU1A 4J1PA 5LJ2A 5K29A 5CFWA 5D3HA 4NR4A 5C7NA 2RNYA 4A9LA 4YADA 3O34A 4XY8A 4TT4A 5JWMA 2I7KA 3JVMA 4HBYA 4XYAA 5DYCA 5CPEA 4YY6A 4O72A 5FFVA 5FE5A 5A5SA 4LYSA 5FB1A 4MEQA 3LJWA 3Q2EA 5FE7A 4NYVA 5ETBA 4YBTA 4ALHA 4NR7A 5CUAA 4WHWA 4BW2A 2I8NA 5FFWA 4NS5A 4OUFA 3I3JA 4Z1QA 4MR3A 5LKTA 4Z93A 2L85A 5ENBA 4XUAA 3MUKA 4LDFA 4QZSA 5D7XA 5D3JA 4YABA 4O7BA 4WHUA 5HCLA 4PCIA 5BT4A 5FE6A 4BJXA 4NR5A 3UVWA 4TZ8A 5LKZA 2RO1A 4IOOA 5FFYA 4QSWA 3TLPA 5E9MA 5I89A 4YYHA 3P1EA 5EK9A 5EVAA 5I7YA 3GG3A 5L97A 5KO4A 5F36A 4UYHA 5E7DA 5KU3A 3U5PA 2YEKA 5E3GA 3QZSA 4YK0A 4RVRA 4AKNA 4LZ2A 5H1TA 4A9FA 2L84A 3UV4A 5D3PA 4OGJA 4PTBA 5EICA 2YQDA 3P1DA 5ENGA 1ZS5A 5C89A 1E6IA 4HXSA 5E74A 5EWDA 4YATA 2R0SA 4YY4A 5FE9A 5EGUA 3UV5A 4TS8A 3O33A 2H60A 3AQAA 4YYJA 3Q2FA 4YYKA 5LUUA 5FG5A 4F3IA 3JVLA 5BT3A 2F6NA 3LQIA 5ENEA 1F68A 4LRGA 5D3SA 5EI4A 3O36A 5DKCA 5FH8A 4Z1SA 4NUCA 3SVGA 4BW1A 4A9MA 5A5RA 5LVRA 4BW4A 4Q0OA 5F62A 4N4GA 4IR3A 5CGPA 5FDZA 4O74A 5I80A 5HELA 5LKUA 5DKHA 5CUDA 4HXNA 3G0JA 4NR9A 5LVQA 3U5JA 5A7CA 4X2IA 3U5OA 5FG4A 2RNXA 5IGLA 4N4HA 5ENFA 4CFLA 5ENCA 5EPRA 4Z6HA 5IGMA 5HRVA 2DVQA 3HMHA 5DKDA 4HXLA 3FKMX 5EV9A 4HXMA 4YYIA 5CQAA 3UVDA 4O7AA 5FE4A 5E9LA 5DW1A 4NR8A 2NXBA 3MB4A 3P1CA 5I40A 4YYNA 5HM0A 4HBXA 3ZYUA 5HEMA 5HQ7A 4QUUA 4NUDA 4UIXA 4BHWA 4ZW1A 4QSSA 4C67A 4TT6A 4CUQA 2YDWA 3S92A 3O37A 5CQ6A 4J0RA 4KV4A 4TZ2A 4PS5A 5EWWA 4NYXA 2G4AA 5D3TA 4QEVA 4HXOA 5F1LA 5FB0A 5DYAA 3G0LA 4MR6A 4LYWA 5KHMA 5H1UA 5I1QA 5I83A 3MQMA 4J0SA 4GPJA 4LC2A 5EM3A 4O7FA 4CUUA 5FE2A 3DAIA 5EP7A 2YW5A 3QZVA 2E7NA 4MENA 4N3WA 4QY4A 3UW9A 1EQFA 4A9JA 5D3NA 5IG6A 5CRMA 5E73A 5EWVA 4YC9A 4A9IA 5HLSA 5KTUA 3DWYA 5EWHA 3O35A 4NYWA 4E96A 4Q0NA 4HBWA 4HXPA 2DATA 1X0JA 5E3DA 2WP2A 4ZC9A 4ALGA 3RCWA 2FSAA 4O7CA 3P1FA 4UIWA 4CFKA 1WUGA 4YYDA 3MXFA 5LJ0A 3SVFA 4CUTA 1N72A 4J3IA 3UV2A 2OUOA 2R0YA 3AADA 5IGKA 4QR3A 5F5ZA 5HFRA 5L8UA 5EPBA 2F6JA 5I29A 3LXJA 2D9EA 3MB3A 5I7XA 5H1VA 4QSPA 2E7OA 4IR4A 5CUEA 4UIUA 4A9NA 5EPSA 3HMFA 4TT2A 5CTLA 4ZQLA 4LYIA 5CS8A 5F63A 5C85A 5E9YA 5CQ4A 5TCMA 4O7EA 2DKWA 4MR5A 4TU6A 4O70A 4QC3A 2WP1A 5I88A 4C66A 4NQNA 4NXJA 4QB3A 4QBMA 2OSSA 3SVHA 2YEMA 5E9VA 5A83A 5LJ1A 5A82A 5A5NA 4QEWA 3U5NA 4YBMA 4QR4A 4QSXA 4NR6A 5A5PA 5HJCA 4NRCA 5HRXA 5HFQA 5D0CA 4QSUA 4NQMA 5L8TA 4IR6A 3LQJA 4TU4A 4IR5A 5EQ1A 4UYDA 5DW2A 5J0DA 4MEPA 5D25A 5AMEA 5CQTA 4YYGA 4BW3A 4CLBA 4UYGA 2OO1A 4UYEA 4A9EA 5C8GA 5DYUA 5I86A 2DVSA 5FBXA 4CUPA 5KTWA 5L98A 5G4SA 5H85A 4NUEA 5D24A 4FLPA 4KV1A 4UIVA 4PKLA 3MULA 2N9GA 4IORA 1JSPB 3UVXA 4O76A 5IGNA 2DVVA 5FE1A 5DLXA 4IOQA 5F61A 5A5QA 5CRZA 4N4FA 5F1HA 5EISA 4UYFA 5EWCA 2RNWA 4YYMA 4QC1A 4YBSA 4UIYA 2KTBB 2YYNA 4XY9A 4QSQA 5CQ7A 4LZSA 3JVKA 3HMEA 5A81A 5C87A 4QSRA 4HBVA 4QEUA 5DFCA 5HRWA 4Z6IA 4HXKA 4MR4A 4OGIA 4O78A 5FH6A 5L96A 5IIDA 4QUTA 4Y03A 5DYXA 4NRAA 5F25A 5A85A 2D82A 4TTEA 5DFDA 4A9KA 5II1A 5F2PA 5E0RA 5FG6A 2R0VA 5CQ8A 4N4IA 5A5OA 5AMFA 1WUMA 4CURA 4A9HA 5CUBA 3NXBA 4TQNA 5G4RA 5KTXA 1JM4B 3U5MA 5CUCA 5DFBA 3ONIA 5BT5A 5FE8A 5C4QA 3LQHA 5D3RA 5AD3A 2YELA 3IU5A 4UITA 5DBMA 2MJVB 5E9KA 5TB6A 4HXRA 4XUBA 5FE3A 5ENIA 4UIZA 3JVJA 4QNSA 5L99A 5E9IA 5FH7A 4UYFB 3D7CA 4QSTA 3U5LA 5HQ6A 5HQ5A 3UVYA 4DONA 5D3LA 4YH3A 4NRBA 5ACYA 2RI7A 5FE0A 4QYLA 5JI8A 4TYLA
chains in the Genus database with same CATH superfamily
5ENJA 4PY6A 3QZTA 4LZRA 4QSVA 4YH4A 5D26A 5DX4A 5HENA 5CY9A 5COIA 5LKXA 5ENHA 4WIVA 5DLZA 4O75A 5IBNA 5CU8A 5ETDA 5F60A 4CL9A 5CP5A 2L5EA 5CZGA 5EA1A 4QR5A 4QYDA 5AD2A 5CQ3A 2R10A 2LSPB 4CUSA 3K2JA 2DVRA 4O71A 2RFJA 4O77A 4MEOA 5F3AA 4AKHA 3S91A 2GRCA 2DWWA 5II2A 3IU6A 4PCEA 5CUGA 4LR6A 5CQ5A 5DY7A 2E3KA 4A9OA 2RS9B 3P5OA 4YAXA 3U5KA 4KCXA 5EU1A 4J1PA 5LJ2A 5K29A 5CFWA 5D3HA 4NR4A 5C7NA 2RNYA 4A9LA 4YADA 3O34A 4XY8A 4TT4A 5JWMA 2I7KA 3JVMA 4HBYA 4XYAA 5DYCA 5CPEA 4YY6A 4O72A 5FFVA 5FE5A 5A5SA 4LYSA 5FB1A 4MEQA 3LJWA 3Q2EA 5FE7A 4NYVA 5ETBA 4YBTA 4ALHA 4NR7A 5CUAA 4WHWA 4BW2A 2I8NA 5FFWA 4NS5A 4OUFA 3I3JA 4Z1QA 4MR3A 5LKTA 4Z93A 2L85A 5ENBA 3VKGA 4XUAA 3MUKA 4LDFA 4QZSA 5D7XA 5D3JA 4YABA 4O7BA 4WHUA 5HCLA 4PCIA 5BT4A 5FE6A 4BJXA 4NR5A 3UVWA 4TZ8A 5LKZA 2RO1A 4IOOA 5FFYA 4QSWA 3TLPA 5E9MA 5I89A 4YYHA 3P1EA 5EK9A 5EVAA 5I7YA 3GG3A 5L97A 5KO4A 5F36A 4UYHA 5E7DA 5KU3A 3U5PA 2YEKA 5E3GA 3QZSA 4YK0A 4RVRA 4AKNA 4LZ2A 5H1TA 4A9FA 2L84A 3UV4A 5D3PA 4OGJA 4PTBA 5EICA 2YQDA 3P1DA 5ENGA 1ZS5A 5C89A 1E6IA 4HXSA 5E74A 5EWDA 4YATA 2R0SA 4YY4A 5FE9A 5EGUA 3UV5A 4TS8A 3O33A 2H60A 3AQAA 4YYJA 3ERRA 3Q2FA 4YYKA 5LUUA 5FG5A 4F3IA 3JVLA 5BT3A 2F6NA 3LQIA 5ENEA 1F68A 4LRGA 5D3SA 5EI4A 3O36A 5DKCA 5FH8A 4Z1SA 4NUCA 3SVGA 4BW1A 4A9MA 5A5RA 5LVRA 4BW4A 4Q0OA 5F62A 4N4GA 4IR3A 5CGPA 5FDZA 4O74A 5I80A 5HELA 5LKUA 5DKHA 5CUDA 4HXNA 3G0JA 4NR9A 5LVQA 3U5JA 5A7CA 3VKHA 4X2IA 3U5OA 5FG4A 2RNXA 5IGLA 4N4HA 5ENFA 4CFLA 5ENCA 5EPRA 4Z6HA 5IGMA 5HRVA 2DVQA 3HMHA 5DKDA 4HXLA 3FKMX 5EV9A 4HXMA 4YYIA 5CQAA 1ZKRA 4O7AA 5FE4A 5E9LA 3UVDA 5DW1A 4NR8A 2NXBA 3MB4A 3P1CA 5I40A 4YYNA 5HM0A 4HBXA 3ZYUA 5HEMA 5HQ7A 4QUUA 4NUDA 4UIXA 4BHWA 4ZW1A 4QSSA 4C67A 4TT6A 4CUQA 2YDWA 3S92A 3O37A 5CQ6A 4J0RA 4KV4A 4TZ2A 4PS5A 5EWWA 4NYXA 2G4AA 5D3TA 4QEVA 4HXOA 5F1LA 5FB0A 5DYAA 3G0LA 4MR6A 4LYWA 5KHMA 5H1UA 5I1QA 5I83A 3MQMA 4J0SA 4GPJA 4LC2A 5EM3A 4O7FA 4CUUA 5FE2A 3DAIA 5EP7A 2YW5A 3QZVA 2E7NA 4MENA 4N3WA 4QY4A 3UW9A 1EQFA 4A9JA 5D3NA 5IG6A 5CRMA 5E73A 5EWVA 4YC9A 4A9IA 5HLSA 5KTUA 3DWYA 5EWHA 3O35A 4NYWA 4E96A 4Q0NA 4HBWA 1PUOA 4HXPA 2DATA 1X0JA 5E3DA 2WP2A 3D1DA 4ZC9A 4ALGA 3RCWA 2FSAA 4O7CA 3P1FA 4UIWA 4CFKA 1WUGA 4YYDA 3MXFA 5LJ0A 2EJNA 3SVFA 4CUTA 1N72A 4J3IA 3UV2A 2OUOA 2R0YA 3AADA 5IGKA 4QR3A 5F5ZA 5HFRA 5L8UA 5EPBA 2F6JA 5I29A 3LXJA 2D9EA 3MB3A 5I7XA 5H1VA 4QSPA 2E7OA 4IR4A 5CUEA 4UIUA 4A9NA 5EPSA 3HMFA 4TT2A 5CTLA 4ZQLA 4LYIA 5CS8A 5F63A 5C85A 5E9YA 5CQ4A 5TCMA 4O7EA 2DKWA 4MR5A 4TU6A 4O70A 4AKGA 4QC3A 2WP1A 4AI6A 5I88A 4C66A 4NQNA 4NXJA 4QB3A 4QBMA 2OSSA 3SVHA 2YEMA 5E9VA 5A83A 5LJ1A 5A82A 5A5NA 4QEWA 3U5NA 4YBMA 4QR4A 4QSXA 4NR6A 5A5PA 5HJCA 4NRCA 5HRXA 5HFQA 5D0CA 4QSUA 4NQMA 5L8TA 4IR6A 3LQJA 4TU4A 4IR5A 5EQ1A 4UYDA 5DW2A 5J0DA 4MEPA 5D25A 5AMEA 5CQTA 4YYGA 4BW3A 4CLBA 4UYGA 2OO1A 4UYEA 4A9EA 5C8GA 5DYUA 5I86A 2DVSA 4AKIA 5FBXA 4CUPA 5KTWA 5L98A 5G4SA 5H85A 4NUEA 5D24A 4FLPA 4KV1A 4UIVA 4PKLA 3MULA 3D1BA 2N9GA 4IORA 1JSPB 3UVXA 4O76A 5IGNA 2DVVA 5FE1A 5DLXA 4IOQA 5F61A 5A5QA 5CRZA 4N4FA 5F1HA 5EISA 4UYFA 5EWCA 2RNWA 4YYMA 4QC1A 4YBSA 4UIYA 2KTBB 2YYNA 4XY9A 4QSQA 5CQ7A 4LZSA 3JVKA 3HMEA 5A81A 5C87A 4QSRA 4HBVA 4QEUA 5DFCA 5HRWA 4Z6IA 4HXKA 4MR4A 4OGIA 4O78A 5FH6A 5L96A 5IIDA 4QUTA 4Y03A 5DYXA 4NRAA 5F25A 5A85A 2D82A 4TTEA 5DFDA 4A9KA 5II1A 5F2PA 5E0RA 5FG6A 2R0VA 5CQ8A 4N4IA 5A5OA 5AMFA 1WUMA 4CURA 4A9HA 5CUBA 3NXBA 4TQNA 5G4RA 5KTXA 1JM4B 3U5MA 5CUCA 5DFBA 3ONIA 5BT5A 5FE8A 5C4QA 3LQHA 5D3RA 5AD3A 2YELA 3IU5A 4UITA 5DBMA 2MJVB 5E9KA 5TB6A 4HXRA 4XUBA 5FE3A 5ENIA 4UIZA 3JVJA 4QNSA 5L99A 5E9IA 5FH7A 4UYFB 3D7CA 4QSTA 3U5LA 5HQ6A 5HQ5A 3UVYA 4DONA 5D3LA 4YH3A 4NRBA 5ACYA 2RI7A 5FE0A 4QYLA 5JI8A 4TYLA
chains in the Genus database with same CATH topology
5ENJA 4PY6A 3QZTA 4LZRA 4QSVA 4YH4A 5D26A 5DX4A 5HENA 5CY9A 5COIA 5LKXA 5ENHA 4WIVA 5DLZA 4O75A 5IBNA 5CU8A 5ETDA 5F60A 4CL9A 5CP5A 2L5EA 5CZGA 5EA1A 4QR5A 4QYDA 5AD2A 5CQ3A 2R10A 2LSPB 4CUSA 3K2JA 2DVRA 4O71A 2RFJA 4O77A 4MEOA 5F3AA 3S91A 2GRCA 2DWWA 5II2A 3IU6A 4PCEA 5CUGA 4LR6A 5CQ5A 5DY7A 2E3KA 4A9OA 2RS9B 3P5OA 4YAXA 3U5KA 4KCXA 5EU1A 4J1PA 5LJ2A 5K29A 5CFWA 5D3HA 4NR4A 5C7NA 2RNYA 4A9LA 4YADA 3O34A 4XY8A 4TT4A 5JWMA 2I7KA 3JVMA 4HBYA 4XYAA 5DYCA 5CPEA 4YY6A 4O72A 5FFVA 5FE5A 5A5SA 4LYSA 5FB1A 4MEQA 3LJWA 3Q2EA 5FE7A 4NYVA 5ETBA 4YBTA 4ALHA 4NR7A 5CUAA 4WHWA 4BW2A 2I8NA 5FFWA 4NS5A 4OUFA 3I3JA 4Z1QA 4MR3A 5LKTA 4Z93A 2L85A 5ENBA 4XUAA 3MUKA 4LDFA 4QZSA 5D7XA 5D3JA 4YABA 4O7BA 4WHUA 5HCLA 4PCIA 5BT4A 5FE6A 4BJXA 4NR5A 3UVWA 4TZ8A 5LKZA 2RO1A 4IOOA 5FFYA 4QSWA 3TLPA 5E9MA 5I89A 4YYHA 3P1EA 5EK9A 5EVAA 5I7YA 3GG3A 5L97A 5KO4A 5F36A 4UYHA 5E7DA 5KU3A 3U5PA 2YEKA 5E3GA 3QZSA 4YK0A 4RVRA 4AKNA 4LZ2A 5H1TA 4A9FA 2L84A 3UV4A 5D3PA 4OGJA 4PTBA 5EICA 2YQDA 3P1DA 5ENGA 1ZS5A 5C89A 1E6IA 4HXSA 5E74A 5EWDA 4YATA 2R0SA 4YY4A 5FE9A 5EGUA 3UV5A 4TS8A 3O33A 2H60A 3AQAA 4YYJA 3Q2FA 4YYKA 5LUUA 5FG5A 4F3IA 3JVLA 5BT3A 2F6NA 3LQIA 5ENEA 1F68A 4LRGA 5D3SA 5EI4A 3O36A 5DKCA 5FH8A 4Z1SA 4NUCA 3SVGA 4BW1A 4A9MA 5A5RA 5LVRA 4BW4A 4Q0OA 5F62A 4N4GA 4IR3A 5CGPA 5FDZA 4O74A 5I80A 5HELA 5LKUA 5DKHA 5CUDA 4HXNA 3G0JA 4NR9A 5LVQA 3U5JA 5A7CA 4X2IA 3U5OA 5FG4A 2RNXA 5IGLA 4N4HA 5ENFA 4CFLA 5ENCA 5EPRA 4Z6HA 5IGMA 5HRVA 2DVQA 3HMHA 5DKDA 4HXLA 3FKMX 5EV9A 4HXMA 4YYIA 5CQAA 3UVDA 4O7AA 5FE4A 5E9LA 5DW1A 4NR8A 2NXBA 3MB4A 3P1CA 5I40A 4YYNA 5HM0A 4HBXA 3ZYUA 5HEMA 5HQ7A 4QUUA 4NUDA 4UIXA 4BHWA 4ZW1A 4QSSA 4C67A 4TT6A 4CUQA 2YDWA 3S92A 3O37A 5CQ6A 4J0RA 4KV4A 4TZ2A 4PS5A 5EWWA 4NYXA 2G4AA 5D3TA 4QEVA 4HXOA 5F1LA 5FB0A 5DYAA 3G0LA 4MR6A 4LYWA 5KHMA 5H1UA 5I1QA 5I83A 3MQMA 4J0SA 4GPJA 4LC2A 5EM3A 4O7FA 4CUUA 5FE2A 3DAIA 5EP7A 2YW5A 3QZVA 2E7NA 4MENA 4N3WA 4QY4A 3UW9A 1EQFA 4A9JA 5D3NA 5IG6A 5CRMA 5E73A 5EWVA 4YC9A 4A9IA 5HLSA 5KTUA 3DWYA 5EWHA 3O35A 4NYWA 4E96A 4Q0NA 4HBWA 4HXPA 2DATA 1X0JA 5E3DA 2WP2A 4ZC9A 4ALGA 3RCWA 2FSAA 4O7CA 3P1FA 4UIWA 4CFKA 1WUGA 4YYDA 3MXFA 5LJ0A 3SVFA 4CUTA 1N72A 4J3IA 3UV2A 2OUOA 2R0YA 3AADA 5IGKA 4QR3A 5F5ZA 5HFRA 5L8UA 5EPBA 2F6JA 5I29A 3LXJA 2D9EA 3MB3A 5I7XA 5H1VA 4QSPA 2E7OA 4IR4A 5CUEA 4UIUA 4A9NA 5EPSA 3HMFA 4TT2A 5CTLA 4ZQLA 4LYIA 5CS8A 5F63A 5C85A 5E9YA 5CQ4A 5TCMA 4O7EA 2DKWA 4MR5A 4TU6A 4O70A 4QC3A 2WP1A 5I88A 4C66A 4NQNA 4NXJA 4QB3A 4QBMA 2OSSA 3SVHA 2YEMA 5E9VA 5A83A 5LJ1A 5A82A 5A5NA 4QEWA 3U5NA 4YBMA 4QR4A 4QSXA 4NR6A 5A5PA 5HJCA 4NRCA 5HRXA 5HFQA 5D0CA 4QSUA 4NQMA 5L8TA 4IR6A 3LQJA 4TU4A 4IR5A 5EQ1A 4UYDA 5DW2A 5J0DA 4MEPA 5D25A 5AMEA 5CQTA 4YYGA 4BW3A 4CLBA 4UYGA 2OO1A 4UYEA 4A9EA 5C8GA 5DYUA 5I86A 2DVSA 5FBXA 4CUPA 5KTWA 5L98A 5G4SA 5H85A 4NUEA 5D24A 4FLPA 4KV1A 4UIVA 4PKLA 3MULA 2N9GA 4IORA 1JSPB 3UVXA 4O76A 5IGNA 2DVVA 5FE1A 5DLXA 4IOQA 5F61A 5A5QA 5CRZA 4N4FA 5F1HA 5EISA 4UYFA 5EWCA 2RNWA 4YYMA 4QC1A 4YBSA 4UIYA 2KTBB 2YYNA 4XY9A 4QSQA 5CQ7A 4LZSA 3JVKA 3HMEA 5A81A 5C87A 4QSRA 4HBVA 4QEUA 5DFCA 5HRWA 4Z6IA 4HXKA 4MR4A 4OGIA 4O78A 5FH6A 5L96A 5IIDA 4QUTA 4Y03A 5DYXA 4NRAA 5F25A 5A85A 2D82A 4TTEA 5DFDA 4A9KA 5II1A 5F2PA 5E0RA 5FG6A 2R0VA 5CQ8A 4N4IA 5A5OA 5AMFA 1WUMA 4CURA 4A9HA 5CUBA 3NXBA 4TQNA 5G4RA 5KTXA 1JM4B 3U5MA 5CUCA 5DFBA 3ONIA 5BT5A 5FE8A 5C4QA 3LQHA 5D3RA 5AD3A 2YELA 3IU5A 4UITA 5DBMA 2MJVB 5E9KA 5TB6A 4HXRA 4XUBA 5FE3A 5ENIA 4UIZA 3JVJA 4QNSA 5L99A 5E9IA 5FH7A 4UYFB 3D7CA 4QSTA 3U5LA 5HQ6A 5HQ5A 3UVYA 4DONA 5D3LA 4YH3A 4NRBA 5ACYA 2RI7A 5FE0A 4QYLA 5JI8A 4TYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENJ A;  4PY6 A;  3QZT A;  4LZR A;  4QSV A;  4YH4 A;  5D26 A;  5DX4 A;  5HEN A;  5CY9 A;  5COI A;  5LKX A;  5ENH A;  4WIV A;  5DLZ A;  4O75 A;  5IBN A;  5CU8 A;  5ETD A;  5F60 A;  4CL9 A;  5CP5 A;  2L5E A;  5CZG A;  5EA1 A;  4QR5 A;  4QYD A;  5AD2 A;  5CQ3 A;  2R10 A;  2LSP B;  4CUS A;  3K2J A;  2DVR A;  4O71 A;  2RFJ A;  4O77 A;  4MEO A;  5F3A A;  3S91 A;  2GRC A;  2DWW A;  5II2 A;  3IU6 A;  4PCE A;  5CUG A;  4LR6 A;  5CQ5 A;  5DY7 A;  2E3K A;  4A9O A;  2RS9 B;  3P5O A;  4YAX A;  3U5K A;  4KCX A;  5EU1 A;  4J1P A;  5LJ2 A;  5K29 A;  5CFW A;  5D3H A;  4NR4 A;  5C7N A;  2RNY A;  4A9L A;  4YAD A;  3O34 A;  4XY8 A;  4TT4 A;  5JWM A;  2I7K A;  3JVM A;  4HBY A;  4XYA A;  5DYC A;  5CPE A;  4YY6 A;  4O72 A;  5FFV A;  5FE5 A;  5A5S A;  4LYS A;  5FB1 A;  4MEQ A;  3LJW A;  3Q2E A;  5FE7 A;  4NYV A;  5ETB A;  4YBT A;  4ALH A;  4NR7 A;  5CUA A;  4WHW A;  4BW2 A;  2I8N A;  5FFW A;  4NS5 A;  4OUF A;  3I3J A;  4Z1Q A;  4MR3 A;  5LKT A;  4Z93 A;  2L85 A;  5ENB A;  4XUA A;  3MUK A;  4LDF A;  4QZS A;  5D7X A;  5D3J A;  4YAB A;  4O7B A;  4WHU A;  5HCL A;  4PCI A;  5BT4 A;  5FE6 A;  4BJX A;  4NR5 A;  3UVW A;  4TZ8 A;  5LKZ A;  2RO1 A;  4IOO A;  5FFY A;  4QSW A;  3TLP A;  5E9M A;  5I89 A;  4YYH A;  3P1E A;  5EK9 A;  5EVA A;  5I7Y A;  3GG3 A;  5L97 A;  5KO4 A;  5F36 A;  4UYH A;  5E7D A;  5KU3 A;  3U5P A;  2YEK A;  5E3G A;  3QZS A;  4YK0 A;  4RVR A;  4AKN A;  4LZ2 A;  5H1T A;  4A9F A;  2L84 A;  3UV4 A;  5D3P A;  4OGJ A;  4PTB A;  5EIC A;  2YQD A;  3P1D A;  5ENG A;  1ZS5 A;  5C89 A;  1E6I A;  4HXS A;  5E74 A;  5EWD A;  4YAT A;  2R0S A;  4YY4 A;  5FE9 A;  5EGU A;  3UV5 A;  4TS8 A;  3O33 A;  2H60 A;  3AQA A;  4YYJ A;  3Q2F A;  4YYK A;  5LUU A;  5FG5 A;  4F3I A;  3JVL A;  5BT3 A;  2F6N A;  3LQI A;  5ENE A;  1F68 A;  4LRG A;  5D3S A;  5EI4 A;  3O36 A;  5DKC A;  5FH8 A;  4Z1S A;  4NUC A;  3SVG A;  4BW1 A;  4A9M A;  5A5R A;  5LVR A;  4BW4 A;  4Q0O A;  5F62 A;  4N4G A;  4IR3 A;  5CGP A;  5FDZ A;  4O74 A;  5I80 A;  5HEL A;  5LKU A;  5DKH A;  5CUD A;  4HXN A;  3G0J A;  4NR9 A;  5LVQ A;  3U5J A;  5A7C A;  4X2I A;  3U5O A;  5FG4 A;  2RNX A;  5IGL A;  4N4H A;  5ENF A;  4CFL A;  5ENC A;  5EPR A;  4Z6H A;  5IGM A;  5HRV A;  2DVQ A;  3HMH A;  5DKD A;  4HXL A;  3FKM X;  5EV9 A;  4HXM A;  4YYI A;  5CQA A;  3UVD A;  4O7A A;  5FE4 A;  5E9L A;  5DW1 A;  4NR8 A;  2NXB A;  3MB4 A;  3P1C A;  5I40 A;  4YYN A;  5HM0 A;  4HBX A;  3ZYU A;  5HEM A;  5HQ7 A;  4QUU A;  4NUD A;  4UIX A;  4BHW A;  4ZW1 A;  4QSS A;  4C67 A;  4TT6 A;  4CUQ A;  2YDW A;  3S92 A;  3O37 A;  5CQ6 A;  4J0R A;  4KV4 A;  4TZ2 A;  4PS5 A;  5EWW A;  4NYX A;  2G4A A;  5D3T A;  4QEV A;  4HXO A;  5F1L A;  5FB0 A;  5DYA A;  3G0L A;  4MR6 A;  4LYW A;  5KHM A;  5H1U A;  5I1Q A;  5I83 A;  3MQM A;  4J0S A;  4GPJ A;  4LC2 A;  5EM3 A;  4O7F A;  4CUU A;  5FE2 A;  3DAI A;  5EP7 A;  2YW5 A;  3QZV A;  2E7N A;  4MEN A;  4N3W A;  4QY4 A;  3UW9 A;  1EQF A;  4A9J A;  5D3N A;  5IG6 A;  5CRM A;  5E73 A;  5EWV A;  4YC9 A;  4A9I A;  5HLS A;  5KTU A;  3DWY A;  5EWH A;  3O35 A;  4NYW A;  4E96 A;  4Q0N A;  4HBW A;  4HXP A;  2DAT A;  1X0J A;  5E3D A;  2WP2 A;  4ZC9 A;  4ALG A;  3RCW A;  2FSA A;  4O7C A;  3P1F A;  4UIW A;  4CFK A;  1WUG A;  4YYD A;  3MXF A;  5LJ0 A;  3SVF A;  4CUT A;  1N72 A;  4J3I A;  3UV2 A;  2OUO A;  2R0Y A;  3AAD A;  5IGK A;  4QR3 A;  5F5Z A;  5HFR A;  5L8U A;  5EPB A;  2F6J A;  5I29 A;  3LXJ A;  2D9E A;  3MB3 A;  5I7X A;  5H1V A;  4QSP A;  2E7O A;  4IR4 A;  5CUE A;  4UIU A;  4A9N A;  5EPS A;  3HMF A;  4TT2 A;  5CTL A;  4ZQL A;  4LYI A;  5CS8 A;  5F63 A;  5C85 A;  5E9Y A;  5CQ4 A;  5TCM A;  4O7E A;  2DKW A;  4MR5 A;  4TU6 A;  4O70 A;  4QC3 A;  2WP1 A;  5I88 A;  4C66 A;  4NQN A;  4NXJ A;  4QB3 A;  4QBM A;  2OSS A;  3SVH A;  2YEM A;  5E9V A;  5A83 A;  5LJ1 A;  5A82 A;  5A5N A;  4QEW A;  3U5N A;  4YBM A;  4QR4 A;  4QSX A;  4NR6 A;  5A5P A;  5HJC A;  4NRC A;  5HRX A;  5HFQ A;  5D0C A;  4QSU A;  4NQM A;  5L8T A;  4IR6 A;  3LQJ A;  4TU4 A;  4IR5 A;  5EQ1 A;  4UYD A;  5DW2 A;  5J0D A;  4MEP A;  5D25 A;  5AME A;  5CQT A;  4YYG A;  4BW3 A;  4CLB A;  4UYG A;  2OO1 A;  4UYE A;  4A9E A;  5C8G A;  5DYU A;  5I86 A;  2DVS A;  5FBX A;  4CUP A;  5KTW A;  5L98 A;  5G4S A;  5H85 A;  4NUE A;  5D24 A;  4FLP A;  4KV1 A;  4UIV A;  4PKL A;  3MUL A;  2N9G A;  4IOR A;  1JSP B;  3UVX A;  4O76 A;  5IGN A;  2DVV A;  5FE1 A;  5DLX A;  4IOQ A;  5F61 A;  5A5Q A;  5CRZ A;  4N4F A;  5F1H A;  5EIS A;  4UYF A;  5EWC A;  2RNW A;  4YYM A;  4QC1 A;  4YBS A;  4UIY A;  2KTB B;  2YYN A;  4XY9 A;  4QSQ A;  5CQ7 A;  4LZS A;  3JVK A;  3HME A;  5A81 A;  5C87 A;  4QSR A;  4HBV A;  4QEU A;  5DFC A;  5HRW A;  4Z6I A;  4HXK A;  4MR4 A;  4OGI A;  4O78 A;  5FH6 A;  5L96 A;  5IID A;  4QUT A;  4Y03 A;  5DYX A;  4NRA A;  5F25 A;  5A85 A;  2D82 A;  4TTE A;  5DFD A;  4A9K A;  5II1 A;  5F2P A;  5E0R A;  5FG6 A;  2R0V A;  5CQ8 A;  4N4I A;  5A5O A;  5AMF A;  1WUM A;  4CUR A;  4A9H A;  5CUB A;  3NXB A;  4TQN A;  5G4R A;  5KTX A;  1JM4 B;  3U5M A;  5CUC A;  5DFB A;  3ONI A;  5BT5 A;  5FE8 A;  5C4Q A;  3LQH A;  5D3R A;  5AD3 A;  2YEL A;  3IU5 A;  4UIT A;  5DBM A;  2MJV B;  5E9K A;  5TB6 A;  4HXR A;  4XUB A;  5FE3 A;  5ENI A;  4UIZ A;  3JVJ A;  4QNS A;  5L99 A;  5E9I A;  5FH7 A;  4UYF B;  3D7C A;  4QST A;  3U5L A;  5HQ6 A;  5HQ5 A;  3UVY A;  4DON A;  5D3L A;  4YH3 A;  4NRB A;  5ACY A;  2RI7 A;  5FE0 A;  4QYL A;  5JI8 A;  4TYL A; 
#chains in the Genus database with same CATH topology
 5ENJ A;  4PY6 A;  3QZT A;  4LZR A;  4QSV A;  4YH4 A;  5D26 A;  5DX4 A;  5HEN A;  5CY9 A;  5COI A;  5LKX A;  5ENH A;  4WIV A;  5DLZ A;  4O75 A;  5IBN A;  5CU8 A;  5ETD A;  5F60 A;  4CL9 A;  5CP5 A;  2L5E A;  5CZG A;  5EA1 A;  4QR5 A;  4QYD A;  5AD2 A;  5CQ3 A;  2R10 A;  2LSP B;  4CUS A;  3K2J A;  2DVR A;  4O71 A;  2RFJ A;  4O77 A;  4MEO A;  5F3A A;  4AKH A;  3S91 A;  2GRC A;  2DWW A;  5II2 A;  3IU6 A;  4PCE A;  5CUG A;  4LR6 A;  5CQ5 A;  5DY7 A;  2E3K A;  4A9O A;  2RS9 B;  3P5O A;  4YAX A;  3U5K A;  4KCX A;  5EU1 A;  4J1P A;  5LJ2 A;  5K29 A;  5CFW A;  5D3H A;  4NR4 A;  5C7N A;  2RNY A;  4A9L A;  4YAD A;  3O34 A;  4XY8 A;  4TT4 A;  5JWM A;  2I7K A;  3JVM A;  4HBY A;  4XYA A;  5DYC A;  5CPE A;  4YY6 A;  4O72 A;  5FFV A;  5FE5 A;  5A5S A;  4LYS A;  5FB1 A;  4MEQ A;  3LJW A;  3Q2E A;  5FE7 A;  4NYV A;  5ETB A;  4YBT A;  4ALH A;  4NR7 A;  5CUA A;  4WHW A;  4BW2 A;  2I8N A;  5FFW A;  4NS5 A;  4OUF A;  3I3J A;  4Z1Q A;  4MR3 A;  5LKT A;  4Z93 A;  2L85 A;  5ENB A;  3VKG A;  4XUA A;  3MUK A;  4LDF A;  4QZS A;  5D7X A;  5D3J A;  4YAB A;  4O7B A;  4WHU A;  5HCL A;  4PCI A;  5BT4 A;  5FE6 A;  4BJX A;  4NR5 A;  3UVW A;  4TZ8 A;  5LKZ A;  2RO1 A;  4IOO A;  5FFY A;  4QSW A;  3TLP A;  5E9M A;  5I89 A;  4YYH A;  3P1E A;  5EK9 A;  5EVA A;  5I7Y A;  3GG3 A;  5L97 A;  5KO4 A;  5F36 A;  4UYH A;  5E7D A;  5KU3 A;  3U5P A;  2YEK A;  5E3G A;  3QZS A;  4YK0 A;  4RVR A;  4AKN A;  4LZ2 A;  5H1T A;  4A9F A;  2L84 A;  3UV4 A;  5D3P A;  4OGJ A;  4PTB A;  5EIC A;  2YQD A;  3P1D A;  5ENG A;  1ZS5 A;  5C89 A;  1E6I A;  4HXS A;  5E74 A;  5EWD A;  4YAT A;  2R0S A;  4YY4 A;  5FE9 A;  5EGU A;  3UV5 A;  4TS8 A;  3O33 A;  2H60 A;  3AQA A;  4YYJ A;  3ERR A;  3Q2F A;  4YYK A;  5LUU A;  5FG5 A;  4F3I A;  3JVL A;  5BT3 A;  2F6N A;  3LQI A;  5ENE A;  1F68 A;  4LRG A;  5D3S A;  5EI4 A;  3O36 A;  5DKC A;  5FH8 A;  4Z1S A;  4NUC A;  3SVG A;  4BW1 A;  4A9M A;  5A5R A;  5LVR A;  4BW4 A;  4Q0O A;  5F62 A;  4N4G A;  4IR3 A;  5CGP A;  5FDZ A;  4O74 A;  5I80 A;  5HEL A;  5LKU A;  5DKH A;  5CUD A;  4HXN A;  3G0J A;  4NR9 A;  5LVQ A;  3U5J A;  5A7C A;  3VKH A;  4X2I A;  3U5O A;  5FG4 A;  2RNX A;  5IGL A;  4N4H A;  5ENF A;  4CFL A;  5ENC A;  5EPR A;  4Z6H A;  5IGM A;  5HRV A;  2DVQ A;  3HMH A;  5DKD A;  4HXL A;  3FKM X;  5EV9 A;  4HXM A;  4YYI A;  5CQA A;  1ZKR A;  4O7A A;  5FE4 A;  5E9L A;  3UVD A;  5DW1 A;  4NR8 A;  2NXB A;  3MB4 A;  3P1C A;  5I40 A;  4YYN A;  5HM0 A;  4HBX A;  3ZYU A;  5HEM A;  5HQ7 A;  4QUU A;  4NUD A;  4UIX A;  4BHW A;  4ZW1 A;  4QSS A;  4C67 A;  4TT6 A;  4CUQ A;  2YDW A;  3S92 A;  3O37 A;  5CQ6 A;  4J0R A;  4KV4 A;  4TZ2 A;  4PS5 A;  5EWW A;  4NYX A;  2G4A A;  5D3T A;  4QEV A;  4HXO A;  5F1L A;  5FB0 A;  5DYA A;  3G0L A;  4MR6 A;  4LYW A;  5KHM A;  5H1U A;  5I1Q A;  5I83 A;  3MQM A;  4J0S A;  4GPJ A;  4LC2 A;  5EM3 A;  4O7F A;  4CUU A;  5FE2 A;  3DAI A;  5EP7 A;  2YW5 A;  3QZV A;  2E7N A;  4MEN A;  4N3W A;  4QY4 A;  3UW9 A;  1EQF A;  4A9J A;  5D3N A;  5IG6 A;  5CRM A;  5E73 A;  5EWV A;  4YC9 A;  4A9I A;  5HLS A;  5KTU A;  3DWY A;  5EWH A;  3O35 A;  4NYW A;  4E96 A;  4Q0N A;  4HBW A;  1PUO A;  4HXP A;  2DAT A;  1X0J A;  5E3D A;  2WP2 A;  3D1D A;  4ZC9 A;  4ALG A;  3RCW A;  2FSA A;  4O7C A;  3P1F A;  4UIW A;  4CFK A;  1WUG A;  4YYD A;  3MXF A;  5LJ0 A;  2EJN A;  3SVF A;  4CUT A;  1N72 A;  4J3I A;  3UV2 A;  2OUO A;  2R0Y A;  3AAD A;  5IGK A;  4QR3 A;  5F5Z A;  5HFR A;  5L8U A;  5EPB A;  2F6J A;  5I29 A;  3LXJ A;  2D9E A;  3MB3 A;  5I7X A;  5H1V A;  4QSP A;  2E7O A;  4IR4 A;  5CUE A;  4UIU A;  4A9N A;  5EPS A;  3HMF A;  4TT2 A;  5CTL A;  4ZQL A;  4LYI A;  5CS8 A;  5F63 A;  5C85 A;  5E9Y A;  5CQ4 A;  5TCM A;  4O7E A;  2DKW A;  4MR5 A;  4TU6 A;  4O70 A;  4AKG A;  4QC3 A;  2WP1 A;  4AI6 A;  5I88 A;  4C66 A;  4NQN A;  4NXJ A;  4QB3 A;  4QBM A;  2OSS A;  3SVH A;  2YEM A;  5E9V A;  5A83 A;  5LJ1 A;  5A82 A;  5A5N A;  4QEW A;  3U5N A;  4YBM A;  4QR4 A;  4QSX A;  4NR6 A;  5A5P A;  5HJC A;  4NRC A;  5HRX A;  5HFQ A;  5D0C A;  4QSU A;  4NQM A;  5L8T A;  4IR6 A;  3LQJ A;  4TU4 A;  4IR5 A;  5EQ1 A;  4UYD A;  5DW2 A;  5J0D A;  4MEP A;  5D25 A;  5AME A;  5CQT A;  4YYG A;  4BW3 A;  4CLB A;  4UYG A;  2OO1 A;  4UYE A;  4A9E A;  5C8G A;  5DYU A;  5I86 A;  2DVS A;  4AKI A;  5FBX A;  4CUP A;  5KTW A;  5L98 A;  5G4S A;  5H85 A;  4NUE A;  5D24 A;  4FLP A;  4KV1 A;  4UIV A;  4PKL A;  3MUL A;  3D1B A;  2N9G A;  4IOR A;  1JSP B;  3UVX A;  4O76 A;  5IGN A;  2DVV A;  5FE1 A;  5DLX A;  4IOQ A;  5F61 A;  5A5Q A;  5CRZ A;  4N4F A;  5F1H A;  5EIS A;  4UYF A;  5EWC A;  2RNW A;  4YYM A;  4QC1 A;  4YBS A;  4UIY A;  2KTB B;  2YYN A;  4XY9 A;  4QSQ A;  5CQ7 A;  4LZS A;  3JVK A;  3HME A;  5A81 A;  5C87 A;  4QSR A;  4HBV A;  4QEU A;  5DFC A;  5HRW A;  4Z6I A;  4HXK A;  4MR4 A;  4OGI A;  4O78 A;  5FH6 A;  5L96 A;  5IID A;  4QUT A;  4Y03 A;  5DYX A;  4NRA A;  5F25 A;  5A85 A;  2D82 A;  4TTE A;  5DFD A;  4A9K A;  5II1 A;  5F2P A;  5E0R A;  5FG6 A;  2R0V A;  5CQ8 A;  4N4I A;  5A5O A;  5AMF A;  1WUM A;  4CUR A;  4A9H A;  5CUB A;  3NXB A;  4TQN A;  5G4R A;  5KTX A;  1JM4 B;  3U5M A;  5CUC A;  5DFB A;  3ONI A;  5BT5 A;  5FE8 A;  5C4Q A;  3LQH A;  5D3R A;  5AD3 A;  2YEL A;  3IU5 A;  4UIT A;  5DBM A;  2MJV B;  5E9K A;  5TB6 A;  4HXR A;  4XUB A;  5FE3 A;  5ENI A;  4UIZ A;  3JVJ A;  4QNS A;  5L99 A;  5E9I A;  5FH7 A;  4UYF B;  3D7C A;  4QST A;  3U5L A;  5HQ6 A;  5HQ5 A;  3UVY A;  4DON A;  5D3L A;  4YH3 A;  4NRB A;  5ACY A;  2RI7 A;  5FE0 A;  4QYL A;  5JI8 A;  4TYL A; 
#chains in the Genus database with same CATH homology
 5ENJ A;  4PY6 A;  3QZT A;  4LZR A;  4QSV A;  4YH4 A;  5D26 A;  5DX4 A;  5HEN A;  5CY9 A;  5COI A;  5LKX A;  5ENH A;  4WIV A;  5DLZ A;  4O75 A;  5IBN A;  5CU8 A;  5ETD A;  5F60 A;  4CL9 A;  5CP5 A;  2L5E A;  5CZG A;  5EA1 A;  4QR5 A;  4QYD A;  5AD2 A;  5CQ3 A;  2R10 A;  2LSP B;  4CUS A;  3K2J A;  2DVR A;  4O71 A;  2RFJ A;  4O77 A;  4MEO A;  5F3A A;  3S91 A;  2GRC A;  2DWW A;  5II2 A;  3IU6 A;  4PCE A;  5CUG A;  4LR6 A;  5CQ5 A;  5DY7 A;  2E3K A;  4A9O A;  2RS9 B;  3P5O A;  4YAX A;  3U5K A;  4KCX A;  5EU1 A;  4J1P A;  5LJ2 A;  5K29 A;  5CFW A;  5D3H A;  4NR4 A;  5C7N A;  2RNY A;  4A9L A;  4YAD A;  3O34 A;  4XY8 A;  4TT4 A;  5JWM A;  2I7K A;  3JVM A;  4HBY A;  4XYA A;  5DYC A;  5CPE A;  4YY6 A;  4O72 A;  5FFV A;  5FE5 A;  5A5S A;  4LYS A;  5FB1 A;  4MEQ A;  3LJW A;  3Q2E A;  5FE7 A;  4NYV A;  5ETB A;  4YBT A;  4ALH A;  4NR7 A;  5CUA A;  4WHW A;  4BW2 A;  2I8N A;  5FFW A;  4NS5 A;  4OUF A;  3I3J A;  4Z1Q A;  4MR3 A;  5LKT A;  4Z93 A;  2L85 A;  5ENB A;  4XUA A;  3MUK A;  4LDF A;  4QZS A;  5D7X A;  5D3J A;  4YAB A;  4O7B A;  4WHU A;  5HCL A;  4PCI A;  5BT4 A;  5FE6 A;  4BJX A;  4NR5 A;  3UVW A;  4TZ8 A;  5LKZ A;  2RO1 A;  4IOO A;  5FFY A;  4QSW A;  3TLP A;  5E9M A;  5I89 A;  4YYH A;  3P1E A;  5EK9 A;  5EVA A;  5I7Y A;  3GG3 A;  5L97 A;  5KO4 A;  5F36 A;  4UYH A;  5E7D A;  5KU3 A;  3U5P A;  2YEK A;  5E3G A;  3QZS A;  4YK0 A;  4RVR A;  4AKN A;  4LZ2 A;  5H1T A;  4A9F A;  2L84 A;  3UV4 A;  5D3P A;  4OGJ A;  4PTB A;  5EIC A;  2YQD A;  3P1D A;  5ENG A;  1ZS5 A;  5C89 A;  1E6I A;  4HXS A;  5E74 A;  5EWD A;  4YAT A;  2R0S A;  4YY4 A;  5FE9 A;  5EGU A;  3UV5 A;  4TS8 A;  3O33 A;  2H60 A;  3AQA A;  4YYJ A;  3Q2F A;  4YYK A;  5LUU A;  5FG5 A;  4F3I A;  3JVL A;  5BT3 A;  2F6N A;  3LQI A;  5ENE A;  1F68 A;  4LRG A;  5D3S A;  5EI4 A;  3O36 A;  5DKC A;  5FH8 A;  4Z1S A;  4NUC A;  3SVG A;  4BW1 A;  4A9M A;  5A5R A;  5LVR A;  4BW4 A;  4Q0O A;  5F62 A;  4N4G A;  4IR3 A;  5CGP A;  5FDZ A;  4O74 A;  5I80 A;  5HEL A;  5LKU A;  5DKH A;  5CUD A;  4HXN A;  3G0J A;  4NR9 A;  5LVQ A;  3U5J A;  5A7C A;  4X2I A;  3U5O A;  5FG4 A;  2RNX A;  5IGL A;  4N4H A;  5ENF A;  4CFL A;  5ENC A;  5EPR A;  4Z6H A;  5IGM A;  5HRV A;  2DVQ A;  3HMH A;  5DKD A;  4HXL A;  3FKM X;  5EV9 A;  4HXM A;  4YYI A;  5CQA A;  3UVD A;  4O7A A;  5FE4 A;  5E9L A;  5DW1 A;  4NR8 A;  2NXB A;  3MB4 A;  3P1C A;  5I40 A;  4YYN A;  5HM0 A;  4HBX A;  3ZYU A;  5HEM A;  5HQ7 A;  4QUU A;  4NUD A;  4UIX A;  4BHW A;  4ZW1 A;  4QSS A;  4C67 A;  4TT6 A;  4CUQ A;  2YDW A;  3S92 A;  3O37 A;  5CQ6 A;  4J0R A;  4KV4 A;  4TZ2 A;  4PS5 A;  5EWW A;  4NYX A;  2G4A A;  5D3T A;  4QEV A;  4HXO A;  5F1L A;  5FB0 A;  5DYA A;  3G0L A;  4MR6 A;  4LYW A;  5KHM A;  5H1U A;  5I1Q A;  5I83 A;  3MQM A;  4J0S A;  4GPJ A;  4LC2 A;  5EM3 A;  4O7F A;  4CUU A;  5FE2 A;  3DAI A;  5EP7 A;  2YW5 A;  3QZV A;  2E7N A;  4MEN A;  4N3W A;  4QY4 A;  3UW9 A;  1EQF A;  4A9J A;  5D3N A;  5IG6 A;  5CRM A;  5E73 A;  5EWV A;  4YC9 A;  4A9I A;  5HLS A;  5KTU A;  3DWY A;  5EWH A;  3O35 A;  4NYW A;  4E96 A;  4Q0N A;  4HBW A;  4HXP A;  2DAT A;  1X0J A;  5E3D A;  2WP2 A;  4ZC9 A;  4ALG A;  3RCW A;  2FSA A;  4O7C A;  3P1F A;  4UIW A;  4CFK A;  1WUG A;  4YYD A;  3MXF A;  5LJ0 A;  3SVF A;  4CUT A;  1N72 A;  4J3I A;  3UV2 A;  2OUO A;  2R0Y A;  3AAD A;  5IGK A;  4QR3 A;  5F5Z A;  5HFR A;  5L8U A;  5EPB A;  2F6J A;  5I29 A;  3LXJ A;  2D9E A;  3MB3 A;  5I7X A;  5H1V A;  4QSP A;  2E7O A;  4IR4 A;  5CUE A;  4UIU A;  4A9N A;  5EPS A;  3HMF A;  4TT2 A;  5CTL A;  4ZQL A;  4LYI A;  5CS8 A;  5F63 A;  5C85 A;  5E9Y A;  5CQ4 A;  5TCM A;  4O7E A;  2DKW A;  4MR5 A;  4TU6 A;  4O70 A;  4QC3 A;  2WP1 A;  5I88 A;  4C66 A;  4NQN A;  4NXJ A;  4QB3 A;  4QBM A;  2OSS A;  3SVH A;  2YEM A;  5E9V A;  5A83 A;  5LJ1 A;  5A82 A;  5A5N A;  4QEW A;  3U5N A;  4YBM A;  4QR4 A;  4QSX A;  4NR6 A;  5A5P A;  5HJC A;  4NRC A;  5HRX A;  5HFQ A;  5D0C A;  4QSU A;  4NQM A;  5L8T A;  4IR6 A;  3LQJ A;  4TU4 A;  4IR5 A;  5EQ1 A;  4UYD A;  5DW2 A;  5J0D A;  4MEP A;  5D25 A;  5AME A;  5CQT A;  4YYG A;  4BW3 A;  4CLB A;  4UYG A;  2OO1 A;  4UYE A;  4A9E A;  5C8G A;  5DYU A;  5I86 A;  2DVS A;  5FBX A;  4CUP A;  5KTW A;  5L98 A;  5G4S A;  5H85 A;  4NUE A;  5D24 A;  4FLP A;  4KV1 A;  4UIV A;  4PKL A;  3MUL A;  2N9G A;  4IOR A;  1JSP B;  3UVX A;  4O76 A;  5IGN A;  2DVV A;  5FE1 A;  5DLX A;  4IOQ A;  5F61 A;  5A5Q A;  5CRZ A;  4N4F A;  5F1H A;  5EIS A;  4UYF A;  5EWC A;  2RNW A;  4YYM A;  4QC1 A;  4YBS A;  4UIY A;  2KTB B;  2YYN A;  4XY9 A;  4QSQ A;  5CQ7 A;  4LZS A;  3JVK A;  3HME A;  5A81 A;  5C87 A;  4QSR A;  4HBV A;  4QEU A;  5DFC A;  5HRW A;  4Z6I A;  4HXK A;  4MR4 A;  4OGI A;  4O78 A;  5FH6 A;  5L96 A;  5IID A;  4QUT A;  4Y03 A;  5DYX A;  4NRA A;  5F25 A;  5A85 A;  2D82 A;  4TTE A;  5DFD A;  4A9K A;  5II1 A;  5F2P A;  5E0R A;  5FG6 A;  2R0V A;  5CQ8 A;  4N4I A;  5A5O A;  5AMF A;  1WUM A;  4CUR A;  4A9H A;  5CUB A;  3NXB A;  4TQN A;  5G4R A;  5KTX A;  1JM4 B;  3U5M A;  5CUC A;  5DFB A;  3ONI A;  5BT5 A;  5FE8 A;  5C4Q A;  3LQH A;  5D3R A;  5AD3 A;  2YEL A;  3IU5 A;  4UIT A;  5DBM A;  2MJV B;  5E9K A;  5TB6 A;  4HXR A;  4XUB A;  5FE3 A;  5ENI A;  4UIZ A;  3JVJ A;  4QNS A;  5L99 A;  5E9I A;  5FH7 A;  4UYF B;  3D7C A;  4QST A;  3U5L A;  5HQ6 A;  5HQ5 A;  3UVY A;  4DON A;  5D3L A;  4YH3 A;  4NRB A;  5ACY A;  2RI7 A;  5FE0 A;  4QYL A;  5JI8 A;  4TYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...