3D1BA

Tetragonal crystal structure of tas3 c-terminal alpha motif
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
111
structure length
111
Chain Sequence
DKNDLYINWLKSLSFFQTNSSCAEALVKVIPHYHNKLIDFSQVLQLVFSASEKFPIQENQPLPEQLMFLSNLEKQTPFAKAVGSSIYKLVTGKNLSLDFASQILKEASILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-induced transcriptional silencing complex protein tas3
publication title An alpha motif at Tas3 C terminus mediates RITS cis spreading and promotes heterochromatic gene silencing.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Nuclear protein
total genus 44
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.40 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 3d1bA00
3D1BA 3D1DA
chains in the Genus database with same CATH superfamily
3UV5A 5AMEA 5L97A 4UYDA 1EQFA 4QNSA 4CURA 5A5OA 5IGLA 3HMHA 5I89A 5C4QA 2YDWA 4CFLA 2RNWA 5HRVA 5F2PA 4N4HA 2DWWA 5F62A 4LDFA 5D3LA 3P5OA 5TB6A 4QEUA 4MEPA 5EGUA 1ZKRA 4RVRA 5CY9A 4KV4A 5CQ4A 4NR5A 3LQHA 5II2A 5C87A 2YELA 3UV4A 5HQ5A 5CP5A 4MR6A 5DW1A 2RFJA 4TU6A 5L96A 4CUSA 5D26A 5D3RA 2GRCA 2RNYA 5I80A 3U5NA 3P1FA 5CUCA 4A9NA 4PKLA 4TT2A 5A5RA 5A81A 4HBVA 3UV2A 3LXJA 4IR5A 4O7AA 4CUPA 5FE2A 4QSUA 4XY8A 5II1A 4O74A 3Q2EA 5HM0A 4QYDA 4BW4A 4MR5A 4NRCA 4CUTA 5CRMA 4OGIA 2L5EA 3U5LA 2MJVB 3U5KA 4A9LA 4CUQA 4ZQLA 4C66A 5I1QA 5CUEA 4Z6IA 2I7KA 2YEKA 5F61A 5CUBA 5E73A 4CFKA 5EQ1A 5L98A 4BW1A 5ENBA 3UW9A 4NR6A 4LRGA 4UYFA 5FH8A 5CFWA 5LVRA 2E7NA 3SVGA 1F68A 4LZSA 4QUTA 4NR4A 4TQNA 4O70A 5EK9A 5LJ1A 5IBNA 2N9GA 5D24A 5F25A 5D3NA 3U5MA 4TZ8A 4NXJA 5EPSA 5EU1A 1E6IA 4QSPA 4HXRA 4YBMA 5E3DA 5D3JA 4LYIA 5COIA 2OUOA 3G0JA 4KV1A 5AD3A 4LZRA 5D3HA 5LKTA 4TZ2A 5D25A 2G4AA 5CUGA 4A9MA 5AMFA 4AI6A 4YK0A 1JM4B 4FLPA 4A9IA 5D3TA 4QSVA 5I40A 4O77A 4QUUA 3QZVA 4KCXA 2NXBA 3S92A 5HEMA 4ZC9A 5E9YA 5EP7A 1WUGA 5LKZA 3ZYUA 2OSSA 5EI4A 5A7CA 2RS9B 5EVAA 3DAIA 4YYJA 4LYSA 4WIVA 5G4RA 4CUUA 4DONA 5EWVA 4UITA 5I86A 5F60A 4ZW1A 3U5OA 2WP1A 1ZS5A 4YYDA 5DY7A 5CZGA 1PUOA 5HELA 4J0RA 2D82A 5DYAA 4GPJA 5FE9A 5I88A 3UVWA 3G0LA 4HXOA 4HXSA 5D3SA 4NYWA 5FDZA 4O7CA 5E3GA 5KO4A 4QSRA 3JVKA 4NS5A 4UYGA 3LJWA 3QZSA 5FE0A 4O75A 5LUUA 5K29A 4XUBA 4NQNA 4QSTA 5L99A 4TS8A 5H1VA 2YYNA 5FE7A 5FH6A 5JI8A 4QC1A 2DKWA 5DKHA 5JWMA 2L85A 4Y03A 3NXBA 4YYNA 4MR3A 5DYXA 3HMFA 5HLSA 4TT6A 4LC2A 5ETDA 4BHWA 5CGPA 4YC9A 2R0YA 5CRZA 5I83A 5EICA 5LKXA 5F5ZA 5EWHA 5EM3A 5KTXA 5CQ3A 4AKHA 4MEQA 2R0VA 4UIUA 3VKGA 4PY6A 5ETBA 5DYUA 5A5NA 4WHWA 4QR5A 2DVSA 4ALHA 3AQAA 4Z1QA 5D0CA 5HRWA 4YABA 3DWYA 4XUAA 4NUEA 5FE1A 5J0DA 4AKGA 4A9OA 5F1LA 3MUKA 5ENCA 5CU8A 3O33A 5A5PA 4NR9A 3AADA 4O71A 4UYEA 5ENJA 4LR6A 4MEOA 5ENEA 4Z6HA 2LSPB 3UVXA 5FE4A 5CQAA 3MULA 2L84A 4IR3A 4HXKA 4QY4A 3I3JA 4N4FA 5FE8A 3LQIA 4HXMA 3ERRA 3S91A 3O37A 4NQMA 5HQ7A 4C67A 5H85A 5F1HA 4QR4A 2F6JA 4HBXA 4PCEA 4O78A 5HFQA 4IR4A 4YATA 2RNXA 5CS8A 5FE3A 4QBMA 5FFYA 3RCWA 4UIXA 5DYCA 4OGJA 5E9IA 4YBSA 5LKUA 5F36A 5FBXA 2R0SA 3P1EA 4WHUA 4TU4A 5DBMA 5DW2A 3D1DA 5A5SA 4NRAA 4HBYA 4UIWA 5FFVA 4Q0OA 3MQMA 3GG3A 4UIYA 4QSWA 5CQ7A 5C8GA 4PTBA 1N72A 4X2IA 5E9LA 5ENHA 2FSAA 4BW3A 4YH4A 3U5PA 5HFRA 3P1DA 5DFDA 5IG6A 2DVQA 3ONIA 4BJXA 2KTBB 4LZ2A 4YYGA 4NUDA 3O35A 5E7DA 3UVDA 5KHMA 4YYKA 5I7YA 5L8TA 4E96A 4QEVA 4NYXA 4NUCA 5EA1A 4BW2A 4Z93A 5I29A 3JVMA 4QB3A 5LJ2A 3SVHA 4IOQA 4HXNA 5FB0A 2EJNA 2I8NA 5E9VA 5F3AA 5EWCA 4O76A 5IIDA 3LQJA 4NR7A 5F63A 2YEMA 3QZTA 3MB4A 2E3KA 4YY6A 3K2JA 4UYHA 2DATA 5CQ6A 5CPEA 5HENA 3D7CA 4PS5A 5DKDA 5DFBA 4HXPA 4MENA 5FG4A 3MXFA 5D3PA 4N3WA 4UYFB 5HCLA 4PCIA 2WP2A 5DLZA 2RI7A 3HMEA 2YQDA 4UIVA 4N4IA 4QYLA 5A83A 4TTEA 5KTWA 5CUAA 5C85A 5TCMA 2H60A 3IU5A 5EWDA 3D1BA 4ALGA 5CQ5A 4YH3A 5FH7A 4QSSA 5I7XA 5FB1A 4O7FA 5FG5A 5L8UA 4J3IA 4QR3A 4OUFA 5ENGA 5FFWA 5E9MA 5H1UA 5C89A 5ENIA 5EISA 5EWWA 4Z1SA 5BT3A 4J0SA 5CUDA 5LJ0A 4A9JA 4O7BA 4A9HA 5FE5A 4AKNA 5DKCA 5FE6A 4O7EA 5EPRA 4TYLA 5KTUA 4MR4A 4NRBA 5BT5A 4A9KA 5FG6A 4YADA 4QC3A 5HJCA 4QSXA 5IGMA 4YAXA 5ACYA 4CL9A 4YYHA 4J1PA 4AKIA 2DVRA 2F6NA 3TLPA 2OO1A 3VKHA 4O72A 4LYWA 5A85A 5A82A 4N4GA 2D9EA 3JVJA 5DLXA 5ENFA 4IORA 4IOOA 4QZSA 2R10A 5DX4A 5KU3A 5E9KA 2YW5A 3IU6A 4CLBA 5E74A 4F3IA 4YYMA 1WUMA 5C7NA 1JSPB 5E0RA 4QSQA 3Q2FA 5CQTA 5CTLA 4A9FA 4YY4A 3JVLA 5CQ8A 5DFCA 3U5JA 5AD2A 5A5QA 2RO1A 5IGNA 1X0JA 3P1CA 4HXLA 5HRXA 2E7OA 4NYVA 3MB3A 2DVVA 5D7XA 5LVQA 4A9EA 4TT4A 4XY9A 3FKMX 3O34A 4UIZA 5IGKA 5EPBA 5EV9A 4XYAA 4HBWA 4QEWA 5G4SA 4YBTA 5H1TA 3UVYA 4Q0NA 3SVFA 3O36A 5BT4A 4YYIA 4NR8A 4IR6A 5HQ6A
chains in the Genus database with same CATH topology
3D1BA 3D1DA 4AKIA 4AI6A 3VKHA 4AKHA 2EJNA 4AKGA 1ZKRA 1PUOA 3VKGA 3ERRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1B A;  3D1D A; 
#chains in the Genus database with same CATH topology
 3UV5 A;  5AME A;  5L97 A;  4UYD A;  1EQF A;  4QNS A;  4CUR A;  5A5O A;  5IGL A;  3HMH A;  5I89 A;  5C4Q A;  2YDW A;  4CFL A;  2RNW A;  5HRV A;  5F2P A;  4N4H A;  2DWW A;  5F62 A;  4LDF A;  5D3L A;  3P5O A;  5TB6 A;  4QEU A;  4MEP A;  5EGU A;  1ZKR A;  4RVR A;  5CY9 A;  4KV4 A;  5CQ4 A;  4NR5 A;  3LQH A;  5II2 A;  5C87 A;  2YEL A;  3UV4 A;  5HQ5 A;  5CP5 A;  4MR6 A;  5DW1 A;  2RFJ A;  4TU6 A;  5L96 A;  4CUS A;  5D26 A;  5D3R A;  2GRC A;  2RNY A;  5I80 A;  3U5N A;  3P1F A;  5CUC A;  4A9N A;  4PKL A;  4TT2 A;  5A5R A;  5A81 A;  4HBV A;  3UV2 A;  3LXJ A;  4IR5 A;  4O7A A;  4CUP A;  5FE2 A;  4QSU A;  4XY8 A;  5II1 A;  4O74 A;  3Q2E A;  5HM0 A;  4QYD A;  4BW4 A;  4MR5 A;  4NRC A;  4CUT A;  5CRM A;  4OGI A;  2L5E A;  3U5L A;  2MJV B;  3U5K A;  4A9L A;  4CUQ A;  4ZQL A;  4C66 A;  5I1Q A;  5CUE A;  4Z6I A;  2I7K A;  2YEK A;  5F61 A;  5CUB A;  5E73 A;  4CFK A;  5EQ1 A;  5L98 A;  4BW1 A;  5ENB A;  3UW9 A;  4NR6 A;  4LRG A;  4UYF A;  5FH8 A;  5CFW A;  5LVR A;  2E7N A;  3SVG A;  1F68 A;  4LZS A;  4QUT A;  4NR4 A;  4TQN A;  4O70 A;  5EK9 A;  5LJ1 A;  5IBN A;  2N9G A;  5D24 A;  5F25 A;  5D3N A;  3U5M A;  4TZ8 A;  4NXJ A;  5EPS A;  5EU1 A;  1E6I A;  4QSP A;  4HXR A;  4YBM A;  5E3D A;  5D3J A;  4LYI A;  5COI A;  2OUO A;  3G0J A;  4KV1 A;  5AD3 A;  4LZR A;  5D3H A;  5LKT A;  4TZ2 A;  5D25 A;  2G4A A;  5CUG A;  4A9M A;  5AMF A;  4AI6 A;  4YK0 A;  1JM4 B;  4FLP A;  4A9I A;  5D3T A;  4QSV A;  5I40 A;  4O77 A;  4QUU A;  3QZV A;  4KCX A;  2NXB A;  3S92 A;  5HEM A;  4ZC9 A;  5E9Y A;  5EP7 A;  1WUG A;  5LKZ A;  3ZYU A;  2OSS A;  5EI4 A;  5A7C A;  2RS9 B;  5EVA A;  3DAI A;  4YYJ A;  4LYS A;  4WIV A;  5G4R A;  4CUU A;  4DON A;  5EWV A;  4UIT A;  5I86 A;  5F60 A;  4ZW1 A;  3U5O A;  2WP1 A;  1ZS5 A;  4YYD A;  5DY7 A;  5CZG A;  1PUO A;  5HEL A;  4J0R A;  2D82 A;  5DYA A;  4GPJ A;  5FE9 A;  5I88 A;  3UVW A;  3G0L A;  4HXO A;  4HXS A;  5D3S A;  4NYW A;  5FDZ A;  4O7C A;  5E3G A;  5KO4 A;  4QSR A;  3JVK A;  4NS5 A;  4UYG A;  3LJW A;  3QZS A;  5FE0 A;  4O75 A;  5LUU A;  5K29 A;  4XUB A;  4NQN A;  4QST A;  5L99 A;  4TS8 A;  5H1V A;  2YYN A;  5FE7 A;  5FH6 A;  5JI8 A;  4QC1 A;  2DKW A;  5DKH A;  5JWM A;  2L85 A;  4Y03 A;  3NXB A;  4YYN A;  4MR3 A;  5DYX A;  3HMF A;  5HLS A;  4TT6 A;  4LC2 A;  5ETD A;  4BHW A;  5CGP A;  4YC9 A;  2R0Y A;  5CRZ A;  5I83 A;  5EIC A;  5LKX A;  5F5Z A;  5EWH A;  5EM3 A;  5KTX A;  5CQ3 A;  4AKH A;  4MEQ A;  2R0V A;  4UIU A;  3VKG A;  4PY6 A;  5ETB A;  5DYU A;  5A5N A;  4WHW A;  4QR5 A;  2DVS A;  4ALH A;  3AQA A;  4Z1Q A;  5D0C A;  5HRW A;  4YAB A;  3DWY A;  4XUA A;  4NUE A;  5FE1 A;  5J0D A;  4AKG A;  4A9O A;  5F1L A;  3MUK A;  5ENC A;  5CU8 A;  3O33 A;  5A5P A;  4NR9 A;  3AAD A;  4O71 A;  4UYE A;  5ENJ A;  4LR6 A;  4MEO A;  5ENE A;  4Z6H A;  2LSP B;  3UVX A;  5FE4 A;  5CQA A;  3MUL A;  2L84 A;  4IR3 A;  4HXK A;  4QY4 A;  3I3J A;  4N4F A;  5FE8 A;  3LQI A;  4HXM A;  3ERR A;  3S91 A;  3O37 A;  4NQM A;  5HQ7 A;  4C67 A;  5H85 A;  5F1H A;  4QR4 A;  2F6J A;  4HBX A;  4PCE A;  4O78 A;  5HFQ A;  4IR4 A;  4YAT A;  2RNX A;  5CS8 A;  5FE3 A;  4QBM A;  5FFY A;  3RCW A;  4UIX A;  5DYC A;  4OGJ A;  5E9I A;  4YBS A;  5LKU A;  5F36 A;  5FBX A;  2R0S A;  3P1E A;  4WHU A;  4TU4 A;  5DBM A;  5DW2 A;  3D1D A;  5A5S A;  4NRA A;  4HBY A;  4UIW A;  5FFV A;  4Q0O A;  3MQM A;  3GG3 A;  4UIY A;  4QSW A;  5CQ7 A;  5C8G A;  4PTB A;  1N72 A;  4X2I A;  5E9L A;  5ENH A;  2FSA A;  4BW3 A;  4YH4 A;  3U5P A;  5HFR A;  3P1D A;  5DFD A;  5IG6 A;  2DVQ A;  3ONI A;  4BJX A;  2KTB B;  4LZ2 A;  4YYG A;  4NUD A;  3O35 A;  5E7D A;  3UVD A;  5KHM A;  4YYK A;  5I7Y A;  5L8T A;  4E96 A;  4QEV A;  4NYX A;  4NUC A;  5EA1 A;  4BW2 A;  4Z93 A;  5I29 A;  3JVM A;  4QB3 A;  5LJ2 A;  3SVH A;  4IOQ A;  4HXN A;  5FB0 A;  2EJN A;  2I8N A;  5E9V A;  5F3A A;  5EWC A;  4O76 A;  5IID A;  3LQJ A;  4NR7 A;  5F63 A;  2YEM A;  3QZT A;  3MB4 A;  2E3K A;  4YY6 A;  3K2J A;  4UYH A;  2DAT A;  5CQ6 A;  5CPE A;  5HEN A;  3D7C A;  4PS5 A;  5DKD A;  5DFB A;  4HXP A;  4MEN A;  5FG4 A;  3MXF A;  5D3P A;  4N3W A;  4UYF B;  5HCL A;  4PCI A;  2WP2 A;  5DLZ A;  2RI7 A;  3HME A;  2YQD A;  4UIV A;  4N4I A;  4QYL A;  5A83 A;  4TTE A;  5KTW A;  5CUA A;  5C85 A;  5TCM A;  2H60 A;  3IU5 A;  5EWD A;  3D1B A;  4ALG A;  5CQ5 A;  4YH3 A;  5FH7 A;  4QSS A;  5I7X A;  5FB1 A;  4O7F A;  5FG5 A;  5L8U A;  4J3I A;  4QR3 A;  4OUF A;  5ENG A;  5FFW A;  5E9M A;  5H1U A;  5C89 A;  5ENI A;  5EIS A;  5EWW A;  4Z1S A;  5BT3 A;  4J0S A;  5CUD A;  5LJ0 A;  4A9J A;  4O7B A;  4A9H A;  5FE5 A;  4AKN A;  5DKC A;  5FE6 A;  4O7E A;  5EPR A;  4TYL A;  5KTU A;  4MR4 A;  4NRB A;  5BT5 A;  4A9K A;  5FG6 A;  4YAD A;  4QC3 A;  5HJC A;  4QSX A;  5IGM A;  4YAX A;  5ACY A;  4CL9 A;  4YYH A;  4J1P A;  4AKI A;  2DVR A;  2F6N A;  3TLP A;  2OO1 A;  3VKH A;  4O72 A;  4LYW A;  5A85 A;  5A82 A;  4N4G A;  2D9E A;  3JVJ A;  5DLX A;  5ENF A;  4IOR A;  4IOO A;  4QZS A;  2R10 A;  5DX4 A;  5KU3 A;  5E9K A;  2YW5 A;  3IU6 A;  4CLB A;  5E74 A;  4F3I A;  4YYM A;  1WUM A;  5C7N A;  1JSP B;  5E0R A;  4QSQ A;  3Q2F A;  5CQT A;  5CTL A;  4A9F A;  4YY4 A;  3JVL A;  5CQ8 A;  5DFC A;  3U5J A;  5AD2 A;  5A5Q A;  2RO1 A;  5IGN A;  1X0J A;  3P1C A;  4HXL A;  5HRX A;  2E7O A;  4NYV A;  3MB3 A;  2DVV A;  5D7X A;  5LVQ A;  4A9E A;  4TT4 A;  4XY9 A;  3FKM X;  3O34 A;  4UIZ A;  5IGK A;  5EPB A;  5EV9 A;  4XYA A;  4HBW A;  4QEW A;  5G4S A;  4YBT A;  5H1T A;  3UVY A;  4Q0N A;  3SVF A;  3O36 A;  5BT4 A;  4YYI A;  4NR8 A;  4IR6 A;  5HQ6 A; 
#chains in the Genus database with same CATH homology
 3D1B A;  3D1D A;  4AKI A;  4AI6 A;  3VKH A;  4AKH A;  2EJN A;  4AKG A;  1ZKR A;  1PUO A;  3VKG A;  3ERR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...