3D1BA

Tetragonal crystal structure of tas3 c-terminal alpha motif
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
111
Chain Sequence
DKNDLYINWLKSLSFFQTNSSCAEALVKVIPHYHNKLIDFSQVLQLVFSASEKFPIQENQPLPEQLMFLSNLEKQTPFAKAVGSSIYKLVTGKNLSLDFASQILKEASILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords RNA-induced transcriptional silencing complex protein tas3
publication title An alpha motif at Tas3 C terminus mediates RITS cis spreading and promotes heterochromatic gene silencing.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 44
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.40 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 3d1bA00
3D1DA 3D1BA
chains in the Genus database with same CATH superfamily
2MJVB 5FE2A 3RCWA 5LKTA 2G4AA 2OUOA 5HCLA 2LSPB 3JVJA 5D3NA 4A9FA 4TT6A 5LKZA 4MR5A 4C67A 4LYIA 4PCIA 4CUQA 5F60A 4NR6A 5FG4A 2DVVA 5AD2A 4YYIA 4IR4A 5II2A 5IG6A 5EPRA 5D7XA 4CFLA 5D3RA 4YYNA 5FE1A 5HQ5A 4O74A 4PTBA 4UITA 4QC1A 5HENA 5HFQA 5LKXA 5CUBA 4NR8A 4TU4A 5DYUA 3JVLA 5EP7A 4J0SA 4CL9A 5I7YA 4UIZA 4QSRA 5I40A 4KV4A 4O7EA 3LQIA 4J3IA 4NRCA 4ZC9A 5I88A 4HBWA 5A5SA 2DVSA 4QEUA 2EJNA 5DFDA 3ERRA 4NS5A 3AQAA 5CUDA 4QY4A 5D25A 5CQAA 4Z6HA 5I29A 3U5OA 5ACYA 4QNSA 5FE0A 2RO1A 1F68A 4LZ2A 5FE5A 2YQDA 5CQTA 5A5QA 5J0DA 5F1HA 5A85A 1ZKRA 5DKHA 5DYCA 5E7DA 4QUUA 5KO4A 2DVRA 4A9JA 4QR5A 5BT4A 4MR3A 5L99A 5ENIA 4QSVA 4A9IA 5I1QA 3MULA 3QZSA 4MEOA 4CUTA 2RI7A 5IGLA 3QZTA 4CUUA 2DATA 2YEKA 4UYGA 4PCEA 5F5ZA 5ENFA 5L98A 5HQ7A 2H60A 4UYHA 5EISA 3U5LA 3UV4A 5AMFA 5KTUA 4WHWA 4O77A 4HXPA 2R0VA 4O7AA 4LC2A 5C89A 3UVDA 4LR6A 5H1VA 2RFJA 5KTXA 5LKUA 3G0LA 5I83A 4PKLA 5G4RA 5A5NA 2FSAA 1WUMA 5ENCA 5I89A 5TCMA 5EPSA 5FDZA 5CQ4A 5H1TA 3P5OA 4UYEA 3LQJA 4NUCA 4A9OA 5CGPA 2N9GA 4QZSA 4HBXA 5CTLA 5A83A 5CRMA 4YADA 5FBXA 2E7OA 5D3PA 5HRXA 5E73A 2D9EA 4QEVA 5ENJA 3U5JA 4IOQA 5ETBA 5COIA 5FB1A 5L96A 5EV9A 2WP1A 4NUDA 2I8NA 4AKNA 5D0CA 3IU5A 4MEQA 5EWWA 5DFBA 2I7KA 5DLZA 4NQNA 5A5PA 5CS8A 4AKIA 5K29A 5FG5A 2YDWA 3SVHA 4QSWA 1EQFA 4CLBA 3NXBA 4RVRA 3UW9A 4BW2A 2OO1A 5A5RA 5EWHA 4MEPA 4O70A 4HBYA 5C85A 3U5PA 2YELA 4QR4A 4FLPA 4NR7A 4QSTA 3U5KA 5LUUA 2DKWA 5FE3A 5LJ0A 5CUCA 4UIWA 4YYJA 5FG6A 4YBSA 5FH7A 5ENEA 5IBNA 5G4SA 5EWDA 4NR5A 2OSSA 4QB3A 3P1FA 5E9VA 4QSUA 4YY6A 5E9LA 5DW1A 4NQMA 4F3IA 5I86A 5D24A 5F62A 1JM4B 4KV1A 5E3GA 4CFKA 5DY7A 5IIDA 5F2PA 5CUEA 5CRZA 5F25A 4NYWA 4O7FA 4A9KA 4GPJA 5EVAA 5D26A 4MR6A 4XY8A 2F6NA 5JI8A 4NRAA 5CPEA 3U5NA 3O36A 3Q2FA 4A9LA 3D1BA 3FKMX 4LDFA 4NUEA 5E9KA 5HELA 4UIVA 2DVQA 4XUAA 5LVRA 4BW3A 4Z1SA 5CFWA 3VKGA 4XYAA 5A82A 3UVXA 5L8TA 5HJCA 5EA1A 5L8UA 5I7XA 5CU8A 4YYDA 4MENA 4YBMA 5KHMA 4YYMA 4O71A 3UV5A 4A9MA 3QZVA 4WIVA 4X2IA 5CUAA 5EK9A 2L84A 3DAIA 5DKDA 4YYKA 3O35A 3DWYA 4LRGA 3IU6A 4C66A 3I3JA 4Y03A 3K2JA 4N3WA 4CUSA 2F6JA 3LXJA 5FFVA 3SVFA 4MR4A 5IGMA 5BT5A 5F63A 5DBMA 4O7BA 5DKCA 2RNXA 5HFRA 4UIXA 4NYVA 4IORA 2YEMA 2RNWA 5ENBA 4O75A 2DWWA 5CQ8A 5DLXA 5C87A 5TB6A 5IGKA 3O34A 4CUPA 5FH8A 4NR4A 3HMEA 4YABA 4AKGA 1PUOA 4UYDA 3UVYA 4E96A 5FFWA 2D82A 4BW4A 2YYNA 2R0SA 5EPBA 4IOOA 3D7CA 3P1CA 4HXOA 4HBVA 4N4IA 5FE9A 5EWCA 5C8GA 5F1LA 4TT2A 3LJWA 4HXLA 5H1UA 1N72A 5FE6A 3D1DA 4KCXA 5EWVA 2YW5A 5H85A 4YK0A 4LYWA 4WHUA 3G0JA 3SVGA 5E9IA 5F3AA 5C7NA 5CZGA 4J0RA 5ETDA 3O33A 5EM3A 4Q0OA 5EICA 5A5OA 4UYFA 4IR3A 5FH6A 5D3SA 3UVWA 4A9HA 5LVQA 4YAXA 4BHWA 5AD3A 4NYXA 5DYXA 5FE4A 4N4HA 4NR9A 5CQ7A 4ALHA 3MXFA 3HMHA 4IR6A 5CY9A 4QC3A 3JVKA 3U5MA 3P1DA 3ONIA 5EQ1A 4N4FA 2R0YA 3VKHA 5FE8A 4QYLA 4QSXA 4YH3A 5BT3A 4QSPA 5AMEA 2GRCA 5IGNA 4YYGA 4TZ8A 4UIYA 2KTBB 5CQ6A 2RNYA 4YY4A 5EI4A 4LZSA 3O37A 5F36A 1WUGA 4QSQA 4XUBA 3ZYUA 4A9EA 2L85A 1ZS5A 2WP2A 5E3DA 4QSSA 4IR5A 2RS9B 2E3KA 4YH4A 5F61A 5I80A 4NRBA 5E9YA 5FFYA 5HQ6A 5C4QA 4OGIA 3S92A 5FB0A 4Z93A 5EU1A 3AADA 4TZ2A 4YC9A 5CP5A 3P1EA 4QBMA 5E74A 2E7NA 4AI6A 4AKHA 2NXBA 4O7CA 4ZQLA 4Q0NA 4TU6A 4TQNA 5CQ3A 4O78A 1E6IA 5KU3A 3HMFA 4UIUA 3UV2A 4HXRA 3TLPA 5ENGA 5CQ5A 4QEWA 5D3HA 4CURA 4TT4A 3Q2EA 4HXMA 5HM0A 4OGJA 1X0JA 5D3JA 4BJXA 5LJ2A 3JVMA 5FE7A 4UYFB 2L5EA 5DW2A 4PY6A 5HEMA 5DX4A 4YYHA 4QR3A 4TYLA 4N4GA 4HXNA 3GG3A 4TS8A 5KTWA 4HXKA 5II1A 5LJ1A 3MB3A 5E9MA 4O72A 4LYSA 4LZRA 4OUFA 4BW1A 5D3TA 4DONA 5DFCA 4YBTA 5DYAA 3MUKA 4O76A 4Z1QA 4J1PA 4ZW1A 4YATA 5L97A 5JWMA 5EGUA 3LQHA 5HRVA 5HLSA 1JSPB 4HXSA 4NXJA 5CUGA 3MQMA 5D3LA 5HRWA 4QUTA 5A7CA 4Z6IA 5A81A 4XY9A 5E0RA 3S91A 4A9NA 4QYDA 3MB4A 4TTEA 4ALGA 5ENHA 2R10A 4PS5A
chains in the Genus database with same CATH topology
4AKHA 1PUOA 3ERRA 2EJNA 3VKGA 4AKIA 3VKHA 3D1BA 1ZKRA 3D1DA 4AKGA 4AI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1D A;  3D1B A; 
#chains in the Genus database with same CATH topology
 2MJV B;  5FE2 A;  3RCW A;  5LKT A;  2G4A A;  2OUO A;  5HCL A;  2LSP B;  3JVJ A;  5D3N A;  4A9F A;  4TT6 A;  5LKZ A;  4MR5 A;  4C67 A;  4LYI A;  4PCI A;  4CUQ A;  5F60 A;  4NR6 A;  5FG4 A;  2DVV A;  5AD2 A;  4YYI A;  4IR4 A;  5II2 A;  5IG6 A;  5EPR A;  5D7X A;  4CFL A;  5D3R A;  4YYN A;  5FE1 A;  5HQ5 A;  4O74 A;  4PTB A;  4UIT A;  4QC1 A;  5HEN A;  5HFQ A;  5LKX A;  5CUB A;  4NR8 A;  4TU4 A;  5DYU A;  3JVL A;  5EP7 A;  4J0S A;  4CL9 A;  5I7Y A;  4UIZ A;  4QSR A;  5I40 A;  4KV4 A;  4O7E A;  3LQI A;  4J3I A;  4NRC A;  4ZC9 A;  5I88 A;  4HBW A;  5A5S A;  2DVS A;  4QEU A;  2EJN A;  5DFD A;  3ERR A;  4NS5 A;  3AQA A;  5CUD A;  4QY4 A;  5D25 A;  5CQA A;  4Z6H A;  5I29 A;  3U5O A;  5ACY A;  4QNS A;  5FE0 A;  2RO1 A;  1F68 A;  4LZ2 A;  5FE5 A;  2YQD A;  5CQT A;  5A5Q A;  5J0D A;  5F1H A;  5A85 A;  1ZKR A;  5DKH A;  5DYC A;  5E7D A;  4QUU A;  5KO4 A;  2DVR A;  4A9J A;  4QR5 A;  5BT4 A;  4MR3 A;  5L99 A;  5ENI A;  4QSV A;  4A9I A;  5I1Q A;  3MUL A;  3QZS A;  4MEO A;  4CUT A;  2RI7 A;  5IGL A;  3QZT A;  4CUU A;  2DAT A;  2YEK A;  4UYG A;  4PCE A;  5F5Z A;  5ENF A;  5L98 A;  5HQ7 A;  2H60 A;  4UYH A;  5EIS A;  3U5L A;  3UV4 A;  5AMF A;  5KTU A;  4WHW A;  4O77 A;  4HXP A;  2R0V A;  4O7A A;  4LC2 A;  5C89 A;  3UVD A;  4LR6 A;  5H1V A;  2RFJ A;  5KTX A;  5LKU A;  3G0L A;  5I83 A;  4PKL A;  5G4R A;  5A5N A;  2FSA A;  1WUM A;  5ENC A;  5I89 A;  5TCM A;  5EPS A;  5FDZ A;  5CQ4 A;  5H1T A;  3P5O A;  4UYE A;  3LQJ A;  4NUC A;  4A9O A;  5CGP A;  2N9G A;  4QZS A;  4HBX A;  5CTL A;  5A83 A;  5CRM A;  4YAD A;  5FBX A;  2E7O A;  5D3P A;  5HRX A;  5E73 A;  2D9E A;  4QEV A;  5ENJ A;  3U5J A;  4IOQ A;  5ETB A;  5COI A;  5FB1 A;  5L96 A;  5EV9 A;  2WP1 A;  4NUD A;  2I8N A;  4AKN A;  5D0C A;  3IU5 A;  4MEQ A;  5EWW A;  5DFB A;  2I7K A;  5DLZ A;  4NQN A;  5A5P A;  5CS8 A;  4AKI A;  5K29 A;  5FG5 A;  2YDW A;  3SVH A;  4QSW A;  1EQF A;  4CLB A;  3NXB A;  4RVR A;  3UW9 A;  4BW2 A;  2OO1 A;  5A5R A;  5EWH A;  4MEP A;  4O70 A;  4HBY A;  5C85 A;  3U5P A;  2YEL A;  4QR4 A;  4FLP A;  4NR7 A;  4QST A;  3U5K A;  5LUU A;  2DKW A;  5FE3 A;  5LJ0 A;  5CUC A;  4UIW A;  4YYJ A;  5FG6 A;  4YBS A;  5FH7 A;  5ENE A;  5IBN A;  5G4S A;  5EWD A;  4NR5 A;  2OSS A;  4QB3 A;  3P1F A;  5E9V A;  4QSU A;  4YY6 A;  5E9L A;  5DW1 A;  4NQM A;  4F3I A;  5I86 A;  5D24 A;  5F62 A;  1JM4 B;  4KV1 A;  5E3G A;  4CFK A;  5DY7 A;  5IID A;  5F2P A;  5CUE A;  5CRZ A;  5F25 A;  4NYW A;  4O7F A;  4A9K A;  4GPJ A;  5EVA A;  5D26 A;  4MR6 A;  4XY8 A;  2F6N A;  5JI8 A;  4NRA A;  5CPE A;  3U5N A;  3O36 A;  3Q2F A;  4A9L A;  3D1B A;  3FKM X;  4LDF A;  4NUE A;  5E9K A;  5HEL A;  4UIV A;  2DVQ A;  4XUA A;  5LVR A;  4BW3 A;  4Z1S A;  5CFW A;  3VKG A;  4XYA A;  5A82 A;  3UVX A;  5L8T A;  5HJC A;  5EA1 A;  5L8U A;  5I7X A;  5CU8 A;  4YYD A;  4MEN A;  4YBM A;  5KHM A;  4YYM A;  4O71 A;  3UV5 A;  4A9M A;  3QZV A;  4WIV A;  4X2I A;  5CUA A;  5EK9 A;  2L84 A;  3DAI A;  5DKD A;  4YYK A;  3O35 A;  3DWY A;  4LRG A;  3IU6 A;  4C66 A;  3I3J A;  4Y03 A;  3K2J A;  4N3W A;  4CUS A;  2F6J A;  3LXJ A;  5FFV A;  3SVF A;  4MR4 A;  5IGM A;  5BT5 A;  5F63 A;  5DBM A;  4O7B A;  5DKC A;  2RNX A;  5HFR A;  4UIX A;  4NYV A;  4IOR A;  2YEM A;  2RNW A;  5ENB A;  4O75 A;  2DWW A;  5CQ8 A;  5DLX A;  5C87 A;  5TB6 A;  5IGK A;  3O34 A;  4CUP A;  5FH8 A;  4NR4 A;  3HME A;  4YAB A;  4AKG A;  1PUO A;  4UYD A;  3UVY A;  4E96 A;  5FFW A;  2D82 A;  4BW4 A;  2YYN A;  2R0S A;  5EPB A;  4IOO A;  3D7C A;  3P1C A;  4HXO A;  4HBV A;  4N4I A;  5FE9 A;  5EWC A;  5C8G A;  5F1L A;  4TT2 A;  3LJW A;  4HXL A;  5H1U A;  1N72 A;  5FE6 A;  3D1D A;  4KCX A;  5EWV A;  2YW5 A;  5H85 A;  4YK0 A;  4LYW A;  4WHU A;  3G0J A;  3SVG A;  5E9I A;  5F3A A;  5C7N A;  5CZG A;  4J0R A;  5ETD A;  3O33 A;  5EM3 A;  4Q0O A;  5EIC A;  5A5O A;  4UYF A;  4IR3 A;  5FH6 A;  5D3S A;  3UVW A;  4A9H A;  5LVQ A;  4YAX A;  4BHW A;  5AD3 A;  4NYX A;  5DYX A;  5FE4 A;  4N4H A;  4NR9 A;  5CQ7 A;  4ALH A;  3MXF A;  3HMH A;  4IR6 A;  5CY9 A;  4QC3 A;  3JVK A;  3U5M A;  3P1D A;  3ONI A;  5EQ1 A;  4N4F A;  2R0Y A;  3VKH A;  5FE8 A;  4QYL A;  4QSX A;  4YH3 A;  5BT3 A;  4QSP A;  5AME A;  2GRC A;  5IGN A;  4YYG A;  4TZ8 A;  4UIY A;  2KTB B;  5CQ6 A;  2RNY A;  4YY4 A;  5EI4 A;  4LZS A;  3O37 A;  5F36 A;  1WUG A;  4QSQ A;  4XUB A;  3ZYU A;  4A9E A;  2L85 A;  1ZS5 A;  2WP2 A;  5E3D A;  4QSS A;  4IR5 A;  2RS9 B;  2E3K A;  4YH4 A;  5F61 A;  5I80 A;  4NRB A;  5E9Y A;  5FFY A;  5HQ6 A;  5C4Q A;  4OGI A;  3S92 A;  5FB0 A;  4Z93 A;  5EU1 A;  3AAD A;  4TZ2 A;  4YC9 A;  5CP5 A;  3P1E A;  4QBM A;  5E74 A;  2E7N A;  4AI6 A;  4AKH A;  2NXB A;  4O7C A;  4ZQL A;  4Q0N A;  4TU6 A;  4TQN A;  5CQ3 A;  4O78 A;  1E6I A;  5KU3 A;  3HMF A;  4UIU A;  3UV2 A;  4HXR A;  3TLP A;  5ENG A;  5CQ5 A;  4QEW A;  5D3H A;  4CUR A;  4TT4 A;  3Q2E A;  4HXM A;  5HM0 A;  4OGJ A;  1X0J A;  5D3J A;  4BJX A;  5LJ2 A;  3JVM A;  5FE7 A;  4UYF B;  2L5E A;  5DW2 A;  4PY6 A;  5HEM A;  5DX4 A;  4YYH A;  4QR3 A;  4TYL A;  4N4G A;  4HXN A;  3GG3 A;  4TS8 A;  5KTW A;  4HXK A;  5II1 A;  5LJ1 A;  3MB3 A;  5E9M A;  4O72 A;  4LYS A;  4LZR A;  4OUF A;  4BW1 A;  5D3T A;  4DON A;  5DFC A;  4YBT A;  5DYA A;  3MUK A;  4O76 A;  4Z1Q A;  4J1P A;  4ZW1 A;  4YAT A;  5L97 A;  5JWM A;  5EGU A;  3LQH A;  5HRV A;  5HLS A;  1JSP B;  4HXS A;  4NXJ A;  5CUG A;  3MQM A;  5D3L A;  5HRW A;  4QUT A;  5A7C A;  4Z6I A;  5A81 A;  4XY9 A;  5E0R A;  3S91 A;  4A9N A;  4QYD A;  3MB4 A;  4TTE A;  4ALG A;  5ENH A;  2R10 A;  4PS5 A; 
#chains in the Genus database with same CATH homology
 4AKH A;  1PUO A;  3ERR A;  2EJN A;  3VKG A;  4AKI A;  3VKH A;  3D1B A;  1ZKR A;  3D1D A;  4AKG A;  4AI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...