4UIXA

N-terminal bromodomain of human brd4 with 7-(3,4-dimethoxyphenyl)-n-(1,1-dioxo-1-thian-4-yl)-5-methyl-4-oxo-4h,5h-thieno-3,2-c-pyridine-2- carboxamide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
MNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHKFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 4
publication title The Discovery of I-Brd9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 126
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uixA01
5A83A 1ZS5A 4ALHA 4IORA 4KV1A 4YYJA 4O76A 5CQAA 3U5LA 3ONIA 3RCWA 4BW1A 4NYVA 5A5OA 4UYFB 5C4QA 4O78A 4C66A 5C87A 1EQFA 5LKTA 3G0JA 2R10A 4J3IA 5E7DA 5ENBA 4AKNA 4YYHA 5KO4A 5A5RA 3O37A 4QR5A 4ALGA 4QUTA 4XYAA 2LSPB 4O7BA 4NRCA 4A9JA 5HRWA 5FG6A 1JSPB 4YAXA 5E9VA 5DKHA 5HJCA 5AD3A 3DAIA 4MR5A 4QSPA 5C8GA 3TLPA 5CQ5A 3QZSA 5K29A 4CFKA 4IR6A 5CY9A 5EPRA 3U5JA 4QSXA 5D0CA 3U5MA 5LKUA 4MEPA 5DY7A 4CUPA 4CLBA 4QSUA 4MR6A 2DVVA 2DVSA 4LZRA 2H60A 5FE6A 4YK0A 5A85A 5HELA 5D3JA 5E9MA 5A7CA 4CUTA 5DX4A 2MJVB 4UIWA 5IG6A 4TZ2A 5F36A 4HXPA 2I7KA 3LQJA 4MENA 4NXJA 5D3RA 4A9MA 5I89A 4Q0NA 4YBTA 5D7XA 5A81A 5FBXA 4TT2A 5CU8A 5FE5A 4QY4A 5I1QA 1X0JA 4LR6A 4N4IA 3LJWA 4PKLA 3U5KA 5ENFA 4QC1A 5IGMA 3Q2EA 4NR6A 4O72A 4QBMA 4XY9A 5DLZA 5CFWA 2RO1A 2OSSA 5F61A 5FE2A 4ZQLA 5E9LA 3FKMX 2NXBA 4HBYA 3MUKA 3ZYUA 2YW5A 4LYIA 2DKWA 5AMEA 5EWCA 5EWVA 5HCLA 5E9IA 3O33A 5F60A 4QNSA 5IIDA 5FE0A 4NR4A 4WIVA 5D3SA 3P5OA 3UW9A 2E3KA 2RNXA 4UYGA 5ENHA 3GG3A 5FB1A 5F2PA 5DYUA 5F5ZA 5II2A 4YYKA 3IU6A 4QEUA 4MR3A 2R0YA 5EI4A 5FG5A 3HMFA 4BW3A 3O36A 5DFCA 5DYAA 5DFBA 4NS5A 5I88A 4O71A 4O7FA 5FFWA 4O77A 4F3IA 5LKZA 5LJ1A 3SVHA 2YELA 5FE9A 4TYLA 5H1TA 5H85A 5L8TA 4NRBA 5EPBA 2F6JA 4PCEA 5DW1A 3U5PA 5COIA 5CZGA 5DBMA 4MR4A 5DKCA 5A5NA 5AD2A 4Z6HA 4BJXA 4BW2A 4QR3A 5DW2A 5LVRA 4BHWA 2DVRA 5L96A 3O34A 4YYNA 3LXJA 5ENEA 2GRCA 4GPJA 4NYWA 2YDWA 2R0SA 4Z1SA 4PTBA 1E6IA 3JVLA 5L99A 5HFQA 5CRZA 5FE1A 3UV5A 5CP5A 4YBMA 5A5PA 3P1FA 5LJ0A 4Z93A 3JVMA 5I40A 4NR9A 4YYDA 4Z1QA 4QSVA 5D3PA 2N9GA 5I86A 5FE8A 4N4GA 5EICA 4QEWA 5KTWA 5E73A 4N3WA 5TB6A 5H1UA 5A5SA 5I29A 5L8UA 5EWWA 3MXFA 3Q2FA 3UV2A 4YY4A 3UV4A 1WUGA 4UYFA 2YQDA 3AQAA 4NUDA 3U5OA 5CRMA 4TZ8A 2WP2A 5ETDA 5F63A 5HQ7A 4O7CA 5DLXA 4UIYA 5I80A 2KTBB 5HM0A 3UVYA 4UITA 4NQMA 2YEKA 3JVJA 4QR4A 2E7NA 3G0LA 4J1PA 5ACYA 5D3LA 4NR5A 2YYNA 4QSSA 4WHUA 4CFLA 3MB3A 5ENCA 3DWYA 5LJ2A 4XUAA 4OGIA 5LKXA 5D25A 4HXKA 1N72A 4MEQA 5EWHA 5I7YA 4LZSA 4RVRA 4A9EA 5F3AA 4NR7A 5IBNA 4J0RA 4UYDA 5J0DA 5D3TA 5A5QA 4LRGA 5G4SA 5CUGA 5G4RA 5FFYA 5FH6A 5KU3A 5CTLA 4QB3A 4IOOA 4LDFA 5C85A 5JI8A 5CGPA 4TTEA 4NQNA 5HQ6A 5ENIA 2RS9B 4HXSA 4HBVA 5CQ6A 5EPSA 4XUBA 4KV4A 5FFVA 2OUOA 5CQ8A 4UIVA 3AADA 5FG4A 5EV9A 4QSTA 5KHMA 4Q0OA 3MQMA 2RI7A 2FSAA 4CUUA 5D3NA 2E7OA 3LQHA 5E3DA 4QEVA 5ENGA 3SVFA 4OUFA 5E3GA 4HXNA 5HEMA 5C89A 4NUCA 5AMFA 4A9OA 4QSQA 5HQ5A 5KTXA 4A9IA 5H1VA 5DYCA 4TT4A 5FDZA 3D7CA 3LQIA 4O70A 2R0VA 4N4HA 4A9NA 4J0SA 4TQNA 4HBWA 3MB4A 5HLSA 4LC2A 4A9LA 5KTUA 4LZ2A 3I3JA 3P1CA 5D3HA 2D82A 5EQ1A 4UYEA 5HFRA 4CUQA 5F25A 5I83A 4QUUA 3S92A 3SVGA 5BT3A 4YYIA 5E0RA 2RFJA 3IU5A 2YEMA 5CUCA 4QYLA 5FE4A 5EISA 4CURA 4NUEA 5TCMA 4C67A 4HXOA 4PS5A 2D9EA 4YY6A 5CQ3A 4UYHA 1JM4B 3P1DA 4IR5A 4LYWA 4TS8A 5F1LA 5CS8A 5I7XA 5IGLA 4YATA 4A9HA 2F6NA 4NYXA 4PCIA 4PY6A 3MULA 2WP1A 4HXLA 4TU6A 5CUEA 5L98A 4IR3A 4O74A 4YBSA 5JWMA 4E96A 3O35A 4O7AA 4CUSA 4OGJA 4ZC9A 4LYSA 4QC3A 4YYMA 3K2JA 5ENJA 4X2IA 4QYDA 2DVQA 5F1HA 5CPEA 5A82A 4YYGA 5CUAA 4YH3A 3UVWA 4QSWA 3UVXA 5E9KA 4NR8A 4CL9A 5FE3A 4ZW1A 5HRXA 5LUUA 4QSRA 5CQTA 2G4AA 5EK9A 5L97A 4XY8A 4DONA 2RNWA 5C7NA 5LVQA 3QZTA 4UIUA 4YC9A 3U5NA 4FLPA 5EP7A 5FH8A 3UVDA 5DFDA 2OO1A 2RNYA 5BT5A 3HMEA 5FE7A 5HENA 4A9KA 4HBXA 5II1A 5EA1A 3JVKA 5EWDA 5HRVA 5DYXA 4QZSA 4A9FA 5E74A 4TT6A 1F68A 5CQ7A 4YABA 3P1EA 5BT4A 4HXRA 3HMHA 2I8NA 5E9YA 4Z6IA 4IOQA 5IGKA 5D24A 5FH7A 2L5EA 2L84A 5FB0A 5EGUA 5CUDA 5DKDA 5ETBA 4O7EA 4O75A 5EU1A 4KCXA 4YH4A 5CUBA 4NRAA 2DATA 4TU4A 4WHWA 4IR4A 5IGNA 1WUMA 5F62A 4UIZA 4UIXA 4N4FA 5D26A 3NXBA 4Y03A 5CQ4A 2DWWA 4HXMA 5EVAA 4BW4A 3S91A 5EM3A 2L85A 3QZVA 4MEOA 4YADA
chains in the Genus database with same CATH superfamily
5A83A 1ZS5A 4ALHA 4IORA 4KV1A 4YYJA 4O76A 5CQAA 3U5LA 3ONIA 3RCWA 4BW1A 4NYVA 5A5OA 4UYFB 5C4QA 4O78A 4C66A 5C87A 1EQFA 5LKTA 3G0JA 2R10A 4J3IA 5E7DA 5ENBA 4AKNA 4YYHA 5KO4A 5A5RA 3O37A 4QR5A 4ALGA 4QUTA 4XYAA 2LSPB 4O7BA 4NRCA 4A9JA 5HRWA 5FG6A 1JSPB 4YAXA 5E9VA 5DKHA 5HJCA 5AD3A 3DAIA 4MR5A 4QSPA 5C8GA 3TLPA 5CQ5A 3QZSA 5K29A 4CFKA 4IR6A 5CY9A 5EPRA 3U5JA 4QSXA 5D0CA 3U5MA 5LKUA 4MEPA 5DY7A 4CUPA 4CLBA 4QSUA 4MR6A 2DVVA 2DVSA 4LZRA 2H60A 5FE6A 4YK0A 5A85A 5HELA 5D3JA 5E9MA 5A7CA 4CUTA 5DX4A 2MJVB 4UIWA 3ERRA 5IG6A 4TZ2A 5F36A 4HXPA 2I7KA 1PUOA 3LQJA 4MENA 4NXJA 5D3RA 4A9MA 5I89A 4Q0NA 4YBTA 5D7XA 5A81A 5FBXA 4TT2A 5CU8A 5FE5A 4QY4A 5I1QA 1X0JA 4LR6A 4N4IA 3LJWA 4PKLA 3U5KA 5ENFA 4QC1A 5IGMA 3Q2EA 4NR6A 4O72A 4QBMA 4XY9A 5DLZA 5CFWA 2RO1A 2OSSA 5F61A 5FE2A 4ZQLA 5E9LA 3FKMX 2NXBA 4HBYA 3MUKA 3ZYUA 2YW5A 4LYIA 2DKWA 5AMEA 5EWCA 5EWVA 5HCLA 5E9IA 3O33A 5F60A 4QNSA 5IIDA 5FE0A 4NR4A 4WIVA 5D3SA 3P5OA 3UW9A 2E3KA 2RNXA 4UYGA 5ENHA 3GG3A 5FB1A 5F2PA 5DYUA 5F5ZA 5II2A 4YYKA 3IU6A 4QEUA 4MR3A 2R0YA 5EI4A 5FG5A 3HMFA 4BW3A 3O36A 5DFCA 5DYAA 5DFBA 4NS5A 5I88A 4O71A 4O7FA 5FFWA 4O77A 3D1BA 4F3IA 5LKZA 5LJ1A 3SVHA 4AKIA 3D1DA 2YELA 5FE9A 4TYLA 5H1TA 5H85A 5L8TA 4NRBA 5EPBA 2F6JA 4PCEA 5DW1A 3U5PA 5COIA 5CZGA 5DBMA 4MR4A 5DKCA 5A5NA 5AD2A 4Z6HA 4BJXA 4BW2A 4QR3A 5DW2A 5LVRA 4BHWA 2DVRA 5L96A 3O34A 4YYNA 3LXJA 5ENEA 2GRCA 4GPJA 4NYWA 2YDWA 2R0SA 4AKHA 4Z1SA 4PTBA 1E6IA 3JVLA 5L99A 5HFQA 5CRZA 5FE1A 3UV5A 5CP5A 4YBMA 5A5PA 3P1FA 5LJ0A 4Z93A 3JVMA 5I40A 4NR9A 4YYDA 4Z1QA 4QSVA 5D3PA 2N9GA 5I86A 5FE8A 4N4GA 5EICA 4QEWA 5KTWA 5E73A 4N3WA 5TB6A 5H1UA 5A5SA 5I29A 5L8UA 5EWWA 3MXFA 3Q2FA 3UV2A 4YY4A 3UV4A 1WUGA 4UYFA 2YQDA 3AQAA 4NUDA 3U5OA 5CRMA 4TZ8A 2WP2A 5ETDA 5F63A 5HQ7A 4O7CA 5DLXA 4UIYA 5I80A 2KTBB 5HM0A 3UVYA 4UITA 4NQMA 2YEKA 3JVJA 4QR4A 2E7NA 3G0LA 4J1PA 5ACYA 5D3LA 4NR5A 2YYNA 4QSSA 4WHUA 4CFLA 3MB3A 5ENCA 3DWYA 5LJ2A 4XUAA 4OGIA 5LKXA 5D25A 4HXKA 1N72A 4MEQA 5EWHA 4AKGA 5I7YA 4LZSA 4RVRA 4A9EA 5F3AA 4NR7A 5IBNA 4J0RA 4UYDA 5J0DA 5D3TA 5A5QA 4LRGA 5G4SA 5CUGA 5G4RA 5FFYA 5FH6A 5KU3A 5CTLA 4QB3A 4IOOA 4LDFA 5C85A 5JI8A 5CGPA 4TTEA 4NQNA 5HQ6A 5ENIA 2RS9B 4HXSA 4HBVA 5CQ6A 5EPSA 4XUBA 4KV4A 5FFVA 2OUOA 5CQ8A 4UIVA 3AADA 5FG4A 5EV9A 4QSTA 5KHMA 4Q0OA 3MQMA 2RI7A 2FSAA 4CUUA 4AI6A 5D3NA 2E7OA 3LQHA 5E3DA 4QEVA 5ENGA 3SVFA 4OUFA 5E3GA 4HXNA 5HEMA 5C89A 4NUCA 5AMFA 4A9OA 4QSQA 5HQ5A 5KTXA 4A9IA 5H1VA 5DYCA 4TT4A 5FDZA 3D7CA 3LQIA 4O70A 2R0VA 4N4HA 4A9NA 4J0SA 4TQNA 4HBWA 3MB4A 5HLSA 4LC2A 2EJNA 4A9LA 5KTUA 4LZ2A 3I3JA 3P1CA 5D3HA 2D82A 5EQ1A 4UYEA 5HFRA 4CUQA 5F25A 5I83A 4QUUA 3S92A 3SVGA 5BT3A 4YYIA 5E0RA 2RFJA 3IU5A 2YEMA 5CUCA 4QYLA 5FE4A 5EISA 4CURA 4NUEA 5TCMA 4C67A 4HXOA 4PS5A 2D9EA 4YY6A 5CQ3A 4UYHA 1JM4B 3P1DA 4IR5A 4LYWA 1ZKRA 4TS8A 5F1LA 5CS8A 5I7XA 5IGLA 4YATA 4A9HA 2F6NA 4NYXA 4PCIA 4PY6A 3MULA 2WP1A 4HXLA 4TU6A 5CUEA 5L98A 4IR3A 4O74A 4YBSA 5JWMA 4E96A 3O35A 4O7AA 4CUSA 4OGJA 4ZC9A 4LYSA 4QC3A 4YYMA 3K2JA 5ENJA 4X2IA 4QYDA 2DVQA 5F1HA 5CPEA 5A82A 4YYGA 5CUAA 4YH3A 3UVWA 4QSWA 3UVXA 5E9KA 4NR8A 4CL9A 5FE3A 4ZW1A 5HRXA 5LUUA 4QSRA 5CQTA 2G4AA 5EK9A 5L97A 4XY8A 4DONA 2RNWA 5C7NA 5LVQA 3QZTA 4UIUA 4YC9A 3U5NA 4FLPA 5EP7A 5FH8A 3UVDA 5DFDA 3VKHA 2OO1A 2RNYA 5BT5A 3HMEA 5FE7A 5HENA 4A9KA 4HBXA 5II1A 5EA1A 3JVKA 5EWDA 5HRVA 5DYXA 4QZSA 4A9FA 5E74A 4TT6A 1F68A 5CQ7A 4YABA 3P1EA 5BT4A 4HXRA 3HMHA 2I8NA 5E9YA 4Z6IA 4IOQA 5IGKA 5D24A 5FH7A 2L5EA 2L84A 5FB0A 5EGUA 5CUDA 5DKDA 5ETBA 4O7EA 4O75A 5EU1A 4KCXA 4YH4A 5CUBA 4NRAA 2DATA 4TU4A 4WHWA 4IR4A 5IGNA 1WUMA 5F62A 4UIZA 4UIXA 4N4FA 5D26A 3NXBA 4Y03A 5CQ4A 2DWWA 4HXMA 5EVAA 4BW4A 3S91A 5EM3A 2L85A 3QZVA 3VKGA 4MEOA 4YADA
chains in the Genus database with same CATH topology
5A83A 1ZS5A 4ALHA 4IORA 4KV1A 4YYJA 4O76A 5CQAA 3U5LA 3ONIA 3RCWA 4BW1A 4NYVA 5A5OA 4UYFB 5C4QA 4O78A 4C66A 5C87A 1EQFA 5LKTA 3G0JA 2R10A 4J3IA 5E7DA 5ENBA 4AKNA 4YYHA 5KO4A 5A5RA 3O37A 4QR5A 4ALGA 4QUTA 4XYAA 2LSPB 4O7BA 4NRCA 4A9JA 5HRWA 5FG6A 1JSPB 4YAXA 5E9VA 5DKHA 5HJCA 5AD3A 3DAIA 4MR5A 4QSPA 5C8GA 3TLPA 5CQ5A 3QZSA 5K29A 4CFKA 4IR6A 5CY9A 5EPRA 3U5JA 4QSXA 5D0CA 3U5MA 5LKUA 4MEPA 5DY7A 4CUPA 4CLBA 4QSUA 4MR6A 2DVVA 2DVSA 4LZRA 2H60A 5FE6A 4YK0A 5A85A 5HELA 5D3JA 5E9MA 5A7CA 4CUTA 5DX4A 2MJVB 4UIWA 5IG6A 4TZ2A 5F36A 4HXPA 2I7KA 3LQJA 4MENA 4NXJA 5D3RA 4A9MA 5I89A 4Q0NA 4YBTA 5D7XA 5A81A 5FBXA 4TT2A 5CU8A 5FE5A 4QY4A 5I1QA 1X0JA 4LR6A 4N4IA 3LJWA 4PKLA 3U5KA 5ENFA 4QC1A 5IGMA 3Q2EA 4NR6A 4O72A 4QBMA 4XY9A 5DLZA 5CFWA 2RO1A 2OSSA 5F61A 5FE2A 4ZQLA 5E9LA 3FKMX 2NXBA 4HBYA 3MUKA 3ZYUA 2YW5A 4LYIA 2DKWA 5AMEA 5EWCA 5EWVA 5HCLA 5E9IA 3O33A 5F60A 4QNSA 5IIDA 5FE0A 4NR4A 4WIVA 5D3SA 3P5OA 3UW9A 2E3KA 2RNXA 4UYGA 5ENHA 3GG3A 5FB1A 5F2PA 5DYUA 5F5ZA 5II2A 4YYKA 3IU6A 4QEUA 4MR3A 2R0YA 5EI4A 5FG5A 3HMFA 4BW3A 3O36A 5DFCA 5DYAA 5DFBA 4NS5A 5I88A 4O71A 4O7FA 5FFWA 4O77A 4F3IA 5LKZA 5LJ1A 3SVHA 2YELA 5FE9A 4TYLA 5H1TA 5H85A 5L8TA 4NRBA 5EPBA 2F6JA 4PCEA 5DW1A 3U5PA 5COIA 5CZGA 5DBMA 4MR4A 5DKCA 5A5NA 5AD2A 4Z6HA 4BJXA 4BW2A 4QR3A 5DW2A 5LVRA 4BHWA 2DVRA 5L96A 3O34A 4YYNA 3LXJA 5ENEA 2GRCA 4GPJA 4NYWA 2YDWA 2R0SA 4Z1SA 4PTBA 1E6IA 3JVLA 5L99A 5HFQA 5CRZA 5FE1A 3UV5A 5CP5A 4YBMA 5A5PA 3P1FA 5LJ0A 4Z93A 3JVMA 5I40A 4NR9A 4YYDA 4Z1QA 4QSVA 5D3PA 2N9GA 5I86A 5FE8A 4N4GA 5EICA 4QEWA 5KTWA 5E73A 4N3WA 5TB6A 5H1UA 5A5SA 5I29A 5L8UA 5EWWA 3MXFA 3Q2FA 3UV2A 4YY4A 3UV4A 1WUGA 4UYFA 2YQDA 3AQAA 4NUDA 3U5OA 5CRMA 4TZ8A 2WP2A 5ETDA 5F63A 5HQ7A 4O7CA 5DLXA 4UIYA 5I80A 2KTBB 5HM0A 3UVYA 4UITA 4NQMA 2YEKA 3JVJA 4QR4A 2E7NA 3G0LA 4J1PA 5ACYA 5D3LA 4NR5A 2YYNA 4QSSA 4WHUA 4CFLA 3MB3A 5ENCA 3DWYA 5LJ2A 4XUAA 4OGIA 5LKXA 5D25A 4HXKA 1N72A 4MEQA 5EWHA 5I7YA 4LZSA 4RVRA 4A9EA 5F3AA 4NR7A 5IBNA 4J0RA 4UYDA 5J0DA 5D3TA 5A5QA 4LRGA 5G4SA 5CUGA 5G4RA 5FFYA 5FH6A 5KU3A 5CTLA 4QB3A 4IOOA 4LDFA 5C85A 5JI8A 5CGPA 4TTEA 4NQNA 5HQ6A 5ENIA 2RS9B 4HXSA 4HBVA 5CQ6A 5EPSA 4XUBA 4KV4A 5FFVA 2OUOA 5CQ8A 4UIVA 3AADA 5FG4A 5EV9A 4QSTA 5KHMA 4Q0OA 3MQMA 2RI7A 2FSAA 4CUUA 5D3NA 2E7OA 3LQHA 5E3DA 4QEVA 5ENGA 3SVFA 4OUFA 5E3GA 4HXNA 5HEMA 5C89A 4NUCA 5AMFA 4A9OA 4QSQA 5HQ5A 5KTXA 4A9IA 5H1VA 5DYCA 4TT4A 5FDZA 3D7CA 3LQIA 4O70A 2R0VA 4N4HA 4A9NA 4J0SA 4TQNA 4HBWA 3MB4A 5HLSA 4LC2A 4A9LA 5KTUA 4LZ2A 3I3JA 3P1CA 5D3HA 2D82A 5EQ1A 4UYEA 5HFRA 4CUQA 5F25A 5I83A 4QUUA 3S92A 3SVGA 5BT3A 4YYIA 5E0RA 2RFJA 3IU5A 2YEMA 5CUCA 4QYLA 5FE4A 5EISA 4CURA 4NUEA 5TCMA 4C67A 4HXOA 4PS5A 2D9EA 4YY6A 5CQ3A 4UYHA 1JM4B 3P1DA 4IR5A 4LYWA 4TS8A 5F1LA 5CS8A 5I7XA 5IGLA 4YATA 4A9HA 2F6NA 4NYXA 4PCIA 4PY6A 3MULA 2WP1A 4HXLA 4TU6A 5CUEA 5L98A 4IR3A 4O74A 4YBSA 5JWMA 4E96A 3O35A 4O7AA 4CUSA 4OGJA 4ZC9A 4LYSA 4QC3A 4YYMA 3K2JA 5ENJA 4X2IA 4QYDA 2DVQA 5F1HA 5CPEA 5A82A 4YYGA 5CUAA 4YH3A 3UVWA 4QSWA 3UVXA 5E9KA 4NR8A 4CL9A 5FE3A 4ZW1A 5HRXA 5LUUA 4QSRA 5CQTA 2G4AA 5EK9A 5L97A 4XY8A 4DONA 2RNWA 5C7NA 5LVQA 3QZTA 4UIUA 4YC9A 3U5NA 4FLPA 5EP7A 5FH8A 3UVDA 5DFDA 2OO1A 2RNYA 5BT5A 3HMEA 5FE7A 5HENA 4A9KA 4HBXA 5II1A 5EA1A 3JVKA 5EWDA 5HRVA 5DYXA 4QZSA 4A9FA 5E74A 4TT6A 1F68A 5CQ7A 4YABA 3P1EA 5BT4A 4HXRA 3HMHA 2I8NA 5E9YA 4Z6IA 4IOQA 5IGKA 5D24A 5FH7A 2L5EA 2L84A 5FB0A 5EGUA 5CUDA 5DKDA 5ETBA 4O7EA 4O75A 5EU1A 4KCXA 4YH4A 5CUBA 4NRAA 2DATA 4TU4A 4WHWA 4IR4A 5IGNA 1WUMA 5F62A 4UIZA 4UIXA 4N4FA 5D26A 3NXBA 4Y03A 5CQ4A 2DWWA 4HXMA 5EVAA 4BW4A 3S91A 5EM3A 2L85A 3QZVA 4MEOA 4YADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A83 A;  1ZS5 A;  4ALH A;  4IOR A;  4KV1 A;  4YYJ A;  4O76 A;  5CQA A;  3U5L A;  3ONI A;  3RCW A;  4BW1 A;  4NYV A;  5A5O A;  4UYF B;  5C4Q A;  4O78 A;  4C66 A;  5C87 A;  1EQF A;  5LKT A;  3G0J A;  2R10 A;  4J3I A;  5E7D A;  5ENB A;  4AKN A;  4YYH A;  5KO4 A;  5A5R A;  3O37 A;  4QR5 A;  4ALG A;  4QUT A;  4XYA A;  2LSP B;  4O7B A;  4NRC A;  4A9J A;  5HRW A;  5FG6 A;  1JSP B;  4YAX A;  5E9V A;  5DKH A;  5HJC A;  5AD3 A;  3DAI A;  4MR5 A;  4QSP A;  5C8G A;  3TLP A;  5CQ5 A;  3QZS A;  5K29 A;  4CFK A;  4IR6 A;  5CY9 A;  5EPR A;  3U5J A;  4QSX A;  5D0C A;  3U5M A;  5LKU A;  4MEP A;  5DY7 A;  4CUP A;  4CLB A;  4QSU A;  4MR6 A;  2DVV A;  2DVS A;  4LZR A;  2H60 A;  5FE6 A;  4YK0 A;  5A85 A;  5HEL A;  5D3J A;  5E9M A;  5A7C A;  4CUT A;  5DX4 A;  2MJV B;  4UIW A;  5IG6 A;  4TZ2 A;  5F36 A;  4HXP A;  2I7K A;  3LQJ A;  4MEN A;  4NXJ A;  5D3R A;  4A9M A;  5I89 A;  4Q0N A;  4YBT A;  5D7X A;  5A81 A;  5FBX A;  4TT2 A;  5CU8 A;  5FE5 A;  4QY4 A;  5I1Q A;  1X0J A;  4LR6 A;  4N4I A;  3LJW A;  4PKL A;  3U5K A;  5ENF A;  4QC1 A;  5IGM A;  3Q2E A;  4NR6 A;  4O72 A;  4QBM A;  4XY9 A;  5DLZ A;  5CFW A;  2RO1 A;  2OSS A;  5F61 A;  5FE2 A;  4ZQL A;  5E9L A;  3FKM X;  2NXB A;  4HBY A;  3MUK A;  3ZYU A;  2YW5 A;  4LYI A;  2DKW A;  5AME A;  5EWC A;  5EWV A;  5HCL A;  5E9I A;  3O33 A;  5F60 A;  4QNS A;  5IID A;  5FE0 A;  4NR4 A;  4WIV A;  5D3S A;  3P5O A;  3UW9 A;  2E3K A;  2RNX A;  4UYG A;  5ENH A;  3GG3 A;  5FB1 A;  5F2P A;  5DYU A;  5F5Z A;  5II2 A;  4YYK A;  3IU6 A;  4QEU A;  4MR3 A;  2R0Y A;  5EI4 A;  5FG5 A;  3HMF A;  4BW3 A;  3O36 A;  5DFC A;  5DYA A;  5DFB A;  4NS5 A;  5I88 A;  4O71 A;  4O7F A;  5FFW A;  4O77 A;  4F3I A;  5LKZ A;  5LJ1 A;  3SVH A;  2YEL A;  5FE9 A;  4TYL A;  5H1T A;  5H85 A;  5L8T A;  4NRB A;  5EPB A;  2F6J A;  4PCE A;  5DW1 A;  3U5P A;  5COI A;  5CZG A;  5DBM A;  4MR4 A;  5DKC A;  5A5N A;  5AD2 A;  4Z6H A;  4BJX A;  4BW2 A;  4QR3 A;  5DW2 A;  5LVR A;  4BHW A;  2DVR A;  5L96 A;  3O34 A;  4YYN A;  3LXJ A;  5ENE A;  2GRC A;  4GPJ A;  4NYW A;  2YDW A;  2R0S A;  4Z1S A;  4PTB A;  1E6I A;  3JVL A;  5L99 A;  5HFQ A;  5CRZ A;  5FE1 A;  3UV5 A;  5CP5 A;  4YBM A;  5A5P A;  3P1F A;  5LJ0 A;  4Z93 A;  3JVM A;  5I40 A;  4NR9 A;  4YYD A;  4Z1Q A;  4QSV A;  5D3P A;  2N9G A;  5I86 A;  5FE8 A;  4N4G A;  5EIC A;  4QEW A;  5KTW A;  5E73 A;  4N3W A;  5TB6 A;  5H1U A;  5A5S A;  5I29 A;  5L8U A;  5EWW A;  3MXF A;  3Q2F A;  3UV2 A;  4YY4 A;  3UV4 A;  1WUG A;  4UYF A;  2YQD A;  3AQA A;  4NUD A;  3U5O A;  5CRM A;  4TZ8 A;  2WP2 A;  5ETD A;  5F63 A;  5HQ7 A;  4O7C A;  5DLX A;  4UIY A;  5I80 A;  2KTB B;  5HM0 A;  3UVY A;  4UIT A;  4NQM A;  2YEK A;  3JVJ A;  4QR4 A;  2E7N A;  3G0L A;  4J1P A;  5ACY A;  5D3L A;  4NR5 A;  2YYN A;  4QSS A;  4WHU A;  4CFL A;  3MB3 A;  5ENC A;  3DWY A;  5LJ2 A;  4XUA A;  4OGI A;  5LKX A;  5D25 A;  4HXK A;  1N72 A;  4MEQ A;  5EWH A;  5I7Y A;  4LZS A;  4RVR A;  4A9E A;  5F3A A;  4NR7 A;  5IBN A;  4J0R A;  4UYD A;  5J0D A;  5D3T A;  5A5Q A;  4LRG A;  5G4S A;  5CUG A;  5G4R A;  5FFY A;  5FH6 A;  5KU3 A;  5CTL A;  4QB3 A;  4IOO A;  4LDF A;  5C85 A;  5JI8 A;  5CGP A;  4TTE A;  4NQN A;  5HQ6 A;  5ENI A;  2RS9 B;  4HXS A;  4HBV A;  5CQ6 A;  5EPS A;  4XUB A;  4KV4 A;  5FFV A;  2OUO A;  5CQ8 A;  4UIV A;  3AAD A;  5FG4 A;  5EV9 A;  4QST A;  5KHM A;  4Q0O A;  3MQM A;  2RI7 A;  2FSA A;  4CUU A;  5D3N A;  2E7O A;  3LQH A;  5E3D A;  4QEV A;  5ENG A;  3SVF A;  4OUF A;  5E3G A;  4HXN A;  5HEM A;  5C89 A;  4NUC A;  5AMF A;  4A9O A;  4QSQ A;  5HQ5 A;  5KTX A;  4A9I A;  5H1V A;  5DYC A;  4TT4 A;  5FDZ A;  3D7C A;  3LQI A;  4O70 A;  2R0V A;  4N4H A;  4A9N A;  4J0S A;  4TQN A;  4HBW A;  3MB4 A;  5HLS A;  4LC2 A;  4A9L A;  5KTU A;  4LZ2 A;  3I3J A;  3P1C A;  5D3H A;  2D82 A;  5EQ1 A;  4UYE A;  5HFR A;  4CUQ A;  5F25 A;  5I83 A;  4QUU A;  3S92 A;  3SVG A;  5BT3 A;  4YYI A;  5E0R A;  2RFJ A;  3IU5 A;  2YEM A;  5CUC A;  4QYL A;  5FE4 A;  5EIS A;  4CUR A;  4NUE A;  5TCM A;  4C67 A;  4HXO A;  4PS5 A;  2D9E A;  4YY6 A;  5CQ3 A;  4UYH A;  1JM4 B;  3P1D A;  4IR5 A;  4LYW A;  4TS8 A;  5F1L A;  5CS8 A;  5I7X A;  5IGL A;  4YAT A;  4A9H A;  2F6N A;  4NYX A;  4PCI A;  4PY6 A;  3MUL A;  2WP1 A;  4HXL A;  4TU6 A;  5CUE A;  5L98 A;  4IR3 A;  4O74 A;  4YBS A;  5JWM A;  4E96 A;  3O35 A;  4O7A A;  4CUS A;  4OGJ A;  4ZC9 A;  4LYS A;  4QC3 A;  4YYM A;  3K2J A;  5ENJ A;  4X2I A;  4QYD A;  2DVQ A;  5F1H A;  5CPE A;  5A82 A;  4YYG A;  5CUA A;  4YH3 A;  3UVW A;  4QSW A;  3UVX A;  5E9K A;  4NR8 A;  4CL9 A;  5FE3 A;  4ZW1 A;  5HRX A;  5LUU A;  4QSR A;  5CQT A;  2G4A A;  5EK9 A;  5L97 A;  4XY8 A;  4DON A;  2RNW A;  5C7N A;  5LVQ A;  3QZT A;  4UIU A;  4YC9 A;  3U5N A;  4FLP A;  5EP7 A;  5FH8 A;  3UVD A;  5DFD A;  2OO1 A;  2RNY A;  5BT5 A;  3HME A;  5FE7 A;  5HEN A;  4A9K A;  4HBX A;  5II1 A;  5EA1 A;  3JVK A;  5EWD A;  5HRV A;  5DYX A;  4QZS A;  4A9F A;  5E74 A;  4TT6 A;  1F68 A;  5CQ7 A;  4YAB A;  3P1E A;  5BT4 A;  4HXR A;  3HMH A;  2I8N A;  5E9Y A;  4Z6I A;  4IOQ A;  5IGK A;  5D24 A;  5FH7 A;  2L5E A;  2L84 A;  5FB0 A;  5EGU A;  5CUD A;  5DKD A;  5ETB A;  4O7E A;  4O75 A;  5EU1 A;  4KCX A;  4YH4 A;  5CUB A;  4NRA A;  2DAT A;  4TU4 A;  4WHW A;  4IR4 A;  5IGN A;  1WUM A;  5F62 A;  4UIZ A;  4UIX A;  4N4F A;  5D26 A;  3NXB A;  4Y03 A;  5CQ4 A;  2DWW A;  4HXM A;  5EVA A;  4BW4 A;  3S91 A;  5EM3 A;  2L85 A;  3QZV A;  4MEO A;  4YAD A; 
#chains in the Genus database with same CATH topology
 5A83 A;  1ZS5 A;  4ALH A;  4IOR A;  4KV1 A;  4YYJ A;  4O76 A;  5CQA A;  3U5L A;  3ONI A;  3RCW A;  4BW1 A;  4NYV A;  5A5O A;  4UYF B;  5C4Q A;  4O78 A;  4C66 A;  5C87 A;  1EQF A;  5LKT A;  3G0J A;  2R10 A;  4J3I A;  5E7D A;  5ENB A;  4AKN A;  4YYH A;  5KO4 A;  5A5R A;  3O37 A;  4QR5 A;  4ALG A;  4QUT A;  4XYA A;  2LSP B;  4O7B A;  4NRC A;  4A9J A;  5HRW A;  5FG6 A;  1JSP B;  4YAX A;  5E9V A;  5DKH A;  5HJC A;  5AD3 A;  3DAI A;  4MR5 A;  4QSP A;  5C8G A;  3TLP A;  5CQ5 A;  3QZS A;  5K29 A;  4CFK A;  4IR6 A;  5CY9 A;  5EPR A;  3U5J A;  4QSX A;  5D0C A;  3U5M A;  5LKU A;  4MEP A;  5DY7 A;  4CUP A;  4CLB A;  4QSU A;  4MR6 A;  2DVV A;  2DVS A;  4LZR A;  2H60 A;  5FE6 A;  4YK0 A;  5A85 A;  5HEL A;  5D3J A;  5E9M A;  5A7C A;  4CUT A;  5DX4 A;  2MJV B;  4UIW A;  3ERR A;  5IG6 A;  4TZ2 A;  5F36 A;  4HXP A;  2I7K A;  1PUO A;  3LQJ A;  4MEN A;  4NXJ A;  5D3R A;  4A9M A;  5I89 A;  4Q0N A;  4YBT A;  5D7X A;  5A81 A;  5FBX A;  4TT2 A;  5CU8 A;  5FE5 A;  4QY4 A;  5I1Q A;  1X0J A;  4LR6 A;  4N4I A;  3LJW A;  4PKL A;  3U5K A;  5ENF A;  4QC1 A;  5IGM A;  3Q2E A;  4NR6 A;  4O72 A;  4QBM A;  4XY9 A;  5DLZ A;  5CFW A;  2RO1 A;  2OSS A;  5F61 A;  5FE2 A;  4ZQL A;  5E9L A;  3FKM X;  2NXB A;  4HBY A;  3MUK A;  3ZYU A;  2YW5 A;  4LYI A;  2DKW A;  5AME A;  5EWC A;  5EWV A;  5HCL A;  5E9I A;  3O33 A;  5F60 A;  4QNS A;  5IID A;  5FE0 A;  4NR4 A;  4WIV A;  5D3S A;  3P5O A;  3UW9 A;  2E3K A;  2RNX A;  4UYG A;  5ENH A;  3GG3 A;  5FB1 A;  5F2P A;  5DYU A;  5F5Z A;  5II2 A;  4YYK A;  3IU6 A;  4QEU A;  4MR3 A;  2R0Y A;  5EI4 A;  5FG5 A;  3HMF A;  4BW3 A;  3O36 A;  5DFC A;  5DYA A;  5DFB A;  4NS5 A;  5I88 A;  4O71 A;  4O7F A;  5FFW A;  4O77 A;  3D1B A;  4F3I A;  5LKZ A;  5LJ1 A;  3SVH A;  4AKI A;  3D1D A;  2YEL A;  5FE9 A;  4TYL A;  5H1T A;  5H85 A;  5L8T A;  4NRB A;  5EPB A;  2F6J A;  4PCE A;  5DW1 A;  3U5P A;  5COI A;  5CZG A;  5DBM A;  4MR4 A;  5DKC A;  5A5N A;  5AD2 A;  4Z6H A;  4BJX A;  4BW2 A;  4QR3 A;  5DW2 A;  5LVR A;  4BHW A;  2DVR A;  5L96 A;  3O34 A;  4YYN A;  3LXJ A;  5ENE A;  2GRC A;  4GPJ A;  4NYW A;  2YDW A;  2R0S A;  4AKH A;  4Z1S A;  4PTB A;  1E6I A;  3JVL A;  5L99 A;  5HFQ A;  5CRZ A;  5FE1 A;  3UV5 A;  5CP5 A;  4YBM A;  5A5P A;  3P1F A;  5LJ0 A;  4Z93 A;  3JVM A;  5I40 A;  4NR9 A;  4YYD A;  4Z1Q A;  4QSV A;  5D3P A;  2N9G A;  5I86 A;  5FE8 A;  4N4G A;  5EIC A;  4QEW A;  5KTW A;  5E73 A;  4N3W A;  5TB6 A;  5H1U A;  5A5S A;  5I29 A;  5L8U A;  5EWW A;  3MXF A;  3Q2F A;  3UV2 A;  4YY4 A;  3UV4 A;  1WUG A;  4UYF A;  2YQD A;  3AQA A;  4NUD A;  3U5O A;  5CRM A;  4TZ8 A;  2WP2 A;  5ETD A;  5F63 A;  5HQ7 A;  4O7C A;  5DLX A;  4UIY A;  5I80 A;  2KTB B;  5HM0 A;  3UVY A;  4UIT A;  4NQM A;  2YEK A;  3JVJ A;  4QR4 A;  2E7N A;  3G0L A;  4J1P A;  5ACY A;  5D3L A;  4NR5 A;  2YYN A;  4QSS A;  4WHU A;  4CFL A;  3MB3 A;  5ENC A;  3DWY A;  5LJ2 A;  4XUA A;  4OGI A;  5LKX A;  5D25 A;  4HXK A;  1N72 A;  4MEQ A;  5EWH A;  4AKG A;  5I7Y A;  4LZS A;  4RVR A;  4A9E A;  5F3A A;  4NR7 A;  5IBN A;  4J0R A;  4UYD A;  5J0D A;  5D3T A;  5A5Q A;  4LRG A;  5G4S A;  5CUG A;  5G4R A;  5FFY A;  5FH6 A;  5KU3 A;  5CTL A;  4QB3 A;  4IOO A;  4LDF A;  5C85 A;  5JI8 A;  5CGP A;  4TTE A;  4NQN A;  5HQ6 A;  5ENI A;  2RS9 B;  4HXS A;  4HBV A;  5CQ6 A;  5EPS A;  4XUB A;  4KV4 A;  5FFV A;  2OUO A;  5CQ8 A;  4UIV A;  3AAD A;  5FG4 A;  5EV9 A;  4QST A;  5KHM A;  4Q0O A;  3MQM A;  2RI7 A;  2FSA A;  4CUU A;  4AI6 A;  5D3N A;  2E7O A;  3LQH A;  5E3D A;  4QEV A;  5ENG A;  3SVF A;  4OUF A;  5E3G A;  4HXN A;  5HEM A;  5C89 A;  4NUC A;  5AMF A;  4A9O A;  4QSQ A;  5HQ5 A;  5KTX A;  4A9I A;  5H1V A;  5DYC A;  4TT4 A;  5FDZ A;  3D7C A;  3LQI A;  4O70 A;  2R0V A;  4N4H A;  4A9N A;  4J0S A;  4TQN A;  4HBW A;  3MB4 A;  5HLS A;  4LC2 A;  2EJN A;  4A9L A;  5KTU A;  4LZ2 A;  3I3J A;  3P1C A;  5D3H A;  2D82 A;  5EQ1 A;  4UYE A;  5HFR A;  4CUQ A;  5F25 A;  5I83 A;  4QUU A;  3S92 A;  3SVG A;  5BT3 A;  4YYI A;  5E0R A;  2RFJ A;  3IU5 A;  2YEM A;  5CUC A;  4QYL A;  5FE4 A;  5EIS A;  4CUR A;  4NUE A;  5TCM A;  4C67 A;  4HXO A;  4PS5 A;  2D9E A;  4YY6 A;  5CQ3 A;  4UYH A;  1JM4 B;  3P1D A;  4IR5 A;  4LYW A;  1ZKR A;  4TS8 A;  5F1L A;  5CS8 A;  5I7X A;  5IGL A;  4YAT A;  4A9H A;  2F6N A;  4NYX A;  4PCI A;  4PY6 A;  3MUL A;  2WP1 A;  4HXL A;  4TU6 A;  5CUE A;  5L98 A;  4IR3 A;  4O74 A;  4YBS A;  5JWM A;  4E96 A;  3O35 A;  4O7A A;  4CUS A;  4OGJ A;  4ZC9 A;  4LYS A;  4QC3 A;  4YYM A;  3K2J A;  5ENJ A;  4X2I A;  4QYD A;  2DVQ A;  5F1H A;  5CPE A;  5A82 A;  4YYG A;  5CUA A;  4YH3 A;  3UVW A;  4QSW A;  3UVX A;  5E9K A;  4NR8 A;  4CL9 A;  5FE3 A;  4ZW1 A;  5HRX A;  5LUU A;  4QSR A;  5CQT A;  2G4A A;  5EK9 A;  5L97 A;  4XY8 A;  4DON A;  2RNW A;  5C7N A;  5LVQ A;  3QZT A;  4UIU A;  4YC9 A;  3U5N A;  4FLP A;  5EP7 A;  5FH8 A;  3UVD A;  5DFD A;  3VKH A;  2OO1 A;  2RNY A;  5BT5 A;  3HME A;  5FE7 A;  5HEN A;  4A9K A;  4HBX A;  5II1 A;  5EA1 A;  3JVK A;  5EWD A;  5HRV A;  5DYX A;  4QZS A;  4A9F A;  5E74 A;  4TT6 A;  1F68 A;  5CQ7 A;  4YAB A;  3P1E A;  5BT4 A;  4HXR A;  3HMH A;  2I8N A;  5E9Y A;  4Z6I A;  4IOQ A;  5IGK A;  5D24 A;  5FH7 A;  2L5E A;  2L84 A;  5FB0 A;  5EGU A;  5CUD A;  5DKD A;  5ETB A;  4O7E A;  4O75 A;  5EU1 A;  4KCX A;  4YH4 A;  5CUB A;  4NRA A;  2DAT A;  4TU4 A;  4WHW A;  4IR4 A;  5IGN A;  1WUM A;  5F62 A;  4UIZ A;  4UIX A;  4N4F A;  5D26 A;  3NXB A;  4Y03 A;  5CQ4 A;  2DWW A;  4HXM A;  5EVA A;  4BW4 A;  3S91 A;  5EM3 A;  2L85 A;  3QZV A;  3VKG A;  4MEO A;  4YAD A; 
#chains in the Genus database with same CATH homology
 5A83 A;  1ZS5 A;  4ALH A;  4IOR A;  4KV1 A;  4YYJ A;  4O76 A;  5CQA A;  3U5L A;  3ONI A;  3RCW A;  4BW1 A;  4NYV A;  5A5O A;  4UYF B;  5C4Q A;  4O78 A;  4C66 A;  5C87 A;  1EQF A;  5LKT A;  3G0J A;  2R10 A;  4J3I A;  5E7D A;  5ENB A;  4AKN A;  4YYH A;  5KO4 A;  5A5R A;  3O37 A;  4QR5 A;  4ALG A;  4QUT A;  4XYA A;  2LSP B;  4O7B A;  4NRC A;  4A9J A;  5HRW A;  5FG6 A;  1JSP B;  4YAX A;  5E9V A;  5DKH A;  5HJC A;  5AD3 A;  3DAI A;  4MR5 A;  4QSP A;  5C8G A;  3TLP A;  5CQ5 A;  3QZS A;  5K29 A;  4CFK A;  4IR6 A;  5CY9 A;  5EPR A;  3U5J A;  4QSX A;  5D0C A;  3U5M A;  5LKU A;  4MEP A;  5DY7 A;  4CUP A;  4CLB A;  4QSU A;  4MR6 A;  2DVV A;  2DVS A;  4LZR A;  2H60 A;  5FE6 A;  4YK0 A;  5A85 A;  5HEL A;  5D3J A;  5E9M A;  5A7C A;  4CUT A;  5DX4 A;  2MJV B;  4UIW A;  5IG6 A;  4TZ2 A;  5F36 A;  4HXP A;  2I7K A;  3LQJ A;  4MEN A;  4NXJ A;  5D3R A;  4A9M A;  5I89 A;  4Q0N A;  4YBT A;  5D7X A;  5A81 A;  5FBX A;  4TT2 A;  5CU8 A;  5FE5 A;  4QY4 A;  5I1Q A;  1X0J A;  4LR6 A;  4N4I A;  3LJW A;  4PKL A;  3U5K A;  5ENF A;  4QC1 A;  5IGM A;  3Q2E A;  4NR6 A;  4O72 A;  4QBM A;  4XY9 A;  5DLZ A;  5CFW A;  2RO1 A;  2OSS A;  5F61 A;  5FE2 A;  4ZQL A;  5E9L A;  3FKM X;  2NXB A;  4HBY A;  3MUK A;  3ZYU A;  2YW5 A;  4LYI A;  2DKW A;  5AME A;  5EWC A;  5EWV A;  5HCL A;  5E9I A;  3O33 A;  5F60 A;  4QNS A;  5IID A;  5FE0 A;  4NR4 A;  4WIV A;  5D3S A;  3P5O A;  3UW9 A;  2E3K A;  2RNX A;  4UYG A;  5ENH A;  3GG3 A;  5FB1 A;  5F2P A;  5DYU A;  5F5Z A;  5II2 A;  4YYK A;  3IU6 A;  4QEU A;  4MR3 A;  2R0Y A;  5EI4 A;  5FG5 A;  3HMF A;  4BW3 A;  3O36 A;  5DFC A;  5DYA A;  5DFB A;  4NS5 A;  5I88 A;  4O71 A;  4O7F A;  5FFW A;  4O77 A;  4F3I A;  5LKZ A;  5LJ1 A;  3SVH A;  2YEL A;  5FE9 A;  4TYL A;  5H1T A;  5H85 A;  5L8T A;  4NRB A;  5EPB A;  2F6J A;  4PCE A;  5DW1 A;  3U5P A;  5COI A;  5CZG A;  5DBM A;  4MR4 A;  5DKC A;  5A5N A;  5AD2 A;  4Z6H A;  4BJX A;  4BW2 A;  4QR3 A;  5DW2 A;  5LVR A;  4BHW A;  2DVR A;  5L96 A;  3O34 A;  4YYN A;  3LXJ A;  5ENE A;  2GRC A;  4GPJ A;  4NYW A;  2YDW A;  2R0S A;  4Z1S A;  4PTB A;  1E6I A;  3JVL A;  5L99 A;  5HFQ A;  5CRZ A;  5FE1 A;  3UV5 A;  5CP5 A;  4YBM A;  5A5P A;  3P1F A;  5LJ0 A;  4Z93 A;  3JVM A;  5I40 A;  4NR9 A;  4YYD A;  4Z1Q A;  4QSV A;  5D3P A;  2N9G A;  5I86 A;  5FE8 A;  4N4G A;  5EIC A;  4QEW A;  5KTW A;  5E73 A;  4N3W A;  5TB6 A;  5H1U A;  5A5S A;  5I29 A;  5L8U A;  5EWW A;  3MXF A;  3Q2F A;  3UV2 A;  4YY4 A;  3UV4 A;  1WUG A;  4UYF A;  2YQD A;  3AQA A;  4NUD A;  3U5O A;  5CRM A;  4TZ8 A;  2WP2 A;  5ETD A;  5F63 A;  5HQ7 A;  4O7C A;  5DLX A;  4UIY A;  5I80 A;  2KTB B;  5HM0 A;  3UVY A;  4UIT A;  4NQM A;  2YEK A;  3JVJ A;  4QR4 A;  2E7N A;  3G0L A;  4J1P A;  5ACY A;  5D3L A;  4NR5 A;  2YYN A;  4QSS A;  4WHU A;  4CFL A;  3MB3 A;  5ENC A;  3DWY A;  5LJ2 A;  4XUA A;  4OGI A;  5LKX A;  5D25 A;  4HXK A;  1N72 A;  4MEQ A;  5EWH A;  5I7Y A;  4LZS A;  4RVR A;  4A9E A;  5F3A A;  4NR7 A;  5IBN A;  4J0R A;  4UYD A;  5J0D A;  5D3T A;  5A5Q A;  4LRG A;  5G4S A;  5CUG A;  5G4R A;  5FFY A;  5FH6 A;  5KU3 A;  5CTL A;  4QB3 A;  4IOO A;  4LDF A;  5C85 A;  5JI8 A;  5CGP A;  4TTE A;  4NQN A;  5HQ6 A;  5ENI A;  2RS9 B;  4HXS A;  4HBV A;  5CQ6 A;  5EPS A;  4XUB A;  4KV4 A;  5FFV A;  2OUO A;  5CQ8 A;  4UIV A;  3AAD A;  5FG4 A;  5EV9 A;  4QST A;  5KHM A;  4Q0O A;  3MQM A;  2RI7 A;  2FSA A;  4CUU A;  5D3N A;  2E7O A;  3LQH A;  5E3D A;  4QEV A;  5ENG A;  3SVF A;  4OUF A;  5E3G A;  4HXN A;  5HEM A;  5C89 A;  4NUC A;  5AMF A;  4A9O A;  4QSQ A;  5HQ5 A;  5KTX A;  4A9I A;  5H1V A;  5DYC A;  4TT4 A;  5FDZ A;  3D7C A;  3LQI A;  4O70 A;  2R0V A;  4N4H A;  4A9N A;  4J0S A;  4TQN A;  4HBW A;  3MB4 A;  5HLS A;  4LC2 A;  4A9L A;  5KTU A;  4LZ2 A;  3I3J A;  3P1C A;  5D3H A;  2D82 A;  5EQ1 A;  4UYE A;  5HFR A;  4CUQ A;  5F25 A;  5I83 A;  4QUU A;  3S92 A;  3SVG A;  5BT3 A;  4YYI A;  5E0R A;  2RFJ A;  3IU5 A;  2YEM A;  5CUC A;  4QYL A;  5FE4 A;  5EIS A;  4CUR A;  4NUE A;  5TCM A;  4C67 A;  4HXO A;  4PS5 A;  2D9E A;  4YY6 A;  5CQ3 A;  4UYH A;  1JM4 B;  3P1D A;  4IR5 A;  4LYW A;  4TS8 A;  5F1L A;  5CS8 A;  5I7X A;  5IGL A;  4YAT A;  4A9H A;  2F6N A;  4NYX A;  4PCI A;  4PY6 A;  3MUL A;  2WP1 A;  4HXL A;  4TU6 A;  5CUE A;  5L98 A;  4IR3 A;  4O74 A;  4YBS A;  5JWM A;  4E96 A;  3O35 A;  4O7A A;  4CUS A;  4OGJ A;  4ZC9 A;  4LYS A;  4QC3 A;  4YYM A;  3K2J A;  5ENJ A;  4X2I A;  4QYD A;  2DVQ A;  5F1H A;  5CPE A;  5A82 A;  4YYG A;  5CUA A;  4YH3 A;  3UVW A;  4QSW A;  3UVX A;  5E9K A;  4NR8 A;  4CL9 A;  5FE3 A;  4ZW1 A;  5HRX A;  5LUU A;  4QSR A;  5CQT A;  2G4A A;  5EK9 A;  5L97 A;  4XY8 A;  4DON A;  2RNW A;  5C7N A;  5LVQ A;  3QZT A;  4UIU A;  4YC9 A;  3U5N A;  4FLP A;  5EP7 A;  5FH8 A;  3UVD A;  5DFD A;  2OO1 A;  2RNY A;  5BT5 A;  3HME A;  5FE7 A;  5HEN A;  4A9K A;  4HBX A;  5II1 A;  5EA1 A;  3JVK A;  5EWD A;  5HRV A;  5DYX A;  4QZS A;  4A9F A;  5E74 A;  4TT6 A;  1F68 A;  5CQ7 A;  4YAB A;  3P1E A;  5BT4 A;  4HXR A;  3HMH A;  2I8N A;  5E9Y A;  4Z6I A;  4IOQ A;  5IGK A;  5D24 A;  5FH7 A;  2L5E A;  2L84 A;  5FB0 A;  5EGU A;  5CUD A;  5DKD A;  5ETB A;  4O7E A;  4O75 A;  5EU1 A;  4KCX A;  4YH4 A;  5CUB A;  4NRA A;  2DAT A;  4TU4 A;  4WHW A;  4IR4 A;  5IGN A;  1WUM A;  5F62 A;  4UIZ A;  4UIX A;  4N4F A;  5D26 A;  3NXB A;  4Y03 A;  5CQ4 A;  2DWW A;  4HXM A;  5EVA A;  4BW4 A;  3S91 A;  5EM3 A;  2L85 A;  3QZV A;  4MEO A;  4YAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...