4UIXA

N-terminal bromodomain of human brd4 with 7-(3,4-dimethoxyphenyl)-n-(1,1-dioxo-1-thian-4-yl)-5-methyl-4-oxo-4h,5h-thieno-3,2-c-pyridine-2- carboxamide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
MNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHKFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 4
publication title The Discovery of I-Brd9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 126
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uixA01
2RO1A 5D3JA 5F5ZA 5FE3A 5CQTA 4O77A 4XYAA 4OGIA 5I80A 5A5RA 4YABA 3G0LA 4Z93A 5EGUA 4TQNA 5J0DA 5FE2A 3U5JA 4QSTA 2DVRA 2KTBB 4NR7A 4O7BA 1ZS5A 4OUFA 3P1CA 2E3KA 3LQHA 4Z6HA 5H85A 4UIUA 3S91A 4UIXA 2RFJA 4Z6IA 4HXRA 4TTEA 5HQ7A 1EQFA 3O34A 4IOOA 5FH7A 4YYGA 4IR3A 4IOQA 5I7XA 5EPSA 4MEQA 5DW2A 4CUPA 3P1FA 4BHWA 4YH4A 5CTLA 4O75A 4YYJA 5H1TA 4MR6A 4UYHA 5D25A 5HRXA 5IIDA 4QSRA 3MULA 4A9OA 4TYLA 5ACYA 5IGKA 3IU5A 3UVDA 5JWMA 5L97A 4MR3A 4LZSA 4QNSA 5F36A 3O33A 2YELA 5CUGA 4LYWA 4YBMA 2WP1A 2YEKA 5CGPA 4CUUA 2RNYA 5HFRA 3ONIA 3U5KA 4N4FA 4IR5A 4WHWA 4NS5A 1E6IA 5FB0A 4QSQA 2YYNA 5D3NA 4O71A 4UIWA 4HBYA 4HBVA 5EQ1A 5FG6A 4N4IA 4O74A 3G0JA 5I89A 3U5OA 3UV2A 4MR5A 4HXNA 4E96A 4N3WA 3P5OA 4IORA 2G4AA 3JVKA 4YYDA 5EPBA 3JVLA 4KV1A 2RNWA 5CRZA 5E74A 5DX4A 5FFWA 4XY9A 2R0SA 4ZQLA 5FE1A 5E9MA 4PTBA 5HCLA 3JVMA 5ETDA 5HJCA 2F6JA 5COIA 5E3GA 5EWVA 4YY4A 5D26A 4F3IA 5AMFA 4A9JA 5ENJA 4ALGA 5II2A 4UYFB 5HM0A 5L8UA 5A5NA 5KTXA 4J0RA 4N4HA 3MB4A 3AQAA 5DLXA 5LJ0A 3O37A 4C67A 4YK0A 5D3PA 5EWCA 4QC3A 4O7FA 4QZSA 5IGMA 5E0RA 3U5LA 4LZRA 5I29A 5D7XA 3IU6A 5F63A 3P1EA 4CFKA 4YC9A 5CS8A 5E9IA 5D24A 5CRMA 5E7DA 2RI7A 3LQJA 5DYXA 5HQ6A 5JI8A 4NUEA 5DFBA 5LJ1A 5F1HA 5D3RA 5FFVA 5CQ5A 4QSUA 5C4QA 3HMFA 4KV4A 2RNXA 5IG6A 5II1A 5ENEA 4UIVA 4IR6A 3GG3A 5EP7A 5CQ8A 4NUDA 5TCMA 4C66A 5CQ4A 5FG5A 5C89A 4LR6A 4N4GA 4QSSA 4NR4A 4Q0NA 5FE0A 5E3DA 4MEPA 5EWWA 5ENBA 4DONA 5DFDA 4XUAA 5IGLA 3U5NA 5AD2A 5AD3A 4NUCA 4XY8A 4ALHA 5EISA 3AADA 5HRWA 4TT4A 4TU6A 5DYCA 5BT3A 2YQDA 3S92A 4J3IA 3U5MA 5ENCA 5A5PA 3P1DA 4PS5A 3HMEA 5CP5A 2DKWA 2L5EA 5LVQA 3I3JA 5EI4A 4UYDA 5CUDA 5L8TA 3RCWA 5CY9A 5KU3A 4HXMA 4O76A 3MXFA 5E9VA 5EA1A 3K2JA 5E9LA 2I8NA 4A9LA 5I86A 5ENGA 5F3AA 5EK9A 4YAXA 5H1VA 4NR9A 3UW9A 3Q2EA 5KTUA 2F6NA 5E73A 5K29A 4LYSA 3UVWA 2DVVA 5EWHA 4QBMA 4ZC9A 4KCXA 4UYFA 5HELA 5A5OA 4YYKA 4QEWA 4HBWA 3LJWA 4HBXA 2DATA 3FKMX 4NR6A 5D3SA 4A9HA 3UVYA 4QC1A 2R10A 3MUKA 4J1PA 4O7CA 5HQ5A 3UVXA 4YYMA 4MR4A 3TLPA 4LDFA 2YDWA 3UV4A 4O78A 5L98A 1X0JA 5A5SA 3MB3A 3QZTA 5FE4A 5C8GA 5FE9A 5L96A 4FLPA 5CUEA 4O7EA 3ZYUA 4HXLA 4A9NA 5BT5A 4J0SA 4TZ2A 2MJVB 4LRGA 5HEMA 5ENHA 5HFQA 5CU8A 4QEUA 4Z1QA 5KHMA 5C87A 5CQAA 4X2IA 5EU1A 2D9EA 1JM4B 5A82A 5A83A 4BW2A 4CUTA 4RVRA 4NXJA 5CUCA 4A9IA 4HXSA 4LZ2A 5BT4A 5DYAA 4NR5A 5FFYA 4A9KA 2NXBA 5CUBA 5LUUA 5ENIA 4YYIA 5D3HA 5ENFA 4AKNA 2FSAA 4LYIA 4HXPA 5DLZA 5CQ7A 4CL9A 4YBSA 4TT2A 5LVRA 5D3TA 4PKLA 4BW3A 5CZGA 3U5PA 4GPJA 3D7CA 4O70A 5I1QA 5F62A 5FBXA 5IBNA 2DVQA 4UIZA 4WIVA 5CQ6A 4YYNA 5L99A 5LKZA 1WUMA 5I7YA 4QEVA 4QUTA 5FE8A 3QZVA 4MENA 3LXJA 5FG4A 4QR3A 4QR5A 3Q2FA 2RS9B 2OO1A 5ETBA 5F2PA 4NYVA 2LSPB 4UIYA 5CUAA 4CUSA 5IGNA 5FH8A 4LC2A 4NQMA 5D0CA 5I40A 2E7NA 5C85A 5A7CA 5DKDA 5HRVA 5CPEA 5DFCA 5F25A 5F61A 5D3LA 2OUOA 2E7OA 5E9YA 5FDZA 5FE7A 4QY4A 4UITA 5KO4A 4YBTA 4TZ8A 4QYLA 5C7NA 4A9EA 3DWYA 4YH3A 2WP2A 4QSWA 2YEMA 4QSXA 1WUGA 4HXKA 4OGJA 2DVSA 3DAIA 3JVJA 4NR8A 5DKCA 5A81A 4CLBA 5LKXA 3LQIA 5EWDA 5EV9A 5F60A 5CFWA 3SVHA 4WHUA 2R0YA 4CFLA 5LKTA 5HLSA 2H60A 3UV5A 5H1UA 5EPRA 4TU4A 4HXOA 4O72A 2L85A 4QB3A 4TS8A 1JSPB 5FE6A 3MQMA 5FB1A 4CURA 5CQ3A 5DW1A 4NRBA 4Z1SA 5FH6A 3QZSA 4NQNA 4QYDA 4MEOA 1F68A 5A85A 1N72A 4YYHA 5I83A 2GRCA 5EM3A 4A9MA 5KTWA 5EVAA 5G4RA 5LJ2A 4YATA 4NYXA 4PCIA 4QR4A 4BW4A 4TT6A 4NRAA 4QUUA 3O35A 5AMEA 2YW5A 5A5QA 2DWWA 5EICA 4NYWA 4BW1A 2OSSA 5I88A 3SVFA 3HMHA 5E9KA 4PCEA 2I7KA 5DKHA 5DYUA 4YY6A 5TB6A 4YADA 4QSVA 5DBMA 4ZW1A 2N9GA 4O7AA 5DY7A 5G4SA 2R0VA 4Q0OA 5HENA 4BJXA 3SVGA 2D82A 2L84A 4XUBA 4A9FA 4PY6A 4QSPA 5LKUA 4CUQA 4Y03A 5FE5A 5F1LA 4IR4A 4NRCA 4UYGA 3NXBA 3O36A 4UYEA
chains in the Genus database with same CATH superfamily
2RO1A 5D3JA 5F5ZA 5FE3A 5CQTA 4O77A 4XYAA 4OGIA 5I80A 5A5RA 4YABA 3G0LA 4Z93A 5EGUA 4TQNA 5J0DA 5FE2A 3U5JA 4QSTA 2DVRA 2KTBB 4NR7A 4O7BA 1ZS5A 4OUFA 3P1CA 2E3KA 3LQHA 4Z6HA 5H85A 4UIUA 3S91A 4UIXA 2RFJA 4Z6IA 4AKIA 4HXRA 4TTEA 5HQ7A 1EQFA 3O34A 4IOOA 5FH7A 4YYGA 4IR3A 4IOQA 5I7XA 5EPSA 4MEQA 5DW2A 4CUPA 3P1FA 4BHWA 4YH4A 5CTLA 4O75A 4YYJA 5H1TA 4MR6A 4UYHA 5D25A 5HRXA 5IIDA 4QSRA 3MULA 4A9OA 4TYLA 5ACYA 5IGKA 3IU5A 3UVDA 5JWMA 5L97A 4MR3A 4LZSA 4QNSA 5F36A 3O33A 2YELA 5CUGA 4LYWA 4YBMA 2WP1A 2YEKA 5CGPA 4CUUA 2RNYA 5HFRA 3ONIA 3U5KA 4N4FA 4IR5A 4WHWA 4NS5A 1E6IA 5FB0A 4QSQA 2YYNA 5D3NA 4O71A 4UIWA 4HBYA 4HBVA 5EQ1A 5FG6A 4N4IA 4O74A 3G0JA 5I89A 3U5OA 3UV2A 4MR5A 4HXNA 4E96A 4N3WA 3P5OA 4IORA 2G4AA 3JVKA 4YYDA 5EPBA 3JVLA 4KV1A 2RNWA 5CRZA 5E74A 5DX4A 5FFWA 4XY9A 2R0SA 4ZQLA 5FE1A 5E9MA 4PTBA 5HCLA 3JVMA 5ETDA 5HJCA 2F6JA 5COIA 5E3GA 5EWVA 4YY4A 5D26A 4F3IA 5AMFA 4A9JA 5ENJA 4ALGA 5II2A 4UYFB 5HM0A 5L8UA 5A5NA 5KTXA 4J0RA 4N4HA 3MB4A 3AQAA 5DLXA 5LJ0A 3O37A 4C67A 4AKHA 4YK0A 5D3PA 5EWCA 4QC3A 4O7FA 4QZSA 5IGMA 5E0RA 3U5LA 4LZRA 5I29A 5D7XA 3IU6A 5F63A 3P1EA 4CFKA 4YC9A 5CS8A 5E9IA 5D24A 5CRMA 5E7DA 2RI7A 3LQJA 5DYXA 5HQ6A 5JI8A 4NUEA 5DFBA 5LJ1A 5F1HA 5D3RA 5FFVA 5CQ5A 4QSUA 5C4QA 3HMFA 4KV4A 2RNXA 5IG6A 5II1A 5ENEA 4UIVA 4IR6A 3GG3A 5EP7A 5CQ8A 4NUDA 5TCMA 4C66A 5CQ4A 5FG5A 5C89A 4LR6A 4N4GA 4QSSA 4NR4A 4Q0NA 5FE0A 5E3DA 4MEPA 5EWWA 5ENBA 4DONA 5DFDA 4XUAA 5IGLA 3U5NA 5AD2A 5AD3A 4NUCA 4XY8A 4ALHA 5EISA 3AADA 5HRWA 4TT4A 4TU6A 5DYCA 5BT3A 2YQDA 3S92A 4J3IA 3U5MA 5ENCA 5A5PA 3P1DA 4PS5A 3HMEA 5CP5A 2DKWA 2L5EA 5LVQA 3I3JA 5EI4A 4UYDA 5CUDA 5L8TA 3RCWA 3VKHA 5CY9A 5KU3A 4HXMA 4AKGA 4O76A 3MXFA 5E9VA 5EA1A 3K2JA 5E9LA 2I8NA 4A9LA 5I86A 5ENGA 5F3AA 5EK9A 4YAXA 5H1VA 4NR9A 3UW9A 3Q2EA 5KTUA 2F6NA 5E73A 5K29A 4LYSA 3UVWA 2DVVA 5EWHA 4QBMA 4ZC9A 4KCXA 4UYFA 5HELA 5A5OA 1ZKRA 4YYKA 4QEWA 4HBWA 3LJWA 4HBXA 2DATA 3FKMX 4NR6A 5D3SA 4A9HA 3UVYA 4QC1A 2R10A 3MUKA 4J1PA 4O7CA 5HQ5A 3UVXA 4YYMA 4MR4A 3TLPA 4LDFA 2YDWA 3UV4A 4O78A 5L98A 1X0JA 5A5SA 3MB3A 3QZTA 5FE4A 5C8GA 5FE9A 5L96A 4FLPA 5CUEA 4O7EA 3ZYUA 4HXLA 4A9NA 5BT5A 4J0SA 4TZ2A 2MJVB 4LRGA 5HEMA 5ENHA 5HFQA 5CU8A 4QEUA 4Z1QA 5KHMA 5C87A 5CQAA 4X2IA 5EU1A 2D9EA 1JM4B 5A82A 3VKGA 5A83A 4BW2A 4CUTA 4RVRA 4NXJA 5CUCA 4A9IA 4HXSA 4LZ2A 5BT4A 5DYAA 4NR5A 5FFYA 4A9KA 2NXBA 3ERRA 5CUBA 5LUUA 5ENIA 4YYIA 5D3HA 5ENFA 4AKNA 2FSAA 4LYIA 4HXPA 5DLZA 5CQ7A 4CL9A 4YBSA 4TT2A 5LVRA 5D3TA 4PKLA 4BW3A 5CZGA 3U5PA 4GPJA 3D7CA 4O70A 5I1QA 5F62A 5FBXA 5IBNA 2DVQA 4UIZA 4WIVA 5CQ6A 4YYNA 5L99A 5LKZA 1WUMA 5I7YA 4QEVA 4QUTA 5FE8A 3QZVA 4MENA 3LXJA 5FG4A 4QR3A 4QR5A 3Q2FA 2RS9B 2OO1A 5ETBA 5F2PA 4NYVA 2LSPB 4UIYA 5CUAA 4CUSA 5IGNA 5FH8A 4LC2A 4NQMA 5D0CA 5I40A 2E7NA 5C85A 5A7CA 5DKDA 5HRVA 5CPEA 5DFCA 5F25A 5F61A 5D3LA 2OUOA 2E7OA 5E9YA 5FDZA 5FE7A 4QY4A 4UITA 5KO4A 4YBTA 4TZ8A 4QYLA 5C7NA 4A9EA 3DWYA 4YH3A 2WP2A 4QSWA 2YEMA 4QSXA 1WUGA 4HXKA 4OGJA 2DVSA 3DAIA 3JVJA 4NR8A 5DKCA 5A81A 4CLBA 5LKXA 3LQIA 5EWDA 5EV9A 5F60A 5CFWA 3SVHA 4WHUA 2R0YA 4CFLA 5LKTA 5HLSA 2H60A 3UV5A 5H1UA 5EPRA 4TU4A 4HXOA 4O72A 2L85A 4QB3A 4TS8A 1JSPB 5FE6A 3MQMA 5FB1A 4CURA 5CQ3A 5DW1A 4NRBA 4Z1SA 5FH6A 3QZSA 4NQNA 4QYDA 4MEOA 1F68A 5A85A 1N72A 4YYHA 5I83A 2GRCA 5EM3A 4A9MA 5KTWA 5EVAA 5G4RA 5LJ2A 4YATA 4NYXA 4PCIA 4QR4A 4BW4A 4TT6A 4NRAA 4QUUA 3O35A 5AMEA 2YW5A 5A5QA 2DWWA 2EJNA 5EICA 4NYWA 4BW1A 2OSSA 5I88A 3D1DA 3SVFA 3HMHA 5E9KA 4PCEA 2I7KA 5DKHA 5DYUA 4AI6A 4YY6A 5TB6A 4YADA 4QSVA 5DBMA 4ZW1A 2N9GA 4O7AA 5DY7A 5G4SA 2R0VA 1PUOA 4Q0OA 5HENA 4BJXA 3SVGA 2D82A 2L84A 4XUBA 4A9FA 4PY6A 3D1BA 4QSPA 5LKUA 4CUQA 4Y03A 5FE5A 5F1LA 4IR4A 4NRCA 4UYGA 3NXBA 3O36A 4UYEA
chains in the Genus database with same CATH topology
2RO1A 5D3JA 5F5ZA 5FE3A 5CQTA 4O77A 4XYAA 4OGIA 5I80A 5A5RA 4YABA 3G0LA 4Z93A 5EGUA 4TQNA 5J0DA 5FE2A 3U5JA 4QSTA 2DVRA 2KTBB 4NR7A 4O7BA 1ZS5A 4OUFA 3P1CA 2E3KA 3LQHA 4Z6HA 5H85A 4UIUA 3S91A 4UIXA 2RFJA 4Z6IA 4HXRA 4TTEA 5HQ7A 1EQFA 3O34A 4IOOA 5FH7A 4YYGA 4IR3A 4IOQA 5I7XA 5EPSA 4MEQA 5DW2A 4CUPA 3P1FA 4BHWA 4YH4A 5CTLA 4O75A 4YYJA 5H1TA 4MR6A 4UYHA 5D25A 5HRXA 5IIDA 4QSRA 3MULA 4A9OA 4TYLA 5ACYA 5IGKA 3IU5A 3UVDA 5JWMA 5L97A 4MR3A 4LZSA 4QNSA 5F36A 3O33A 2YELA 5CUGA 4LYWA 4YBMA 2WP1A 2YEKA 5CGPA 4CUUA 2RNYA 5HFRA 3ONIA 3U5KA 4N4FA 4IR5A 4WHWA 4NS5A 1E6IA 5FB0A 4QSQA 2YYNA 5D3NA 4O71A 4UIWA 4HBYA 4HBVA 5EQ1A 5FG6A 4N4IA 4O74A 3G0JA 5I89A 3U5OA 3UV2A 4MR5A 4HXNA 4E96A 4N3WA 3P5OA 4IORA 2G4AA 3JVKA 4YYDA 5EPBA 3JVLA 4KV1A 2RNWA 5CRZA 5E74A 5DX4A 5FFWA 4XY9A 2R0SA 4ZQLA 5FE1A 5E9MA 4PTBA 5HCLA 3JVMA 5ETDA 5HJCA 2F6JA 5COIA 5E3GA 5EWVA 4YY4A 5D26A 4F3IA 5AMFA 4A9JA 5ENJA 4ALGA 5II2A 4UYFB 5HM0A 5L8UA 5A5NA 5KTXA 4J0RA 4N4HA 3MB4A 3AQAA 5DLXA 5LJ0A 3O37A 4C67A 4YK0A 5D3PA 5EWCA 4QC3A 4O7FA 4QZSA 5IGMA 5E0RA 3U5LA 4LZRA 5I29A 5D7XA 3IU6A 5F63A 3P1EA 4CFKA 4YC9A 5CS8A 5E9IA 5D24A 5CRMA 5E7DA 2RI7A 3LQJA 5DYXA 5HQ6A 5JI8A 4NUEA 5DFBA 5LJ1A 5F1HA 5D3RA 5FFVA 5CQ5A 4QSUA 5C4QA 3HMFA 4KV4A 2RNXA 5IG6A 5II1A 5ENEA 4UIVA 4IR6A 3GG3A 5EP7A 5CQ8A 4NUDA 5TCMA 4C66A 5CQ4A 5FG5A 5C89A 4LR6A 4N4GA 4QSSA 4NR4A 4Q0NA 5FE0A 5E3DA 4MEPA 5EWWA 5ENBA 4DONA 5DFDA 4XUAA 5IGLA 3U5NA 5AD2A 5AD3A 4NUCA 4XY8A 4ALHA 5EISA 3AADA 5HRWA 4TT4A 4TU6A 5DYCA 5BT3A 2YQDA 3S92A 4J3IA 3U5MA 5ENCA 5A5PA 3P1DA 4PS5A 3HMEA 5CP5A 2DKWA 2L5EA 5LVQA 3I3JA 5EI4A 4UYDA 5CUDA 5L8TA 3RCWA 5CY9A 5KU3A 4HXMA 4O76A 3MXFA 5E9VA 5EA1A 3K2JA 5E9LA 2I8NA 4A9LA 5I86A 5ENGA 5F3AA 5EK9A 4YAXA 5H1VA 4NR9A 3UW9A 3Q2EA 5KTUA 2F6NA 5E73A 5K29A 4LYSA 3UVWA 2DVVA 5EWHA 4QBMA 4ZC9A 4KCXA 4UYFA 5HELA 5A5OA 4YYKA 4QEWA 4HBWA 3LJWA 4HBXA 2DATA 3FKMX 4NR6A 5D3SA 4A9HA 3UVYA 4QC1A 2R10A 3MUKA 4J1PA 4O7CA 5HQ5A 3UVXA 4YYMA 4MR4A 3TLPA 4LDFA 2YDWA 3UV4A 4O78A 5L98A 1X0JA 5A5SA 3MB3A 3QZTA 5FE4A 5C8GA 5FE9A 5L96A 4FLPA 5CUEA 4O7EA 3ZYUA 4HXLA 4A9NA 5BT5A 4J0SA 4TZ2A 2MJVB 4LRGA 5HEMA 5ENHA 5HFQA 5CU8A 4QEUA 4Z1QA 5KHMA 5C87A 5CQAA 4X2IA 5EU1A 2D9EA 1JM4B 5A82A 5A83A 4BW2A 4CUTA 4RVRA 4NXJA 5CUCA 4A9IA 4HXSA 4LZ2A 5BT4A 5DYAA 4NR5A 5FFYA 4A9KA 2NXBA 5CUBA 5LUUA 5ENIA 4YYIA 5D3HA 5ENFA 4AKNA 2FSAA 4LYIA 4HXPA 5DLZA 5CQ7A 4CL9A 4YBSA 4TT2A 5LVRA 5D3TA 4PKLA 4BW3A 5CZGA 3U5PA 4GPJA 3D7CA 4O70A 5I1QA 5F62A 5FBXA 5IBNA 2DVQA 4UIZA 4WIVA 5CQ6A 4YYNA 5L99A 5LKZA 1WUMA 5I7YA 4QEVA 4QUTA 5FE8A 3QZVA 4MENA 3LXJA 5FG4A 4QR3A 4QR5A 3Q2FA 2RS9B 2OO1A 5ETBA 5F2PA 4NYVA 2LSPB 4UIYA 5CUAA 4CUSA 5IGNA 5FH8A 4LC2A 4NQMA 5D0CA 5I40A 2E7NA 5C85A 5A7CA 5DKDA 5HRVA 5CPEA 5DFCA 5F25A 5F61A 5D3LA 2OUOA 2E7OA 5E9YA 5FDZA 5FE7A 4QY4A 4UITA 5KO4A 4YBTA 4TZ8A 4QYLA 5C7NA 4A9EA 3DWYA 4YH3A 2WP2A 4QSWA 2YEMA 4QSXA 1WUGA 4HXKA 4OGJA 2DVSA 3DAIA 3JVJA 4NR8A 5DKCA 5A81A 4CLBA 5LKXA 3LQIA 5EWDA 5EV9A 5F60A 5CFWA 3SVHA 4WHUA 2R0YA 4CFLA 5LKTA 5HLSA 2H60A 3UV5A 5H1UA 5EPRA 4TU4A 4HXOA 4O72A 2L85A 4QB3A 4TS8A 1JSPB 5FE6A 3MQMA 5FB1A 4CURA 5CQ3A 5DW1A 4NRBA 4Z1SA 5FH6A 3QZSA 4NQNA 4QYDA 4MEOA 1F68A 5A85A 1N72A 4YYHA 5I83A 2GRCA 5EM3A 4A9MA 5KTWA 5EVAA 5G4RA 5LJ2A 4YATA 4NYXA 4PCIA 4QR4A 4BW4A 4TT6A 4NRAA 4QUUA 3O35A 5AMEA 2YW5A 5A5QA 2DWWA 5EICA 4NYWA 4BW1A 2OSSA 5I88A 3SVFA 3HMHA 5E9KA 4PCEA 2I7KA 5DKHA 5DYUA 4YY6A 5TB6A 4YADA 4QSVA 5DBMA 4ZW1A 2N9GA 4O7AA 5DY7A 5G4SA 2R0VA 4Q0OA 5HENA 4BJXA 3SVGA 2D82A 2L84A 4XUBA 4A9FA 4PY6A 4QSPA 5LKUA 4CUQA 4Y03A 5FE5A 5F1LA 4IR4A 4NRCA 4UYGA 3NXBA 3O36A 4UYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RO1 A;  5D3J A;  5F5Z A;  5FE3 A;  5CQT A;  4O77 A;  4XYA A;  4OGI A;  5I80 A;  5A5R A;  4YAB A;  3G0L A;  4Z93 A;  5EGU A;  4TQN A;  5J0D A;  5FE2 A;  3U5J A;  4QST A;  2DVR A;  2KTB B;  4NR7 A;  4O7B A;  1ZS5 A;  4OUF A;  3P1C A;  2E3K A;  3LQH A;  4Z6H A;  5H85 A;  4UIU A;  3S91 A;  4UIX A;  2RFJ A;  4Z6I A;  4HXR A;  4TTE A;  5HQ7 A;  1EQF A;  3O34 A;  4IOO A;  5FH7 A;  4YYG A;  4IR3 A;  4IOQ A;  5I7X A;  5EPS A;  4MEQ A;  5DW2 A;  4CUP A;  3P1F A;  4BHW A;  4YH4 A;  5CTL A;  4O75 A;  4YYJ A;  5H1T A;  4MR6 A;  4UYH A;  5D25 A;  5HRX A;  5IID A;  4QSR A;  3MUL A;  4A9O A;  4TYL A;  5ACY A;  5IGK A;  3IU5 A;  3UVD A;  5JWM A;  5L97 A;  4MR3 A;  4LZS A;  4QNS A;  5F36 A;  3O33 A;  2YEL A;  5CUG A;  4LYW A;  4YBM A;  2WP1 A;  2YEK A;  5CGP A;  4CUU A;  2RNY A;  5HFR A;  3ONI A;  3U5K A;  4N4F A;  4IR5 A;  4WHW A;  4NS5 A;  1E6I A;  5FB0 A;  4QSQ A;  2YYN A;  5D3N A;  4O71 A;  4UIW A;  4HBY A;  4HBV A;  5EQ1 A;  5FG6 A;  4N4I A;  4O74 A;  3G0J A;  5I89 A;  3U5O A;  3UV2 A;  4MR5 A;  4HXN A;  4E96 A;  4N3W A;  3P5O A;  4IOR A;  2G4A A;  3JVK A;  4YYD A;  5EPB A;  3JVL A;  4KV1 A;  2RNW A;  5CRZ A;  5E74 A;  5DX4 A;  5FFW A;  4XY9 A;  2R0S A;  4ZQL A;  5FE1 A;  5E9M A;  4PTB A;  5HCL A;  3JVM A;  5ETD A;  5HJC A;  2F6J A;  5COI A;  5E3G A;  5EWV A;  4YY4 A;  5D26 A;  4F3I A;  5AMF A;  4A9J A;  5ENJ A;  4ALG A;  5II2 A;  4UYF B;  5HM0 A;  5L8U A;  5A5N A;  5KTX A;  4J0R A;  4N4H A;  3MB4 A;  3AQA A;  5DLX A;  5LJ0 A;  3O37 A;  4C67 A;  4YK0 A;  5D3P A;  5EWC A;  4QC3 A;  4O7F A;  4QZS A;  5IGM A;  5E0R A;  3U5L A;  4LZR A;  5I29 A;  5D7X A;  3IU6 A;  5F63 A;  3P1E A;  4CFK A;  4YC9 A;  5CS8 A;  5E9I A;  5D24 A;  5CRM A;  5E7D A;  2RI7 A;  3LQJ A;  5DYX A;  5HQ6 A;  5JI8 A;  4NUE A;  5DFB A;  5LJ1 A;  5F1H A;  5D3R A;  5FFV A;  5CQ5 A;  4QSU A;  5C4Q A;  3HMF A;  4KV4 A;  2RNX A;  5IG6 A;  5II1 A;  5ENE A;  4UIV A;  4IR6 A;  3GG3 A;  5EP7 A;  5CQ8 A;  4NUD A;  5TCM A;  4C66 A;  5CQ4 A;  5FG5 A;  5C89 A;  4LR6 A;  4N4G A;  4QSS A;  4NR4 A;  4Q0N A;  5FE0 A;  5E3D A;  4MEP A;  5EWW A;  5ENB A;  4DON A;  5DFD A;  4XUA A;  5IGL A;  3U5N A;  5AD2 A;  5AD3 A;  4NUC A;  4XY8 A;  4ALH A;  5EIS A;  3AAD A;  5HRW A;  4TT4 A;  4TU6 A;  5DYC A;  5BT3 A;  2YQD A;  3S92 A;  4J3I A;  3U5M A;  5ENC A;  5A5P A;  3P1D A;  4PS5 A;  3HME A;  5CP5 A;  2DKW A;  2L5E A;  5LVQ A;  3I3J A;  5EI4 A;  4UYD A;  5CUD A;  5L8T A;  3RCW A;  5CY9 A;  5KU3 A;  4HXM A;  4O76 A;  3MXF A;  5E9V A;  5EA1 A;  3K2J A;  5E9L A;  2I8N A;  4A9L A;  5I86 A;  5ENG A;  5F3A A;  5EK9 A;  4YAX A;  5H1V A;  4NR9 A;  3UW9 A;  3Q2E A;  5KTU A;  2F6N A;  5E73 A;  5K29 A;  4LYS A;  3UVW A;  2DVV A;  5EWH A;  4QBM A;  4ZC9 A;  4KCX A;  4UYF A;  5HEL A;  5A5O A;  4YYK A;  4QEW A;  4HBW A;  3LJW A;  4HBX A;  2DAT A;  3FKM X;  4NR6 A;  5D3S A;  4A9H A;  3UVY A;  4QC1 A;  2R10 A;  3MUK A;  4J1P A;  4O7C A;  5HQ5 A;  3UVX A;  4YYM A;  4MR4 A;  3TLP A;  4LDF A;  2YDW A;  3UV4 A;  4O78 A;  5L98 A;  1X0J A;  5A5S A;  3MB3 A;  3QZT A;  5FE4 A;  5C8G A;  5FE9 A;  5L96 A;  4FLP A;  5CUE A;  4O7E A;  3ZYU A;  4HXL A;  4A9N A;  5BT5 A;  4J0S A;  4TZ2 A;  2MJV B;  4LRG A;  5HEM A;  5ENH A;  5HFQ A;  5CU8 A;  4QEU A;  4Z1Q A;  5KHM A;  5C87 A;  5CQA A;  4X2I A;  5EU1 A;  2D9E A;  1JM4 B;  5A82 A;  5A83 A;  4BW2 A;  4CUT A;  4RVR A;  4NXJ A;  5CUC A;  4A9I A;  4HXS A;  4LZ2 A;  5BT4 A;  5DYA A;  4NR5 A;  5FFY A;  4A9K A;  2NXB A;  5CUB A;  5LUU A;  5ENI A;  4YYI A;  5D3H A;  5ENF A;  4AKN A;  2FSA A;  4LYI A;  4HXP A;  5DLZ A;  5CQ7 A;  4CL9 A;  4YBS A;  4TT2 A;  5LVR A;  5D3T A;  4PKL A;  4BW3 A;  5CZG A;  3U5P A;  4GPJ A;  3D7C A;  4O70 A;  5I1Q A;  5F62 A;  5FBX A;  5IBN A;  2DVQ A;  4UIZ A;  4WIV A;  5CQ6 A;  4YYN A;  5L99 A;  5LKZ A;  1WUM A;  5I7Y A;  4QEV A;  4QUT A;  5FE8 A;  3QZV A;  4MEN A;  3LXJ A;  5FG4 A;  4QR3 A;  4QR5 A;  3Q2F A;  2RS9 B;  2OO1 A;  5ETB A;  5F2P A;  4NYV A;  2LSP B;  4UIY A;  5CUA A;  4CUS A;  5IGN A;  5FH8 A;  4LC2 A;  4NQM A;  5D0C A;  5I40 A;  2E7N A;  5C85 A;  5A7C A;  5DKD A;  5HRV A;  5CPE A;  5DFC A;  5F25 A;  5F61 A;  5D3L A;  2OUO A;  2E7O A;  5E9Y A;  5FDZ A;  5FE7 A;  4QY4 A;  4UIT A;  5KO4 A;  4YBT A;  4TZ8 A;  4QYL A;  5C7N A;  4A9E A;  3DWY A;  4YH3 A;  2WP2 A;  4QSW A;  2YEM A;  4QSX A;  1WUG A;  4HXK A;  4OGJ A;  2DVS A;  3DAI A;  3JVJ A;  4NR8 A;  5DKC A;  5A81 A;  4CLB A;  5LKX A;  3LQI A;  5EWD A;  5EV9 A;  5F60 A;  5CFW A;  3SVH A;  4WHU A;  2R0Y A;  4CFL A;  5LKT A;  5HLS A;  2H60 A;  3UV5 A;  5H1U A;  5EPR A;  4TU4 A;  4HXO A;  4O72 A;  2L85 A;  4QB3 A;  4TS8 A;  1JSP B;  5FE6 A;  3MQM A;  5FB1 A;  4CUR A;  5CQ3 A;  5DW1 A;  4NRB A;  4Z1S A;  5FH6 A;  3QZS A;  4NQN A;  4QYD A;  4MEO A;  1F68 A;  5A85 A;  1N72 A;  4YYH A;  5I83 A;  2GRC A;  5EM3 A;  4A9M A;  5KTW A;  5EVA A;  5G4R A;  5LJ2 A;  4YAT A;  4NYX A;  4PCI A;  4QR4 A;  4BW4 A;  4TT6 A;  4NRA A;  4QUU A;  3O35 A;  5AME A;  2YW5 A;  5A5Q A;  2DWW A;  5EIC A;  4NYW A;  4BW1 A;  2OSS A;  5I88 A;  3SVF A;  3HMH A;  5E9K A;  4PCE A;  2I7K A;  5DKH A;  5DYU A;  4YY6 A;  5TB6 A;  4YAD A;  4QSV A;  5DBM A;  4ZW1 A;  2N9G A;  4O7A A;  5DY7 A;  5G4S A;  2R0V A;  4Q0O A;  5HEN A;  4BJX A;  3SVG A;  2D82 A;  2L84 A;  4XUB A;  4A9F A;  4PY6 A;  4QSP A;  5LKU A;  4CUQ A;  4Y03 A;  5FE5 A;  5F1L A;  4IR4 A;  4NRC A;  4UYG A;  3NXB A;  3O36 A;  4UYE A; 
#chains in the Genus database with same CATH topology
 2RO1 A;  5D3J A;  5F5Z A;  5FE3 A;  5CQT A;  4O77 A;  4XYA A;  4OGI A;  5I80 A;  5A5R A;  4YAB A;  3G0L A;  4Z93 A;  5EGU A;  4TQN A;  5J0D A;  5FE2 A;  3U5J A;  4QST A;  2DVR A;  2KTB B;  4NR7 A;  4O7B A;  1ZS5 A;  4OUF A;  3P1C A;  2E3K A;  3LQH A;  4Z6H A;  5H85 A;  4UIU A;  3S91 A;  4UIX A;  2RFJ A;  4Z6I A;  4AKI A;  4HXR A;  4TTE A;  5HQ7 A;  1EQF A;  3O34 A;  4IOO A;  5FH7 A;  4YYG A;  4IR3 A;  4IOQ A;  5I7X A;  5EPS A;  4MEQ A;  5DW2 A;  4CUP A;  3P1F A;  4BHW A;  4YH4 A;  5CTL A;  4O75 A;  4YYJ A;  5H1T A;  4MR6 A;  4UYH A;  5D25 A;  5HRX A;  5IID A;  4QSR A;  3MUL A;  4A9O A;  4TYL A;  5ACY A;  5IGK A;  3IU5 A;  3UVD A;  5JWM A;  5L97 A;  4MR3 A;  4LZS A;  4QNS A;  5F36 A;  3O33 A;  2YEL A;  5CUG A;  4LYW A;  4YBM A;  2WP1 A;  2YEK A;  5CGP A;  4CUU A;  2RNY A;  5HFR A;  3ONI A;  3U5K A;  4N4F A;  4IR5 A;  4WHW A;  4NS5 A;  1E6I A;  5FB0 A;  4QSQ A;  2YYN A;  5D3N A;  4O71 A;  4UIW A;  4HBY A;  4HBV A;  5EQ1 A;  5FG6 A;  4N4I A;  4O74 A;  3G0J A;  5I89 A;  3U5O A;  3UV2 A;  4MR5 A;  4HXN A;  4E96 A;  4N3W A;  3P5O A;  4IOR A;  2G4A A;  3JVK A;  4YYD A;  5EPB A;  3JVL A;  4KV1 A;  2RNW A;  5CRZ A;  5E74 A;  5DX4 A;  5FFW A;  4XY9 A;  2R0S A;  4ZQL A;  5FE1 A;  5E9M A;  4PTB A;  5HCL A;  3JVM A;  5ETD A;  5HJC A;  2F6J A;  5COI A;  5E3G A;  5EWV A;  4YY4 A;  5D26 A;  4F3I A;  5AMF A;  4A9J A;  5ENJ A;  4ALG A;  5II2 A;  4UYF B;  5HM0 A;  5L8U A;  5A5N A;  5KTX A;  4J0R A;  4N4H A;  3MB4 A;  3AQA A;  5DLX A;  5LJ0 A;  3O37 A;  4C67 A;  4AKH A;  4YK0 A;  5D3P A;  5EWC A;  4QC3 A;  4O7F A;  4QZS A;  5IGM A;  5E0R A;  3U5L A;  4LZR A;  5I29 A;  5D7X A;  3IU6 A;  5F63 A;  3P1E A;  4CFK A;  4YC9 A;  5CS8 A;  5E9I A;  5D24 A;  5CRM A;  5E7D A;  2RI7 A;  3LQJ A;  5DYX A;  5HQ6 A;  5JI8 A;  4NUE A;  5DFB A;  5LJ1 A;  5F1H A;  5D3R A;  5FFV A;  5CQ5 A;  4QSU A;  5C4Q A;  3HMF A;  4KV4 A;  2RNX A;  5IG6 A;  5II1 A;  5ENE A;  4UIV A;  4IR6 A;  3GG3 A;  5EP7 A;  5CQ8 A;  4NUD A;  5TCM A;  4C66 A;  5CQ4 A;  5FG5 A;  5C89 A;  4LR6 A;  4N4G A;  4QSS A;  4NR4 A;  4Q0N A;  5FE0 A;  5E3D A;  4MEP A;  5EWW A;  5ENB A;  4DON A;  5DFD A;  4XUA A;  5IGL A;  3U5N A;  5AD2 A;  5AD3 A;  4NUC A;  4XY8 A;  4ALH A;  5EIS A;  3AAD A;  5HRW A;  4TT4 A;  4TU6 A;  5DYC A;  5BT3 A;  2YQD A;  3S92 A;  4J3I A;  3U5M A;  5ENC A;  5A5P A;  3P1D A;  4PS5 A;  3HME A;  5CP5 A;  2DKW A;  2L5E A;  5LVQ A;  3I3J A;  5EI4 A;  4UYD A;  5CUD A;  5L8T A;  3RCW A;  3VKH A;  5CY9 A;  5KU3 A;  4HXM A;  4AKG A;  4O76 A;  3MXF A;  5E9V A;  5EA1 A;  3K2J A;  5E9L A;  2I8N A;  4A9L A;  5I86 A;  5ENG A;  5F3A A;  5EK9 A;  4YAX A;  5H1V A;  4NR9 A;  3UW9 A;  3Q2E A;  5KTU A;  2F6N A;  5E73 A;  5K29 A;  4LYS A;  3UVW A;  2DVV A;  5EWH A;  4QBM A;  4ZC9 A;  4KCX A;  4UYF A;  5HEL A;  5A5O A;  1ZKR A;  4YYK A;  4QEW A;  4HBW A;  3LJW A;  4HBX A;  2DAT A;  3FKM X;  4NR6 A;  5D3S A;  4A9H A;  3UVY A;  4QC1 A;  2R10 A;  3MUK A;  4J1P A;  4O7C A;  5HQ5 A;  3UVX A;  4YYM A;  4MR4 A;  3TLP A;  4LDF A;  2YDW A;  3UV4 A;  4O78 A;  5L98 A;  1X0J A;  5A5S A;  3MB3 A;  3QZT A;  5FE4 A;  5C8G A;  5FE9 A;  5L96 A;  4FLP A;  5CUE A;  4O7E A;  3ZYU A;  4HXL A;  4A9N A;  5BT5 A;  4J0S A;  4TZ2 A;  2MJV B;  4LRG A;  5HEM A;  5ENH A;  5HFQ A;  5CU8 A;  4QEU A;  4Z1Q A;  5KHM A;  5C87 A;  5CQA A;  4X2I A;  5EU1 A;  2D9E A;  1JM4 B;  5A82 A;  3VKG A;  5A83 A;  4BW2 A;  4CUT A;  4RVR A;  4NXJ A;  5CUC A;  4A9I A;  4HXS A;  4LZ2 A;  5BT4 A;  5DYA A;  4NR5 A;  5FFY A;  4A9K A;  2NXB A;  3ERR A;  5CUB A;  5LUU A;  5ENI A;  4YYI A;  5D3H A;  5ENF A;  4AKN A;  2FSA A;  4LYI A;  4HXP A;  5DLZ A;  5CQ7 A;  4CL9 A;  4YBS A;  4TT2 A;  5LVR A;  5D3T A;  4PKL A;  4BW3 A;  5CZG A;  3U5P A;  4GPJ A;  3D7C A;  4O70 A;  5I1Q A;  5F62 A;  5FBX A;  5IBN A;  2DVQ A;  4UIZ A;  4WIV A;  5CQ6 A;  4YYN A;  5L99 A;  5LKZ A;  1WUM A;  5I7Y A;  4QEV A;  4QUT A;  5FE8 A;  3QZV A;  4MEN A;  3LXJ A;  5FG4 A;  4QR3 A;  4QR5 A;  3Q2F A;  2RS9 B;  2OO1 A;  5ETB A;  5F2P A;  4NYV A;  2LSP B;  4UIY A;  5CUA A;  4CUS A;  5IGN A;  5FH8 A;  4LC2 A;  4NQM A;  5D0C A;  5I40 A;  2E7N A;  5C85 A;  5A7C A;  5DKD A;  5HRV A;  5CPE A;  5DFC A;  5F25 A;  5F61 A;  5D3L A;  2OUO A;  2E7O A;  5E9Y A;  5FDZ A;  5FE7 A;  4QY4 A;  4UIT A;  5KO4 A;  4YBT A;  4TZ8 A;  4QYL A;  5C7N A;  4A9E A;  3DWY A;  4YH3 A;  2WP2 A;  4QSW A;  2YEM A;  4QSX A;  1WUG A;  4HXK A;  4OGJ A;  2DVS A;  3DAI A;  3JVJ A;  4NR8 A;  5DKC A;  5A81 A;  4CLB A;  5LKX A;  3LQI A;  5EWD A;  5EV9 A;  5F60 A;  5CFW A;  3SVH A;  4WHU A;  2R0Y A;  4CFL A;  5LKT A;  5HLS A;  2H60 A;  3UV5 A;  5H1U A;  5EPR A;  4TU4 A;  4HXO A;  4O72 A;  2L85 A;  4QB3 A;  4TS8 A;  1JSP B;  5FE6 A;  3MQM A;  5FB1 A;  4CUR A;  5CQ3 A;  5DW1 A;  4NRB A;  4Z1S A;  5FH6 A;  3QZS A;  4NQN A;  4QYD A;  4MEO A;  1F68 A;  5A85 A;  1N72 A;  4YYH A;  5I83 A;  2GRC A;  5EM3 A;  4A9M A;  5KTW A;  5EVA A;  5G4R A;  5LJ2 A;  4YAT A;  4NYX A;  4PCI A;  4QR4 A;  4BW4 A;  4TT6 A;  4NRA A;  4QUU A;  3O35 A;  5AME A;  2YW5 A;  5A5Q A;  2DWW A;  2EJN A;  5EIC A;  4NYW A;  4BW1 A;  2OSS A;  5I88 A;  3D1D A;  3SVF A;  3HMH A;  5E9K A;  4PCE A;  2I7K A;  5DKH A;  5DYU A;  4AI6 A;  4YY6 A;  5TB6 A;  4YAD A;  4QSV A;  5DBM A;  4ZW1 A;  2N9G A;  4O7A A;  5DY7 A;  5G4S A;  2R0V A;  1PUO A;  4Q0O A;  5HEN A;  4BJX A;  3SVG A;  2D82 A;  2L84 A;  4XUB A;  4A9F A;  4PY6 A;  3D1B A;  4QSP A;  5LKU A;  4CUQ A;  4Y03 A;  5FE5 A;  5F1L A;  4IR4 A;  4NRC A;  4UYG A;  3NXB A;  3O36 A;  4UYE A; 
#chains in the Genus database with same CATH homology
 2RO1 A;  5D3J A;  5F5Z A;  5FE3 A;  5CQT A;  4O77 A;  4XYA A;  4OGI A;  5I80 A;  5A5R A;  4YAB A;  3G0L A;  4Z93 A;  5EGU A;  4TQN A;  5J0D A;  5FE2 A;  3U5J A;  4QST A;  2DVR A;  2KTB B;  4NR7 A;  4O7B A;  1ZS5 A;  4OUF A;  3P1C A;  2E3K A;  3LQH A;  4Z6H A;  5H85 A;  4UIU A;  3S91 A;  4UIX A;  2RFJ A;  4Z6I A;  4HXR A;  4TTE A;  5HQ7 A;  1EQF A;  3O34 A;  4IOO A;  5FH7 A;  4YYG A;  4IR3 A;  4IOQ A;  5I7X A;  5EPS A;  4MEQ A;  5DW2 A;  4CUP A;  3P1F A;  4BHW A;  4YH4 A;  5CTL A;  4O75 A;  4YYJ A;  5H1T A;  4MR6 A;  4UYH A;  5D25 A;  5HRX A;  5IID A;  4QSR A;  3MUL A;  4A9O A;  4TYL A;  5ACY A;  5IGK A;  3IU5 A;  3UVD A;  5JWM A;  5L97 A;  4MR3 A;  4LZS A;  4QNS A;  5F36 A;  3O33 A;  2YEL A;  5CUG A;  4LYW A;  4YBM A;  2WP1 A;  2YEK A;  5CGP A;  4CUU A;  2RNY A;  5HFR A;  3ONI A;  3U5K A;  4N4F A;  4IR5 A;  4WHW A;  4NS5 A;  1E6I A;  5FB0 A;  4QSQ A;  2YYN A;  5D3N A;  4O71 A;  4UIW A;  4HBY A;  4HBV A;  5EQ1 A;  5FG6 A;  4N4I A;  4O74 A;  3G0J A;  5I89 A;  3U5O A;  3UV2 A;  4MR5 A;  4HXN A;  4E96 A;  4N3W A;  3P5O A;  4IOR A;  2G4A A;  3JVK A;  4YYD A;  5EPB A;  3JVL A;  4KV1 A;  2RNW A;  5CRZ A;  5E74 A;  5DX4 A;  5FFW A;  4XY9 A;  2R0S A;  4ZQL A;  5FE1 A;  5E9M A;  4PTB A;  5HCL A;  3JVM A;  5ETD A;  5HJC A;  2F6J A;  5COI A;  5E3G A;  5EWV A;  4YY4 A;  5D26 A;  4F3I A;  5AMF A;  4A9J A;  5ENJ A;  4ALG A;  5II2 A;  4UYF B;  5HM0 A;  5L8U A;  5A5N A;  5KTX A;  4J0R A;  4N4H A;  3MB4 A;  3AQA A;  5DLX A;  5LJ0 A;  3O37 A;  4C67 A;  4YK0 A;  5D3P A;  5EWC A;  4QC3 A;  4O7F A;  4QZS A;  5IGM A;  5E0R A;  3U5L A;  4LZR A;  5I29 A;  5D7X A;  3IU6 A;  5F63 A;  3P1E A;  4CFK A;  4YC9 A;  5CS8 A;  5E9I A;  5D24 A;  5CRM A;  5E7D A;  2RI7 A;  3LQJ A;  5DYX A;  5HQ6 A;  5JI8 A;  4NUE A;  5DFB A;  5LJ1 A;  5F1H A;  5D3R A;  5FFV A;  5CQ5 A;  4QSU A;  5C4Q A;  3HMF A;  4KV4 A;  2RNX A;  5IG6 A;  5II1 A;  5ENE A;  4UIV A;  4IR6 A;  3GG3 A;  5EP7 A;  5CQ8 A;  4NUD A;  5TCM A;  4C66 A;  5CQ4 A;  5FG5 A;  5C89 A;  4LR6 A;  4N4G A;  4QSS A;  4NR4 A;  4Q0N A;  5FE0 A;  5E3D A;  4MEP A;  5EWW A;  5ENB A;  4DON A;  5DFD A;  4XUA A;  5IGL A;  3U5N A;  5AD2 A;  5AD3 A;  4NUC A;  4XY8 A;  4ALH A;  5EIS A;  3AAD A;  5HRW A;  4TT4 A;  4TU6 A;  5DYC A;  5BT3 A;  2YQD A;  3S92 A;  4J3I A;  3U5M A;  5ENC A;  5A5P A;  3P1D A;  4PS5 A;  3HME A;  5CP5 A;  2DKW A;  2L5E A;  5LVQ A;  3I3J A;  5EI4 A;  4UYD A;  5CUD A;  5L8T A;  3RCW A;  5CY9 A;  5KU3 A;  4HXM A;  4O76 A;  3MXF A;  5E9V A;  5EA1 A;  3K2J A;  5E9L A;  2I8N A;  4A9L A;  5I86 A;  5ENG A;  5F3A A;  5EK9 A;  4YAX A;  5H1V A;  4NR9 A;  3UW9 A;  3Q2E A;  5KTU A;  2F6N A;  5E73 A;  5K29 A;  4LYS A;  3UVW A;  2DVV A;  5EWH A;  4QBM A;  4ZC9 A;  4KCX A;  4UYF A;  5HEL A;  5A5O A;  4YYK A;  4QEW A;  4HBW A;  3LJW A;  4HBX A;  2DAT A;  3FKM X;  4NR6 A;  5D3S A;  4A9H A;  3UVY A;  4QC1 A;  2R10 A;  3MUK A;  4J1P A;  4O7C A;  5HQ5 A;  3UVX A;  4YYM A;  4MR4 A;  3TLP A;  4LDF A;  2YDW A;  3UV4 A;  4O78 A;  5L98 A;  1X0J A;  5A5S A;  3MB3 A;  3QZT A;  5FE4 A;  5C8G A;  5FE9 A;  5L96 A;  4FLP A;  5CUE A;  4O7E A;  3ZYU A;  4HXL A;  4A9N A;  5BT5 A;  4J0S A;  4TZ2 A;  2MJV B;  4LRG A;  5HEM A;  5ENH A;  5HFQ A;  5CU8 A;  4QEU A;  4Z1Q A;  5KHM A;  5C87 A;  5CQA A;  4X2I A;  5EU1 A;  2D9E A;  1JM4 B;  5A82 A;  5A83 A;  4BW2 A;  4CUT A;  4RVR A;  4NXJ A;  5CUC A;  4A9I A;  4HXS A;  4LZ2 A;  5BT4 A;  5DYA A;  4NR5 A;  5FFY A;  4A9K A;  2NXB A;  5CUB A;  5LUU A;  5ENI A;  4YYI A;  5D3H A;  5ENF A;  4AKN A;  2FSA A;  4LYI A;  4HXP A;  5DLZ A;  5CQ7 A;  4CL9 A;  4YBS A;  4TT2 A;  5LVR A;  5D3T A;  4PKL A;  4BW3 A;  5CZG A;  3U5P A;  4GPJ A;  3D7C A;  4O70 A;  5I1Q A;  5F62 A;  5FBX A;  5IBN A;  2DVQ A;  4UIZ A;  4WIV A;  5CQ6 A;  4YYN A;  5L99 A;  5LKZ A;  1WUM A;  5I7Y A;  4QEV A;  4QUT A;  5FE8 A;  3QZV A;  4MEN A;  3LXJ A;  5FG4 A;  4QR3 A;  4QR5 A;  3Q2F A;  2RS9 B;  2OO1 A;  5ETB A;  5F2P A;  4NYV A;  2LSP B;  4UIY A;  5CUA A;  4CUS A;  5IGN A;  5FH8 A;  4LC2 A;  4NQM A;  5D0C A;  5I40 A;  2E7N A;  5C85 A;  5A7C A;  5DKD A;  5HRV A;  5CPE A;  5DFC A;  5F25 A;  5F61 A;  5D3L A;  2OUO A;  2E7O A;  5E9Y A;  5FDZ A;  5FE7 A;  4QY4 A;  4UIT A;  5KO4 A;  4YBT A;  4TZ8 A;  4QYL A;  5C7N A;  4A9E A;  3DWY A;  4YH3 A;  2WP2 A;  4QSW A;  2YEM A;  4QSX A;  1WUG A;  4HXK A;  4OGJ A;  2DVS A;  3DAI A;  3JVJ A;  4NR8 A;  5DKC A;  5A81 A;  4CLB A;  5LKX A;  3LQI A;  5EWD A;  5EV9 A;  5F60 A;  5CFW A;  3SVH A;  4WHU A;  2R0Y A;  4CFL A;  5LKT A;  5HLS A;  2H60 A;  3UV5 A;  5H1U A;  5EPR A;  4TU4 A;  4HXO A;  4O72 A;  2L85 A;  4QB3 A;  4TS8 A;  1JSP B;  5FE6 A;  3MQM A;  5FB1 A;  4CUR A;  5CQ3 A;  5DW1 A;  4NRB A;  4Z1S A;  5FH6 A;  3QZS A;  4NQN A;  4QYD A;  4MEO A;  1F68 A;  5A85 A;  1N72 A;  4YYH A;  5I83 A;  2GRC A;  5EM3 A;  4A9M A;  5KTW A;  5EVA A;  5G4R A;  5LJ2 A;  4YAT A;  4NYX A;  4PCI A;  4QR4 A;  4BW4 A;  4TT6 A;  4NRA A;  4QUU A;  3O35 A;  5AME A;  2YW5 A;  5A5Q A;  2DWW A;  5EIC A;  4NYW A;  4BW1 A;  2OSS A;  5I88 A;  3SVF A;  3HMH A;  5E9K A;  4PCE A;  2I7K A;  5DKH A;  5DYU A;  4YY6 A;  5TB6 A;  4YAD A;  4QSV A;  5DBM A;  4ZW1 A;  2N9G A;  4O7A A;  5DY7 A;  5G4S A;  2R0V A;  4Q0O A;  5HEN A;  4BJX A;  3SVG A;  2D82 A;  2L84 A;  4XUB A;  4A9F A;  4PY6 A;  4QSP A;  5LKU A;  4CUQ A;  4Y03 A;  5FE5 A;  5F1L A;  4IR4 A;  4NRC A;  4UYG A;  3NXB A;  3O36 A;  4UYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...