4UIXA

N-terminal bromodomain of human brd4 with 7-(3,4-dimethoxyphenyl)-n-(1,1-dioxo-1-thian-4-yl)-5-methyl-4-oxo-4h,5h-thieno-3,2-c-pyridine-2- carboxamide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
MNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHKFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 4
publication title The Discovery of I-Brd9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 126
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uixA01
5EM3A 5F2PA 4CLBA 5CRZA 5C4QA 4PS5A 2DKWA 4YADA 5FE4A 3JVLA 4UYFA 5E0RA 2R10A 5A81A 2RFJA 5FG5A 4LYSA 5HFRA 2L84A 4CUSA 4CUTA 5IGKA 4MR6A 2NXBA 4LZ2A 3JVJA 5EPSA 4UIZA 3ONIA 2E7OA 4MR5A 4QUUA 5CUDA 4Z1SA 4CL9A 1X0JA 5D3JA 2R0VA 4MEOA 5KHMA 4UYDA 5LUUA 5FE5A 4HXLA 4X2IA 3DAIA 4YY4A 4NR7A 4YYKA 5DX4A 1F68A 2DVQA 4J0SA 4QSTA 2YQDA 5E73A 3P1DA 3UVWA 5L98A 3UV4A 5DBMA 4NQMA 3RCWA 5A5RA 4N4FA 5FFWA 4XUBA 5EWDA 5D25A 5DYCA 5COIA 4YYJA 4UIYA 4YYHA 4HXNA 5I86A 2I7KA 5L97A 5DYUA 5D7XA 4QEWA 3SVGA 4HBVA 5CY9A 3AADA 5L99A 4UYEA 2H60A 4QSSA 4Z93A 2DVSA 5HENA 2YW5A 5CGPA 5D24A 5FH8A 2OSSA 5EP7A 3P5OA 4NYWA 5I80A 5CP5A 3IU5A 5HQ5A 5F1HA 4NR8A 4O7FA 4NYXA 4NR4A 4TS8A 4TTEA 4IR4A 2YDWA 4QY4A 4NUEA 4YBTA 3UV2A 4BW4A 5IIDA 4UIXA 5E9IA 4AKNA 3U5PA 5TB6A 4NUCA 4QSVA 4IR5A 4TZ8A 5CUGA 5E9LA 3G0LA 4Y03A 1WUMA 4QB3A 3O34A 2YEMA 4O77A 5F1LA 3MB3A 4Q0OA 5ENBA 4O74A 4TT4A 4CFLA 4FLPA 2D82A 4LZRA 5FE0A 2RNXA 5A83A 2OO1A 2F6JA 5IBNA 4N4IA 3MULA 5F3AA 5KO4A 1E6IA 5D3TA 5HJCA 4A9LA 4QC1A 5JWMA 4O70A 5LJ0A 2RNYA 4CFKA 4NUDA 2FSAA 3QZTA 5HM0A 5FBXA 4KCXA 4J1PA 4IORA 4O78A 5HRVA 5I1QA 4BW2A 4TQNA 4QSPA 5FDZA 5DW2A 5BT5A 5L96A 5IGLA 5I7YA 5F60A 5HQ7A 4C67A 5HLSA 3I3JA 4A9IA 5FE8A 2YEKA 3QZSA 3U5NA 5TCMA 4NS5A 5F61A 5F5ZA 5H1VA 4YY6A 5EA1A 1ZS5A 5LKTA 4YYNA 4IOOA 3LJWA 4CUQA 4O7BA 2N9GA 4HXKA 3P1FA 4ALHA 5DFBA 5H1TA 4UIWA 5ENHA 5EU1A 4QNSA 4MEPA 5C89A 2MJVB 5F62A 5D26A 5ENFA 5ETDA 5J0DA 2RS9B 5D3LA 5I40A 4CURA 5BT4A 5EQ1A 4O72A 5H1UA 4YYDA 5G4SA 4YABA 5FB1A 3S91A 5LKUA 4O7AA 3TLPA 5IG6A 5C87A 3O35A 3UW9A 2R0YA 4LYIA 3UVXA 4QUTA 5DFCA 4O7CA 3LQHA 5EGUA 5HEMA 3O33A 4WHWA 4WHUA 5E9YA 5E3DA 5F63A 2E3KA 3MXFA 5D3NA 4YC9A 4QEVA 4QC3A 5EICA 5BT3A 5EV9A 5CQ5A 4TZ2A 3U5JA 4O76A 4PCIA 3SVFA 4ZC9A 4A9MA 5E74A 4CUPA 4HBXA 5D0CA 5CQ7A 4QZSA 5F36A 5A5NA 5CQ4A 4HXMA 4UYGA 4N4GA 4NRAA 5FFVA 3AQAA 5ETBA 5F25A 4J3IA 2G4AA 3D7CA 3GG3A 5CUAA 4BW3A 4CUUA 4MR3A 4DONA 5EWVA 5DY7A 4HBWA 4NRBA 5D3PA 4XY8A 4YH3A 5A85A 5ENIA 4TU4A 1JM4B 5IGMA 5ENGA 5DLXA 5C85A 4GPJA 5CQ3A 4C66A 4YYIA 4MR4A 5CPEA 5CQ6A 4A9EA 4TYLA 5E9KA 5HCLA 2D9EA 4NR5A 5JI8A 4QYDA 3UVDA 5AMFA 3UVYA 5I83A 5DW1A 5DLZA 5AD2A 5LVRA 4XYAA 5I29A 5KTXA 5ENCA 4ZW1A 4XY9A 5DYAA 5CUBA 5CS8A 5IGNA 2DATA 4Z6HA 4MENA 5A5PA 5AMEA 4O7EA 5EPBA 4WIVA 5HQ6A 5CUCA 4N3WA 1N72A 5E7DA 3Q2FA 5EI4A 5D3HA 5CRMA 5II2A 5A82A 3HMEA 5LKZA 5EWHA 3ZYUA 5FE9A 5C8GA 4A9OA 4Z6IA 4LYWA 1JSPB 5CZGA 5EWCA 4A9JA 5CQTA 5I7XA 2YYNA 5EPRA 5H85A 5LJ1A 5C7NA 2R0SA 4YK0A 4BJXA 4NQNA 5I89A 5LJ2A 4NR9A 3JVMA 5CFWA 5FH6A 5DKDA 4QSRA 5L8TA 2YELA 4QR4A 5FG4A 4LC2A 3SVHA 4YAXA 5FFYA 5KU3A 5KTWA 5FE7A 3LQJA 5E9VA 2WP1A 5II1A 4O71A 4QSQA 5D3RA 4NXJA 5CUEA 3Q2EA 5A7CA 5FH7A 5A5QA 5EK9A 3NXBA 5FG6A 4QSUA 4LZSA 4RVRA 5HRWA 4UIVA 5CQ8A 2RNWA 2L5EA 5KTUA 3U5MA 3P1EA 4TT6A 5DKCA 4YYGA 2LSPB 2E7NA 5HELA 5CQAA 3MB4A 5FE2A 4QYLA 4KV4A 5E3GA 5DKHA 4OGJA 3G0JA 5HFQA 4PTBA 1WUGA 4MEQA 5CTLA 4F3IA 3U5KA 4LR6A 3IU6A 4IOQA 4YATA 3HMFA 3O36A 4QBMA 4ZQLA 5I88A 4HXRA 4A9KA 5LVQA 4QSWA 5HRXA 5ENEA 4Q0NA 5D3SA 4E96A 5FE6A 4Z1QA 3LQIA 3FKMX 2DWWA 4TU6A 4YBSA 4OGIA 3QZVA 4UYFB 5AD3A 4PCEA 4J0RA 4IR6A 2GRCA 5A5SA 4A9HA 5CU8A 5EWWA 3LXJA 4HXSA 4O75A 4UYHA 3U5LA 2DVRA 4UITA 3S92A 3MUKA 1EQFA 4IR3A 4TT2A 3U5OA 5LKXA 5ACYA 4NYVA 4YBMA 5E9MA 4QEUA 4HBYA 5FE1A 4HXPA 3JVKA 5K29A 2F6NA 4LRGA 4A9NA 3K2JA 2WP2A 4PKLA 5FB0A 2KTBB 3MQMA 4UIUA 3DWYA 2I8NA 5FE3A 3HMHA 3O37A 4KV1A 4NRCA 4XUAA 5EISA 4ALGA 4YYMA 5A5OA 4QR5A 2OUOA 4NR6A 4OUFA 2RO1A 4BHWA 2RI7A 2L85A 4PY6A 5DYXA 3P1CA 5EVAA 4BW1A 4QSXA 5G4RA 4QR3A 5DFDA 4HXOA 2DVVA 4A9FA 4YH4A 5ENJA 4LDFA 4N4HA 5L8UA 3UV5A
chains in the Genus database with same CATH superfamily
5EM3A 5F2PA 4CLBA 5CRZA 5C4QA 4PS5A 2DKWA 4YADA 5FE4A 3JVLA 4UYFA 5E0RA 2R10A 5A81A 2RFJA 5FG5A 4LYSA 5HFRA 2L84A 4CUSA 4CUTA 5IGKA 4MR6A 2NXBA 4LZ2A 3JVJA 5EPSA 4UIZA 3ONIA 2E7OA 4MR5A 4QUUA 5CUDA 4Z1SA 4CL9A 1X0JA 5D3JA 2R0VA 4MEOA 5KHMA 4UYDA 5LUUA 5FE5A 4HXLA 4X2IA 3DAIA 4YY4A 4NR7A 4YYKA 5DX4A 1F68A 2DVQA 4J0SA 4QSTA 2YQDA 5E73A 3P1DA 3UVWA 5L98A 3UV4A 5DBMA 4NQMA 3RCWA 5A5RA 4N4FA 5FFWA 4XUBA 5EWDA 5D25A 5DYCA 5COIA 4YYJA 4UIYA 4YYHA 3VKHA 4HXNA 5I86A 3ERRA 2I7KA 5L97A 5DYUA 5D7XA 4QEWA 3SVGA 4HBVA 5CY9A 3AADA 5L99A 4UYEA 2H60A 4QSSA 4Z93A 2DVSA 5HENA 3VKGA 2YW5A 5CGPA 5D24A 5FH8A 2OSSA 5EP7A 3P5OA 4NYWA 5I80A 5CP5A 3IU5A 5HQ5A 5F1HA 4NR8A 4O7FA 4NYXA 4NR4A 4TS8A 4TTEA 4IR4A 2YDWA 4QY4A 4NUEA 4YBTA 3UV2A 4BW4A 5IIDA 4UIXA 5E9IA 4AKNA 3U5PA 5TB6A 4NUCA 4QSVA 4IR5A 4TZ8A 5CUGA 5E9LA 3G0LA 4Y03A 1WUMA 4QB3A 3O34A 2YEMA 4O77A 5F1LA 3MB3A 4Q0OA 5ENBA 4O74A 4TT4A 4CFLA 4FLPA 2D82A 4LZRA 5FE0A 2RNXA 5A83A 2OO1A 2F6JA 5IBNA 4N4IA 3MULA 5F3AA 5KO4A 1E6IA 5D3TA 5HJCA 4A9LA 4QC1A 5JWMA 4O70A 5LJ0A 2RNYA 4CFKA 4NUDA 2FSAA 3QZTA 5HM0A 5FBXA 4KCXA 4J1PA 4IORA 4O78A 5HRVA 5I1QA 4BW2A 4TQNA 4QSPA 5FDZA 5DW2A 5BT5A 5L96A 5IGLA 5I7YA 5F60A 5HQ7A 4C67A 5HLSA 3I3JA 4A9IA 5FE8A 2YEKA 3QZSA 3U5NA 5TCMA 3D1DA 4NS5A 5F61A 5F5ZA 5H1VA 4YY6A 5EA1A 1ZS5A 5LKTA 4YYNA 4IOOA 3LJWA 4CUQA 4O7BA 2N9GA 4HXKA 3P1FA 4ALHA 5DFBA 5H1TA 4UIWA 5ENHA 4AI6A 5EU1A 4QNSA 4MEPA 5C89A 2MJVB 5F62A 5D26A 5ENFA 5ETDA 5J0DA 2RS9B 5D3LA 5I40A 4CURA 5BT4A 5EQ1A 4O72A 5H1UA 4YYDA 5G4SA 4YABA 5FB1A 3S91A 5LKUA 4O7AA 3TLPA 5IG6A 5C87A 3O35A 3UW9A 2R0YA 4LYIA 3UVXA 4QUTA 5DFCA 4O7CA 3LQHA 2EJNA 5EGUA 5HEMA 3O33A 4WHWA 4WHUA 5E9YA 5E3DA 1PUOA 5F63A 2E3KA 3MXFA 5D3NA 4YC9A 4AKHA 4QEVA 4QC3A 5EICA 5BT3A 5EV9A 5CQ5A 4TZ2A 3U5JA 4O76A 4PCIA 3SVFA 4ZC9A 4A9MA 5E74A 4CUPA 4HBXA 5D0CA 5CQ7A 4QZSA 5F36A 5A5NA 5CQ4A 4HXMA 4UYGA 4N4GA 4NRAA 5FFVA 3AQAA 5ETBA 5F25A 4J3IA 1ZKRA 2G4AA 3D7CA 3GG3A 5CUAA 4BW3A 4AKGA 4CUUA 4MR3A 4DONA 5EWVA 5DY7A 4HBWA 4NRBA 5D3PA 4XY8A 4YH3A 5A85A 5ENIA 4TU4A 1JM4B 5IGMA 5ENGA 5DLXA 5C85A 4GPJA 5CQ3A 4C66A 4YYIA 4MR4A 5CPEA 5CQ6A 4A9EA 4TYLA 5E9KA 5HCLA 2D9EA 4NR5A 5JI8A 4QYDA 3UVDA 5AMFA 3D1BA 3UVYA 5I83A 5DW1A 5DLZA 5AD2A 5LVRA 4XYAA 5I29A 5KTXA 5ENCA 4ZW1A 4XY9A 5DYAA 5CUBA 5CS8A 5IGNA 2DATA 4Z6HA 4MENA 5A5PA 5AMEA 4O7EA 5EPBA 4WIVA 5HQ6A 5CUCA 4N3WA 1N72A 5E7DA 3Q2FA 5EI4A 5D3HA 5CRMA 5II2A 5A82A 3HMEA 5LKZA 5EWHA 3ZYUA 5FE9A 5C8GA 4A9OA 4Z6IA 4LYWA 1JSPB 5CZGA 5EWCA 4A9JA 5CQTA 5I7XA 2YYNA 5EPRA 5H85A 5LJ1A 5C7NA 2R0SA 4YK0A 4BJXA 4NQNA 5I89A 5LJ2A 4NR9A 3JVMA 5CFWA 5FH6A 5DKDA 4QSRA 5L8TA 2YELA 4QR4A 5FG4A 4LC2A 3SVHA 4YAXA 5FFYA 5KU3A 5KTWA 5FE7A 3LQJA 5E9VA 2WP1A 5II1A 4O71A 4QSQA 5D3RA 4NXJA 5CUEA 3Q2EA 5A7CA 5FH7A 5A5QA 5EK9A 3NXBA 5FG6A 4QSUA 4LZSA 4RVRA 5HRWA 4UIVA 5CQ8A 2RNWA 2L5EA 5KTUA 3U5MA 3P1EA 4TT6A 5DKCA 4YYGA 2LSPB 2E7NA 5HELA 5CQAA 3MB4A 5FE2A 4QYLA 4KV4A 5E3GA 5DKHA 4OGJA 3G0JA 5HFQA 4PTBA 1WUGA 4MEQA 5CTLA 4F3IA 4AKIA 3U5KA 4LR6A 3IU6A 4IOQA 4YATA 3HMFA 3O36A 4QBMA 4ZQLA 5I88A 4HXRA 4A9KA 5LVQA 4QSWA 5HRXA 5ENEA 4Q0NA 5D3SA 4E96A 5FE6A 4Z1QA 3LQIA 3FKMX 2DWWA 4TU6A 4YBSA 4OGIA 3QZVA 4UYFB 5AD3A 4PCEA 4J0RA 4IR6A 2GRCA 5A5SA 4A9HA 5CU8A 5EWWA 3LXJA 4HXSA 4O75A 4UYHA 3U5LA 2DVRA 4UITA 3S92A 3MUKA 1EQFA 4IR3A 4TT2A 3U5OA 5LKXA 5ACYA 4NYVA 4YBMA 5E9MA 4QEUA 4HBYA 5FE1A 4HXPA 3JVKA 5K29A 2F6NA 4LRGA 4A9NA 3K2JA 2WP2A 4PKLA 5FB0A 2KTBB 3MQMA 4UIUA 3DWYA 2I8NA 5FE3A 3HMHA 3O37A 4KV1A 4NRCA 4XUAA 5EISA 4ALGA 4YYMA 5A5OA 4QR5A 2OUOA 4NR6A 4OUFA 2RO1A 4BHWA 2RI7A 2L85A 4PY6A 5DYXA 3P1CA 5EVAA 4BW1A 4QSXA 5G4RA 4QR3A 4HXOA 5DFDA 2DVVA 4A9FA 4YH4A 5ENJA 4LDFA 4N4HA 5L8UA 3UV5A
chains in the Genus database with same CATH topology
5EM3A 5F2PA 4CLBA 5CRZA 5C4QA 4PS5A 2DKWA 4YADA 5FE4A 3JVLA 4UYFA 5E0RA 2R10A 5A81A 2RFJA 5FG5A 4LYSA 5HFRA 2L84A 4CUSA 4CUTA 5IGKA 4MR6A 2NXBA 4LZ2A 3JVJA 5EPSA 4UIZA 3ONIA 2E7OA 4MR5A 4QUUA 5CUDA 4Z1SA 4CL9A 1X0JA 5D3JA 2R0VA 4MEOA 5KHMA 4UYDA 5LUUA 5FE5A 4HXLA 4X2IA 3DAIA 4YY4A 4NR7A 4YYKA 5DX4A 1F68A 2DVQA 4J0SA 4QSTA 2YQDA 5E73A 3P1DA 3UVWA 5L98A 3UV4A 5DBMA 4NQMA 3RCWA 5A5RA 4N4FA 5FFWA 4XUBA 5EWDA 5D25A 5DYCA 5COIA 4YYJA 4UIYA 4YYHA 4HXNA 5I86A 2I7KA 5L97A 5DYUA 5D7XA 4QEWA 3SVGA 4HBVA 5CY9A 3AADA 5L99A 4UYEA 2H60A 4QSSA 4Z93A 2DVSA 5HENA 2YW5A 5CGPA 5D24A 5FH8A 2OSSA 5EP7A 3P5OA 4NYWA 5I80A 5CP5A 3IU5A 5HQ5A 5F1HA 4NR8A 4O7FA 4NYXA 4NR4A 4TS8A 4TTEA 4IR4A 2YDWA 4QY4A 4NUEA 4YBTA 3UV2A 4BW4A 5IIDA 4UIXA 5E9IA 4AKNA 3U5PA 5TB6A 4NUCA 4QSVA 4IR5A 4TZ8A 5CUGA 5E9LA 3G0LA 4Y03A 1WUMA 4QB3A 3O34A 2YEMA 4O77A 5F1LA 3MB3A 4Q0OA 5ENBA 4O74A 4TT4A 4CFLA 4FLPA 2D82A 4LZRA 5FE0A 2RNXA 5A83A 2OO1A 2F6JA 5IBNA 4N4IA 3MULA 5F3AA 5KO4A 1E6IA 5D3TA 5HJCA 4A9LA 4QC1A 5JWMA 4O70A 5LJ0A 2RNYA 4CFKA 4NUDA 2FSAA 3QZTA 5HM0A 5FBXA 4KCXA 4J1PA 4IORA 4O78A 5HRVA 5I1QA 4BW2A 4TQNA 4QSPA 5FDZA 5DW2A 5BT5A 5L96A 5IGLA 5I7YA 5F60A 5HQ7A 4C67A 5HLSA 3I3JA 4A9IA 5FE8A 2YEKA 3QZSA 3U5NA 5TCMA 4NS5A 5F61A 5F5ZA 5H1VA 4YY6A 5EA1A 1ZS5A 5LKTA 4YYNA 4IOOA 3LJWA 4CUQA 4O7BA 2N9GA 4HXKA 3P1FA 4ALHA 5DFBA 5H1TA 4UIWA 5ENHA 5EU1A 4QNSA 4MEPA 5C89A 2MJVB 5F62A 5D26A 5ENFA 5ETDA 5J0DA 2RS9B 5D3LA 5I40A 4CURA 5BT4A 5EQ1A 4O72A 5H1UA 4YYDA 5G4SA 4YABA 5FB1A 3S91A 5LKUA 4O7AA 3TLPA 5IG6A 5C87A 3O35A 3UW9A 2R0YA 4LYIA 3UVXA 4QUTA 5DFCA 4O7CA 3LQHA 5EGUA 5HEMA 3O33A 4WHWA 4WHUA 5E9YA 5E3DA 5F63A 2E3KA 3MXFA 5D3NA 4YC9A 4QEVA 4QC3A 5EICA 5BT3A 5EV9A 5CQ5A 4TZ2A 3U5JA 4O76A 4PCIA 3SVFA 4ZC9A 4A9MA 5E74A 4CUPA 4HBXA 5D0CA 5CQ7A 4QZSA 5F36A 5A5NA 5CQ4A 4HXMA 4UYGA 4N4GA 4NRAA 5FFVA 3AQAA 5ETBA 5F25A 4J3IA 2G4AA 3D7CA 3GG3A 5CUAA 4BW3A 4CUUA 4MR3A 4DONA 5EWVA 5DY7A 4HBWA 4NRBA 5D3PA 4XY8A 4YH3A 5A85A 5ENIA 4TU4A 1JM4B 5IGMA 5ENGA 5DLXA 5C85A 4GPJA 5CQ3A 4C66A 4YYIA 4MR4A 5CPEA 5CQ6A 4A9EA 4TYLA 5E9KA 5HCLA 2D9EA 4NR5A 5JI8A 4QYDA 3UVDA 5AMFA 3UVYA 5I83A 5DW1A 5DLZA 5AD2A 5LVRA 4XYAA 5I29A 5KTXA 5ENCA 4ZW1A 4XY9A 5DYAA 5CUBA 5CS8A 5IGNA 2DATA 4Z6HA 4MENA 5A5PA 5AMEA 4O7EA 5EPBA 4WIVA 5HQ6A 5CUCA 4N3WA 1N72A 5E7DA 3Q2FA 5EI4A 5D3HA 5CRMA 5II2A 5A82A 3HMEA 5LKZA 5EWHA 3ZYUA 5FE9A 5C8GA 4A9OA 4Z6IA 4LYWA 1JSPB 5CZGA 5EWCA 4A9JA 5CQTA 5I7XA 2YYNA 5EPRA 5H85A 5LJ1A 5C7NA 2R0SA 4YK0A 4BJXA 4NQNA 5I89A 5LJ2A 4NR9A 3JVMA 5CFWA 5FH6A 5DKDA 4QSRA 5L8TA 2YELA 4QR4A 5FG4A 4LC2A 3SVHA 4YAXA 5FFYA 5KU3A 5KTWA 5FE7A 3LQJA 5E9VA 2WP1A 5II1A 4O71A 4QSQA 5D3RA 4NXJA 5CUEA 3Q2EA 5A7CA 5FH7A 5A5QA 5EK9A 3NXBA 5FG6A 4QSUA 4LZSA 4RVRA 5HRWA 4UIVA 5CQ8A 2RNWA 2L5EA 5KTUA 3U5MA 3P1EA 4TT6A 5DKCA 4YYGA 2LSPB 2E7NA 5HELA 5CQAA 3MB4A 5FE2A 4QYLA 4KV4A 5E3GA 5DKHA 4OGJA 3G0JA 5HFQA 4PTBA 1WUGA 4MEQA 5CTLA 4F3IA 3U5KA 4LR6A 3IU6A 4IOQA 4YATA 3HMFA 3O36A 4QBMA 4ZQLA 5I88A 4HXRA 4A9KA 5LVQA 4QSWA 5HRXA 5ENEA 4Q0NA 5D3SA 4E96A 5FE6A 4Z1QA 3LQIA 3FKMX 2DWWA 4TU6A 4YBSA 4OGIA 3QZVA 4UYFB 5AD3A 4PCEA 4J0RA 4IR6A 2GRCA 5A5SA 4A9HA 5CU8A 5EWWA 3LXJA 4HXSA 4O75A 4UYHA 3U5LA 2DVRA 4UITA 3S92A 3MUKA 1EQFA 4IR3A 4TT2A 3U5OA 5LKXA 5ACYA 4NYVA 4YBMA 5E9MA 4QEUA 4HBYA 5FE1A 4HXPA 3JVKA 5K29A 2F6NA 4LRGA 4A9NA 3K2JA 2WP2A 4PKLA 5FB0A 2KTBB 3MQMA 4UIUA 3DWYA 2I8NA 5FE3A 3HMHA 3O37A 4KV1A 4NRCA 4XUAA 5EISA 4ALGA 4YYMA 5A5OA 4QR5A 2OUOA 4NR6A 4OUFA 2RO1A 4BHWA 2RI7A 2L85A 4PY6A 5DYXA 3P1CA 5EVAA 4BW1A 4QSXA 5G4RA 4QR3A 5DFDA 4HXOA 2DVVA 4A9FA 4YH4A 5ENJA 4LDFA 4N4HA 5L8UA 3UV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM3 A;  5F2P A;  4CLB A;  5CRZ A;  5C4Q A;  4PS5 A;  2DKW A;  4YAD A;  5FE4 A;  3JVL A;  4UYF A;  5E0R A;  2R10 A;  5A81 A;  2RFJ A;  5FG5 A;  4LYS A;  5HFR A;  2L84 A;  4CUS A;  4CUT A;  5IGK A;  4MR6 A;  2NXB A;  4LZ2 A;  3JVJ A;  5EPS A;  4UIZ A;  3ONI A;  2E7O A;  4MR5 A;  4QUU A;  5CUD A;  4Z1S A;  4CL9 A;  1X0J A;  5D3J A;  2R0V A;  4MEO A;  5KHM A;  4UYD A;  5LUU A;  5FE5 A;  4HXL A;  4X2I A;  3DAI A;  4YY4 A;  4NR7 A;  4YYK A;  5DX4 A;  1F68 A;  2DVQ A;  4J0S A;  4QST A;  2YQD A;  5E73 A;  3P1D A;  3UVW A;  5L98 A;  3UV4 A;  5DBM A;  4NQM A;  3RCW A;  5A5R A;  4N4F A;  5FFW A;  4XUB A;  5EWD A;  5D25 A;  5DYC A;  5COI A;  4YYJ A;  4UIY A;  4YYH A;  4HXN A;  5I86 A;  2I7K A;  5L97 A;  5DYU A;  5D7X A;  4QEW A;  3SVG A;  4HBV A;  5CY9 A;  3AAD A;  5L99 A;  4UYE A;  2H60 A;  4QSS A;  4Z93 A;  2DVS A;  5HEN A;  2YW5 A;  5CGP A;  5D24 A;  5FH8 A;  2OSS A;  5EP7 A;  3P5O A;  4NYW A;  5I80 A;  5CP5 A;  3IU5 A;  5HQ5 A;  5F1H A;  4NR8 A;  4O7F A;  4NYX A;  4NR4 A;  4TS8 A;  4TTE A;  4IR4 A;  2YDW A;  4QY4 A;  4NUE A;  4YBT A;  3UV2 A;  4BW4 A;  5IID A;  4UIX A;  5E9I A;  4AKN A;  3U5P A;  5TB6 A;  4NUC A;  4QSV A;  4IR5 A;  4TZ8 A;  5CUG A;  5E9L A;  3G0L A;  4Y03 A;  1WUM A;  4QB3 A;  3O34 A;  2YEM A;  4O77 A;  5F1L A;  3MB3 A;  4Q0O A;  5ENB A;  4O74 A;  4TT4 A;  4CFL A;  4FLP A;  2D82 A;  4LZR A;  5FE0 A;  2RNX A;  5A83 A;  2OO1 A;  2F6J A;  5IBN A;  4N4I A;  3MUL A;  5F3A A;  5KO4 A;  1E6I A;  5D3T A;  5HJC A;  4A9L A;  4QC1 A;  5JWM A;  4O70 A;  5LJ0 A;  2RNY A;  4CFK A;  4NUD A;  2FSA A;  3QZT A;  5HM0 A;  5FBX A;  4KCX A;  4J1P A;  4IOR A;  4O78 A;  5HRV A;  5I1Q A;  4BW2 A;  4TQN A;  4QSP A;  5FDZ A;  5DW2 A;  5BT5 A;  5L96 A;  5IGL A;  5I7Y A;  5F60 A;  5HQ7 A;  4C67 A;  5HLS A;  3I3J A;  4A9I A;  5FE8 A;  2YEK A;  3QZS A;  3U5N A;  5TCM A;  4NS5 A;  5F61 A;  5F5Z A;  5H1V A;  4YY6 A;  5EA1 A;  1ZS5 A;  5LKT A;  4YYN A;  4IOO A;  3LJW A;  4CUQ A;  4O7B A;  2N9G A;  4HXK A;  3P1F A;  4ALH A;  5DFB A;  5H1T A;  4UIW A;  5ENH A;  5EU1 A;  4QNS A;  4MEP A;  5C89 A;  2MJV B;  5F62 A;  5D26 A;  5ENF A;  5ETD A;  5J0D A;  2RS9 B;  5D3L A;  5I40 A;  4CUR A;  5BT4 A;  5EQ1 A;  4O72 A;  5H1U A;  4YYD A;  5G4S A;  4YAB A;  5FB1 A;  3S91 A;  5LKU A;  4O7A A;  3TLP A;  5IG6 A;  5C87 A;  3O35 A;  3UW9 A;  2R0Y A;  4LYI A;  3UVX A;  4QUT A;  5DFC A;  4O7C A;  3LQH A;  5EGU A;  5HEM A;  3O33 A;  4WHW A;  4WHU A;  5E9Y A;  5E3D A;  5F63 A;  2E3K A;  3MXF A;  5D3N A;  4YC9 A;  4QEV A;  4QC3 A;  5EIC A;  5BT3 A;  5EV9 A;  5CQ5 A;  4TZ2 A;  3U5J A;  4O76 A;  4PCI A;  3SVF A;  4ZC9 A;  4A9M A;  5E74 A;  4CUP A;  4HBX A;  5D0C A;  5CQ7 A;  4QZS A;  5F36 A;  5A5N A;  5CQ4 A;  4HXM A;  4UYG A;  4N4G A;  4NRA A;  5FFV A;  3AQA A;  5ETB A;  5F25 A;  4J3I A;  2G4A A;  3D7C A;  3GG3 A;  5CUA A;  4BW3 A;  4CUU A;  4MR3 A;  4DON A;  5EWV A;  5DY7 A;  4HBW A;  4NRB A;  5D3P A;  4XY8 A;  4YH3 A;  5A85 A;  5ENI A;  4TU4 A;  1JM4 B;  5IGM A;  5ENG A;  5DLX A;  5C85 A;  4GPJ A;  5CQ3 A;  4C66 A;  4YYI A;  4MR4 A;  5CPE A;  5CQ6 A;  4A9E A;  4TYL A;  5E9K A;  5HCL A;  2D9E A;  4NR5 A;  5JI8 A;  4QYD A;  3UVD A;  5AMF A;  3UVY A;  5I83 A;  5DW1 A;  5DLZ A;  5AD2 A;  5LVR A;  4XYA A;  5I29 A;  5KTX A;  5ENC A;  4ZW1 A;  4XY9 A;  5DYA A;  5CUB A;  5CS8 A;  5IGN A;  2DAT A;  4Z6H A;  4MEN A;  5A5P A;  5AME A;  4O7E A;  5EPB A;  4WIV A;  5HQ6 A;  5CUC A;  4N3W A;  1N72 A;  5E7D A;  3Q2F A;  5EI4 A;  5D3H A;  5CRM A;  5II2 A;  5A82 A;  3HME A;  5LKZ A;  5EWH A;  3ZYU A;  5FE9 A;  5C8G A;  4A9O A;  4Z6I A;  4LYW A;  1JSP B;  5CZG A;  5EWC A;  4A9J A;  5CQT A;  5I7X A;  2YYN A;  5EPR A;  5H85 A;  5LJ1 A;  5C7N A;  2R0S A;  4YK0 A;  4BJX A;  4NQN A;  5I89 A;  5LJ2 A;  4NR9 A;  3JVM A;  5CFW A;  5FH6 A;  5DKD A;  4QSR A;  5L8T A;  2YEL A;  4QR4 A;  5FG4 A;  4LC2 A;  3SVH A;  4YAX A;  5FFY A;  5KU3 A;  5KTW A;  5FE7 A;  3LQJ A;  5E9V A;  2WP1 A;  5II1 A;  4O71 A;  4QSQ A;  5D3R A;  4NXJ A;  5CUE A;  3Q2E A;  5A7C A;  5FH7 A;  5A5Q A;  5EK9 A;  3NXB A;  5FG6 A;  4QSU A;  4LZS A;  4RVR A;  5HRW A;  4UIV A;  5CQ8 A;  2RNW A;  2L5E A;  5KTU A;  3U5M A;  3P1E A;  4TT6 A;  5DKC A;  4YYG A;  2LSP B;  2E7N A;  5HEL A;  5CQA A;  3MB4 A;  5FE2 A;  4QYL A;  4KV4 A;  5E3G A;  5DKH A;  4OGJ A;  3G0J A;  5HFQ A;  4PTB A;  1WUG A;  4MEQ A;  5CTL A;  4F3I A;  3U5K A;  4LR6 A;  3IU6 A;  4IOQ A;  4YAT A;  3HMF A;  3O36 A;  4QBM A;  4ZQL A;  5I88 A;  4HXR A;  4A9K A;  5LVQ A;  4QSW A;  5HRX A;  5ENE A;  4Q0N A;  5D3S A;  4E96 A;  5FE6 A;  4Z1Q A;  3LQI A;  3FKM X;  2DWW A;  4TU6 A;  4YBS A;  4OGI A;  3QZV A;  4UYF B;  5AD3 A;  4PCE A;  4J0R A;  4IR6 A;  2GRC A;  5A5S A;  4A9H A;  5CU8 A;  5EWW A;  3LXJ A;  4HXS A;  4O75 A;  4UYH A;  3U5L A;  2DVR A;  4UIT A;  3S92 A;  3MUK A;  1EQF A;  4IR3 A;  4TT2 A;  3U5O A;  5LKX A;  5ACY A;  4NYV A;  4YBM A;  5E9M A;  4QEU A;  4HBY A;  5FE1 A;  4HXP A;  3JVK A;  5K29 A;  2F6N A;  4LRG A;  4A9N A;  3K2J A;  2WP2 A;  4PKL A;  5FB0 A;  2KTB B;  3MQM A;  4UIU A;  3DWY A;  2I8N A;  5FE3 A;  3HMH A;  3O37 A;  4KV1 A;  4NRC A;  4XUA A;  5EIS A;  4ALG A;  4YYM A;  5A5O A;  4QR5 A;  2OUO A;  4NR6 A;  4OUF A;  2RO1 A;  4BHW A;  2RI7 A;  2L85 A;  4PY6 A;  5DYX A;  3P1C A;  5EVA A;  4BW1 A;  4QSX A;  5G4R A;  4QR3 A;  5DFD A;  4HXO A;  2DVV A;  4A9F A;  4YH4 A;  5ENJ A;  4LDF A;  4N4H A;  5L8U A;  3UV5 A; 
#chains in the Genus database with same CATH topology
 5EM3 A;  5F2P A;  4CLB A;  5CRZ A;  5C4Q A;  4PS5 A;  2DKW A;  4YAD A;  5FE4 A;  3JVL A;  4UYF A;  5E0R A;  2R10 A;  5A81 A;  2RFJ A;  5FG5 A;  4LYS A;  5HFR A;  2L84 A;  4CUS A;  4CUT A;  5IGK A;  4MR6 A;  2NXB A;  4LZ2 A;  3JVJ A;  5EPS A;  4UIZ A;  3ONI A;  2E7O A;  4MR5 A;  4QUU A;  5CUD A;  4Z1S A;  4CL9 A;  1X0J A;  5D3J A;  2R0V A;  4MEO A;  5KHM A;  4UYD A;  5LUU A;  5FE5 A;  4HXL A;  4X2I A;  3DAI A;  4YY4 A;  4NR7 A;  4YYK A;  5DX4 A;  1F68 A;  2DVQ A;  4J0S A;  4QST A;  2YQD A;  5E73 A;  3P1D A;  3UVW A;  5L98 A;  3UV4 A;  5DBM A;  4NQM A;  3RCW A;  5A5R A;  4N4F A;  5FFW A;  4XUB A;  5EWD A;  5D25 A;  5DYC A;  5COI A;  4YYJ A;  4UIY A;  4YYH A;  3VKH A;  4HXN A;  5I86 A;  3ERR A;  2I7K A;  5L97 A;  5DYU A;  5D7X A;  4QEW A;  3SVG A;  4HBV A;  5CY9 A;  3AAD A;  5L99 A;  4UYE A;  2H60 A;  4QSS A;  4Z93 A;  2DVS A;  5HEN A;  3VKG A;  2YW5 A;  5CGP A;  5D24 A;  5FH8 A;  2OSS A;  5EP7 A;  3P5O A;  4NYW A;  5I80 A;  5CP5 A;  3IU5 A;  5HQ5 A;  5F1H A;  4NR8 A;  4O7F A;  4NYX A;  4NR4 A;  4TS8 A;  4TTE A;  4IR4 A;  2YDW A;  4QY4 A;  4NUE A;  4YBT A;  3UV2 A;  4BW4 A;  5IID A;  4UIX A;  5E9I A;  4AKN A;  3U5P A;  5TB6 A;  4NUC A;  4QSV A;  4IR5 A;  4TZ8 A;  5CUG A;  5E9L A;  3G0L A;  4Y03 A;  1WUM A;  4QB3 A;  3O34 A;  2YEM A;  4O77 A;  5F1L A;  3MB3 A;  4Q0O A;  5ENB A;  4O74 A;  4TT4 A;  4CFL A;  4FLP A;  2D82 A;  4LZR A;  5FE0 A;  2RNX A;  5A83 A;  2OO1 A;  2F6J A;  5IBN A;  4N4I A;  3MUL A;  5F3A A;  5KO4 A;  1E6I A;  5D3T A;  5HJC A;  4A9L A;  4QC1 A;  5JWM A;  4O70 A;  5LJ0 A;  2RNY A;  4CFK A;  4NUD A;  2FSA A;  3QZT A;  5HM0 A;  5FBX A;  4KCX A;  4J1P A;  4IOR A;  4O78 A;  5HRV A;  5I1Q A;  4BW2 A;  4TQN A;  4QSP A;  5FDZ A;  5DW2 A;  5BT5 A;  5L96 A;  5IGL A;  5I7Y A;  5F60 A;  5HQ7 A;  4C67 A;  5HLS A;  3I3J A;  4A9I A;  5FE8 A;  2YEK A;  3QZS A;  3U5N A;  5TCM A;  3D1D A;  4NS5 A;  5F61 A;  5F5Z A;  5H1V A;  4YY6 A;  5EA1 A;  1ZS5 A;  5LKT A;  4YYN A;  4IOO A;  3LJW A;  4CUQ A;  4O7B A;  2N9G A;  4HXK A;  3P1F A;  4ALH A;  5DFB A;  5H1T A;  4UIW A;  5ENH A;  4AI6 A;  5EU1 A;  4QNS A;  4MEP A;  5C89 A;  2MJV B;  5F62 A;  5D26 A;  5ENF A;  5ETD A;  5J0D A;  2RS9 B;  5D3L A;  5I40 A;  4CUR A;  5BT4 A;  5EQ1 A;  4O72 A;  5H1U A;  4YYD A;  5G4S A;  4YAB A;  5FB1 A;  3S91 A;  5LKU A;  4O7A A;  3TLP A;  5IG6 A;  5C87 A;  3O35 A;  3UW9 A;  2R0Y A;  4LYI A;  3UVX A;  4QUT A;  5DFC A;  4O7C A;  3LQH A;  2EJN A;  5EGU A;  5HEM A;  3O33 A;  4WHW A;  4WHU A;  5E9Y A;  5E3D A;  1PUO A;  5F63 A;  2E3K A;  3MXF A;  5D3N A;  4YC9 A;  4AKH A;  4QEV A;  4QC3 A;  5EIC A;  5BT3 A;  5EV9 A;  5CQ5 A;  4TZ2 A;  3U5J A;  4O76 A;  4PCI A;  3SVF A;  4ZC9 A;  4A9M A;  5E74 A;  4CUP A;  4HBX A;  5D0C A;  5CQ7 A;  4QZS A;  5F36 A;  5A5N A;  5CQ4 A;  4HXM A;  4UYG A;  4N4G A;  4NRA A;  5FFV A;  3AQA A;  5ETB A;  5F25 A;  4J3I A;  1ZKR A;  2G4A A;  3D7C A;  3GG3 A;  5CUA A;  4BW3 A;  4AKG A;  4CUU A;  4MR3 A;  4DON A;  5EWV A;  5DY7 A;  4HBW A;  4NRB A;  5D3P A;  4XY8 A;  4YH3 A;  5A85 A;  5ENI A;  4TU4 A;  1JM4 B;  5IGM A;  5ENG A;  5DLX A;  5C85 A;  4GPJ A;  5CQ3 A;  4C66 A;  4YYI A;  4MR4 A;  5CPE A;  5CQ6 A;  4A9E A;  4TYL A;  5E9K A;  5HCL A;  2D9E A;  4NR5 A;  5JI8 A;  4QYD A;  3UVD A;  5AMF A;  3D1B A;  3UVY A;  5I83 A;  5DW1 A;  5DLZ A;  5AD2 A;  5LVR A;  4XYA A;  5I29 A;  5KTX A;  5ENC A;  4ZW1 A;  4XY9 A;  5DYA A;  5CUB A;  5CS8 A;  5IGN A;  2DAT A;  4Z6H A;  4MEN A;  5A5P A;  5AME A;  4O7E A;  5EPB A;  4WIV A;  5HQ6 A;  5CUC A;  4N3W A;  1N72 A;  5E7D A;  3Q2F A;  5EI4 A;  5D3H A;  5CRM A;  5II2 A;  5A82 A;  3HME A;  5LKZ A;  5EWH A;  3ZYU A;  5FE9 A;  5C8G A;  4A9O A;  4Z6I A;  4LYW A;  1JSP B;  5CZG A;  5EWC A;  4A9J A;  5CQT A;  5I7X A;  2YYN A;  5EPR A;  5H85 A;  5LJ1 A;  5C7N A;  2R0S A;  4YK0 A;  4BJX A;  4NQN A;  5I89 A;  5LJ2 A;  4NR9 A;  3JVM A;  5CFW A;  5FH6 A;  5DKD A;  4QSR A;  5L8T A;  2YEL A;  4QR4 A;  5FG4 A;  4LC2 A;  3SVH A;  4YAX A;  5FFY A;  5KU3 A;  5KTW A;  5FE7 A;  3LQJ A;  5E9V A;  2WP1 A;  5II1 A;  4O71 A;  4QSQ A;  5D3R A;  4NXJ A;  5CUE A;  3Q2E A;  5A7C A;  5FH7 A;  5A5Q A;  5EK9 A;  3NXB A;  5FG6 A;  4QSU A;  4LZS A;  4RVR A;  5HRW A;  4UIV A;  5CQ8 A;  2RNW A;  2L5E A;  5KTU A;  3U5M A;  3P1E A;  4TT6 A;  5DKC A;  4YYG A;  2LSP B;  2E7N A;  5HEL A;  5CQA A;  3MB4 A;  5FE2 A;  4QYL A;  4KV4 A;  5E3G A;  5DKH A;  4OGJ A;  3G0J A;  5HFQ A;  4PTB A;  1WUG A;  4MEQ A;  5CTL A;  4F3I A;  4AKI A;  3U5K A;  4LR6 A;  3IU6 A;  4IOQ A;  4YAT A;  3HMF A;  3O36 A;  4QBM A;  4ZQL A;  5I88 A;  4HXR A;  4A9K A;  5LVQ A;  4QSW A;  5HRX A;  5ENE A;  4Q0N A;  5D3S A;  4E96 A;  5FE6 A;  4Z1Q A;  3LQI A;  3FKM X;  2DWW A;  4TU6 A;  4YBS A;  4OGI A;  3QZV A;  4UYF B;  5AD3 A;  4PCE A;  4J0R A;  4IR6 A;  2GRC A;  5A5S A;  4A9H A;  5CU8 A;  5EWW A;  3LXJ A;  4HXS A;  4O75 A;  4UYH A;  3U5L A;  2DVR A;  4UIT A;  3S92 A;  3MUK A;  1EQF A;  4IR3 A;  4TT2 A;  3U5O A;  5LKX A;  5ACY A;  4NYV A;  4YBM A;  5E9M A;  4QEU A;  4HBY A;  5FE1 A;  4HXP A;  3JVK A;  5K29 A;  2F6N A;  4LRG A;  4A9N A;  3K2J A;  2WP2 A;  4PKL A;  5FB0 A;  2KTB B;  3MQM A;  4UIU A;  3DWY A;  2I8N A;  5FE3 A;  3HMH A;  3O37 A;  4KV1 A;  4NRC A;  4XUA A;  5EIS A;  4ALG A;  4YYM A;  5A5O A;  4QR5 A;  2OUO A;  4NR6 A;  4OUF A;  2RO1 A;  4BHW A;  2RI7 A;  2L85 A;  4PY6 A;  5DYX A;  3P1C A;  5EVA A;  4BW1 A;  4QSX A;  5G4R A;  4QR3 A;  4HXO A;  5DFD A;  2DVV A;  4A9F A;  4YH4 A;  5ENJ A;  4LDF A;  4N4H A;  5L8U A;  3UV5 A; 
#chains in the Genus database with same CATH homology
 5EM3 A;  5F2P A;  4CLB A;  5CRZ A;  5C4Q A;  4PS5 A;  2DKW A;  4YAD A;  5FE4 A;  3JVL A;  4UYF A;  5E0R A;  2R10 A;  5A81 A;  2RFJ A;  5FG5 A;  4LYS A;  5HFR A;  2L84 A;  4CUS A;  4CUT A;  5IGK A;  4MR6 A;  2NXB A;  4LZ2 A;  3JVJ A;  5EPS A;  4UIZ A;  3ONI A;  2E7O A;  4MR5 A;  4QUU A;  5CUD A;  4Z1S A;  4CL9 A;  1X0J A;  5D3J A;  2R0V A;  4MEO A;  5KHM A;  4UYD A;  5LUU A;  5FE5 A;  4HXL A;  4X2I A;  3DAI A;  4YY4 A;  4NR7 A;  4YYK A;  5DX4 A;  1F68 A;  2DVQ A;  4J0S A;  4QST A;  2YQD A;  5E73 A;  3P1D A;  3UVW A;  5L98 A;  3UV4 A;  5DBM A;  4NQM A;  3RCW A;  5A5R A;  4N4F A;  5FFW A;  4XUB A;  5EWD A;  5D25 A;  5DYC A;  5COI A;  4YYJ A;  4UIY A;  4YYH A;  4HXN A;  5I86 A;  2I7K A;  5L97 A;  5DYU A;  5D7X A;  4QEW A;  3SVG A;  4HBV A;  5CY9 A;  3AAD A;  5L99 A;  4UYE A;  2H60 A;  4QSS A;  4Z93 A;  2DVS A;  5HEN A;  2YW5 A;  5CGP A;  5D24 A;  5FH8 A;  2OSS A;  5EP7 A;  3P5O A;  4NYW A;  5I80 A;  5CP5 A;  3IU5 A;  5HQ5 A;  5F1H A;  4NR8 A;  4O7F A;  4NYX A;  4NR4 A;  4TS8 A;  4TTE A;  4IR4 A;  2YDW A;  4QY4 A;  4NUE A;  4YBT A;  3UV2 A;  4BW4 A;  5IID A;  4UIX A;  5E9I A;  4AKN A;  3U5P A;  5TB6 A;  4NUC A;  4QSV A;  4IR5 A;  4TZ8 A;  5CUG A;  5E9L A;  3G0L A;  4Y03 A;  1WUM A;  4QB3 A;  3O34 A;  2YEM A;  4O77 A;  5F1L A;  3MB3 A;  4Q0O A;  5ENB A;  4O74 A;  4TT4 A;  4CFL A;  4FLP A;  2D82 A;  4LZR A;  5FE0 A;  2RNX A;  5A83 A;  2OO1 A;  2F6J A;  5IBN A;  4N4I A;  3MUL A;  5F3A A;  5KO4 A;  1E6I A;  5D3T A;  5HJC A;  4A9L A;  4QC1 A;  5JWM A;  4O70 A;  5LJ0 A;  2RNY A;  4CFK A;  4NUD A;  2FSA A;  3QZT A;  5HM0 A;  5FBX A;  4KCX A;  4J1P A;  4IOR A;  4O78 A;  5HRV A;  5I1Q A;  4BW2 A;  4TQN A;  4QSP A;  5FDZ A;  5DW2 A;  5BT5 A;  5L96 A;  5IGL A;  5I7Y A;  5F60 A;  5HQ7 A;  4C67 A;  5HLS A;  3I3J A;  4A9I A;  5FE8 A;  2YEK A;  3QZS A;  3U5N A;  5TCM A;  4NS5 A;  5F61 A;  5F5Z A;  5H1V A;  4YY6 A;  5EA1 A;  1ZS5 A;  5LKT A;  4YYN A;  4IOO A;  3LJW A;  4CUQ A;  4O7B A;  2N9G A;  4HXK A;  3P1F A;  4ALH A;  5DFB A;  5H1T A;  4UIW A;  5ENH A;  5EU1 A;  4QNS A;  4MEP A;  5C89 A;  2MJV B;  5F62 A;  5D26 A;  5ENF A;  5ETD A;  5J0D A;  2RS9 B;  5D3L A;  5I40 A;  4CUR A;  5BT4 A;  5EQ1 A;  4O72 A;  5H1U A;  4YYD A;  5G4S A;  4YAB A;  5FB1 A;  3S91 A;  5LKU A;  4O7A A;  3TLP A;  5IG6 A;  5C87 A;  3O35 A;  3UW9 A;  2R0Y A;  4LYI A;  3UVX A;  4QUT A;  5DFC A;  4O7C A;  3LQH A;  5EGU A;  5HEM A;  3O33 A;  4WHW A;  4WHU A;  5E9Y A;  5E3D A;  5F63 A;  2E3K A;  3MXF A;  5D3N A;  4YC9 A;  4QEV A;  4QC3 A;  5EIC A;  5BT3 A;  5EV9 A;  5CQ5 A;  4TZ2 A;  3U5J A;  4O76 A;  4PCI A;  3SVF A;  4ZC9 A;  4A9M A;  5E74 A;  4CUP A;  4HBX A;  5D0C A;  5CQ7 A;  4QZS A;  5F36 A;  5A5N A;  5CQ4 A;  4HXM A;  4UYG A;  4N4G A;  4NRA A;  5FFV A;  3AQA A;  5ETB A;  5F25 A;  4J3I A;  2G4A A;  3D7C A;  3GG3 A;  5CUA A;  4BW3 A;  4CUU A;  4MR3 A;  4DON A;  5EWV A;  5DY7 A;  4HBW A;  4NRB A;  5D3P A;  4XY8 A;  4YH3 A;  5A85 A;  5ENI A;  4TU4 A;  1JM4 B;  5IGM A;  5ENG A;  5DLX A;  5C85 A;  4GPJ A;  5CQ3 A;  4C66 A;  4YYI A;  4MR4 A;  5CPE A;  5CQ6 A;  4A9E A;  4TYL A;  5E9K A;  5HCL A;  2D9E A;  4NR5 A;  5JI8 A;  4QYD A;  3UVD A;  5AMF A;  3UVY A;  5I83 A;  5DW1 A;  5DLZ A;  5AD2 A;  5LVR A;  4XYA A;  5I29 A;  5KTX A;  5ENC A;  4ZW1 A;  4XY9 A;  5DYA A;  5CUB A;  5CS8 A;  5IGN A;  2DAT A;  4Z6H A;  4MEN A;  5A5P A;  5AME A;  4O7E A;  5EPB A;  4WIV A;  5HQ6 A;  5CUC A;  4N3W A;  1N72 A;  5E7D A;  3Q2F A;  5EI4 A;  5D3H A;  5CRM A;  5II2 A;  5A82 A;  3HME A;  5LKZ A;  5EWH A;  3ZYU A;  5FE9 A;  5C8G A;  4A9O A;  4Z6I A;  4LYW A;  1JSP B;  5CZG A;  5EWC A;  4A9J A;  5CQT A;  5I7X A;  2YYN A;  5EPR A;  5H85 A;  5LJ1 A;  5C7N A;  2R0S A;  4YK0 A;  4BJX A;  4NQN A;  5I89 A;  5LJ2 A;  4NR9 A;  3JVM A;  5CFW A;  5FH6 A;  5DKD A;  4QSR A;  5L8T A;  2YEL A;  4QR4 A;  5FG4 A;  4LC2 A;  3SVH A;  4YAX A;  5FFY A;  5KU3 A;  5KTW A;  5FE7 A;  3LQJ A;  5E9V A;  2WP1 A;  5II1 A;  4O71 A;  4QSQ A;  5D3R A;  4NXJ A;  5CUE A;  3Q2E A;  5A7C A;  5FH7 A;  5A5Q A;  5EK9 A;  3NXB A;  5FG6 A;  4QSU A;  4LZS A;  4RVR A;  5HRW A;  4UIV A;  5CQ8 A;  2RNW A;  2L5E A;  5KTU A;  3U5M A;  3P1E A;  4TT6 A;  5DKC A;  4YYG A;  2LSP B;  2E7N A;  5HEL A;  5CQA A;  3MB4 A;  5FE2 A;  4QYL A;  4KV4 A;  5E3G A;  5DKH A;  4OGJ A;  3G0J A;  5HFQ A;  4PTB A;  1WUG A;  4MEQ A;  5CTL A;  4F3I A;  3U5K A;  4LR6 A;  3IU6 A;  4IOQ A;  4YAT A;  3HMF A;  3O36 A;  4QBM A;  4ZQL A;  5I88 A;  4HXR A;  4A9K A;  5LVQ A;  4QSW A;  5HRX A;  5ENE A;  4Q0N A;  5D3S A;  4E96 A;  5FE6 A;  4Z1Q A;  3LQI A;  3FKM X;  2DWW A;  4TU6 A;  4YBS A;  4OGI A;  3QZV A;  4UYF B;  5AD3 A;  4PCE A;  4J0R A;  4IR6 A;  2GRC A;  5A5S A;  4A9H A;  5CU8 A;  5EWW A;  3LXJ A;  4HXS A;  4O75 A;  4UYH A;  3U5L A;  2DVR A;  4UIT A;  3S92 A;  3MUK A;  1EQF A;  4IR3 A;  4TT2 A;  3U5O A;  5LKX A;  5ACY A;  4NYV A;  4YBM A;  5E9M A;  4QEU A;  4HBY A;  5FE1 A;  4HXP A;  3JVK A;  5K29 A;  2F6N A;  4LRG A;  4A9N A;  3K2J A;  2WP2 A;  4PKL A;  5FB0 A;  2KTB B;  3MQM A;  4UIU A;  3DWY A;  2I8N A;  5FE3 A;  3HMH A;  3O37 A;  4KV1 A;  4NRC A;  4XUA A;  5EIS A;  4ALG A;  4YYM A;  5A5O A;  4QR5 A;  2OUO A;  4NR6 A;  4OUF A;  2RO1 A;  4BHW A;  2RI7 A;  2L85 A;  4PY6 A;  5DYX A;  3P1C A;  5EVA A;  4BW1 A;  4QSX A;  5G4R A;  4QR3 A;  5DFD A;  4HXO A;  2DVV A;  4A9F A;  4YH4 A;  5ENJ A;  4LDF A;  4N4H A;  5L8U A;  3UV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...