4A9OA

N-terminal bromodomain of human brd2 with 5 ethyl-3-methyl-4-phenyl-1, 2-oxazole
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
RVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN CONTAINING 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 2: Optimization of Phenylisoxazole Sulfonamides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 42
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9oA00
2DVSA 4A9IA 4RVRA 5HFQA 3ZYUA 4UYDA 5I80A 5EICA 5A85A 4YBMA 4Q0NA 4PTBA 3IU6A 5CQ3A 2H60A 4C66A 4TT4A 4Z93A 2DVVA 1EQFA 5CQ6A 2RNWA 5FFWA 5HJCA 4AKNA 4QZSA 5HM0A 5C85A 5ENGA 2I8NA 4XUAA 4O71A 2E3KA 3UV4A 4O7AA 4CUUA 5HRWA 5CUCA 5FFYA 3UVXA 2N9GA 5DKHA 4CFKA 4XUBA 4PKLA 5D3HA 2DWWA 4UIUA 5IGNA 4TYLA 5H85A 4BJXA 5I83A 4QSTA 5EWDA 4TZ8A 4YYKA 5HLSA 5FBXA 5E0RA 5HENA 2L5EA 5E9MA 3ONIA 4TTEA 2YDWA 3QZTA 4A9EA 4HBXA 5A83A 4N4IA 2OO1A 5C4QA 4MR5A 4YYGA 3NXBA 4MEPA 3JVMA 3P1DA 5E3GA 4MR3A 5I1QA 3MXFA 4YADA 3MUKA 4A9NA 5KTXA 2GRCA 4QEUA 5IGMA 4QR4A 3LQIA 5F62A 5CQ5A 4ZC9A 5A82A 4KCXA 5DY7A 4MEOA 4QR3A 5DYCA 3IU5A 5BT5A 4ZW1A 5JWMA 5A5OA 4HXRA 5ENIA 2F6JA 4LC2A 5II1A 5FFVA 4WIVA 3D7CA 5BT3A 4A9FA 2D82A 4QSVA 2DATA 3MULA 3UV5A 4UIZA 4E96A 5I40A 4WHUA 2DVRA 4Q0OA 4LYWA 5A5SA 5ENFA 3S91A 5FE2A 5LVQA 4HXPA 5L8TA 3O33A 3LQHA 4OUFA 5I86A 4NYXA 5HQ6A 5E9VA 5IGLA 4LYSA 2DKWA 4PCIA 4IOOA 4A9OA 4NUCA 4YAXA 5DFBA 4YYMA 4LZRA 3LJWA 5EPRA 5DLZA 4Y03A 4TZ2A 5D25A 5CQTA 4XYAA 4A9LA 5CTLA 4YYDA 5A5NA 1JSPB 4BW1A 4O7CA 5C8GA 4F3IA 2WP2A 5E3DA 5CP5A 5CUGA 5FB0A 5KU3A 4BHWA 5ENBA 2YW5A 3UVYA 4LR6A 5EV9A 4C67A 2E7NA 5F2PA 5H1UA 4BW2A 4YBTA 4IR4A 5CQAA 5CQ7A 5CRMA 5L98A 4QSQA 3QZVA 4NRAA 4QSWA 4BW3A 5EPBA 5LKXA 5DKCA 5FG4A 4WHWA 5DFCA 3HMHA 5FH7A 4IR3A 5EISA 5A5QA 4O7EA 1X0JA 4UYEA 5DFDA 4N4GA 2RS9B 2D9EA 5TB6A 4J0SA 3P5OA 4J3IA 4TS8A 3UVWA 4CURA 4UITA 4IR6A 4Z1SA 4QUUA 4FLPA 4O72A 4UIWA 5I88A 5LKTA 4MR4A 5FE7A 5E9KA 5H1VA 5E9IA 5D3JA 2RO1A 5CUEA 5CU8A 2OUOA 4QSPA 5L97A 4Z6HA 5E9LA 3DAIA 4QSUA 5FG5A 5DKDA 4O70A 5KTUA 5AMFA 4TT2A 4LZ2A 4HBWA 3FKMX 3G0JA 5CUDA 4CL9A 5D3RA 4NXJA 2RI7A 5CQ4A 4A9MA 5A5RA 3JVLA 4KV1A 5HELA 4NR7A 2RNYA 5EWVA 3SVFA 4NR5A 3P1FA 5EK9A 4A9HA 5F5ZA 4NQNA 5F25A 2I7KA 4KV4A 1ZS5A 2YELA 5KHMA 4NRBA 4TU4A 4QUTA 3AQAA 5CS8A 4GPJA 5FE4A 3SVGA 3SVHA 4HXOA 4IR5A 5TCMA 4O75A 5C89A 4HBYA 5FE9A 4OGJA 4BW4A 1E6IA 5EWHA 2YQDA 4MENA 4MR6A 4QC3A 3U5LA 3MB3A 5EVAA 3U5KA 4QB3A 3I3JA 4LZSA 4O7FA 4O74A 5L99A 5EM3A 5KO4A 5FE8A 5FH8A 5G4RA 4NR4A 5A7CA 5D3SA 5EI4A 5DW2A 5II2A 4ALGA 5BT4A 4XY9A 5AD2A 4YY4A 4IORA 2NXBA 3HMEA 5LJ2A 3U5MA 5HQ7A 5A81A 4LYIA 2FSAA 3O37A 4UYFB 5D3PA 3K2JA 5ENCA 1WUMA 2R0SA 4QBMA 2R0VA 4UIVA 5I7XA 4O76A 2G4AA 1WUGA 4QSRA 5AMEA 4O7BA 4QY4A 5L96A 5ENHA 4TQNA 5D0CA 2R10A 4YH3A 5DBMA 4QC1A 4QEWA 5ENJA 4QEVA 4CUQA 5IBNA 3Q2EA 5EWCA 4CFLA 5F61A 5F1LA 4ALHA 5A5PA 4YH4A 2R0YA 4Z1QA 4LRGA 4CLBA 4YYJA 4IOQA 3P1CA 5EU1A 5F36A 2E7OA 4MEQA 5CZGA 4CUSA 2RFJA 4YBSA 2KTBB 5IG6A 4ZQLA 3O34A 4A9JA 4LDFA 5IGKA 5LKZA 4OGIA 5AD3A 5EA1A 2F6NA 3U5NA 4HXKA 5D3NA 5LKUA 3MQMA 5D3LA 3P1EA 5LUUA 5E9YA 2WP1A 5E73A 5HRVA 5F1HA 5G4SA 5HEMA 3UV2A 4DONA 3UVDA 1JM4B 5I89A 5CUBA 5L8UA 4HXNA 4QNSA 5COIA 5FE0A 4UIXA 4HXMA 4NUEA 3UW9A 3Q2FA 5FE1A 3JVJA 5F60A 4N3WA 2YYNA 4QSXA 5D24A 4YC9A 2MJVB 2YEMA 5KTWA 5IIDA 4NRCA 5ETBA 4O77A 4Z6IA 5E74A 5HCLA 4CUPA 4NQMA 5DYUA 2LSPB 5F63A 4J0RA 5ACYA 5I29A 5LVRA 5D3TA 5J0DA 4PS5A 3HMFA 5K29A 4X2IA 4NR6A 4PY6A 5EPSA 4NUDA 4QYDA 1N72A 4UIYA 5CY9A 5FE6A 4HXLA 2L85A 3O35A 5EP7A 5C87A 4TT6A 5LJ0A 5EGUA 5CGPA 4UYFA 5DW1A 5DLXA 5DYAA 5EWWA 5D26A 4NR9A 5HQ5A 4YYHA 3QZSA 4NS5A 4PCEA 4YYNA 4CUTA 2RNXA 4HBVA 5EQ1A 3U5OA 5H1TA 5CRZA 4UYHA 3U5JA 3GG3A 2L84A 5FE3A 4YK0A 5JI8A 3G0LA 3O36A 4QSSA 4N4HA 4YABA 5D7XA 5CUAA 3JVKA 4HXSA 4QYLA 5ENEA 3LQJA 4NYVA 4TU6A 4O78A 4QR5A 4NR8A 3U5PA 3LXJA 4XY8A 5E7DA 3S92A 4N4FA 4A9KA 2DVQA 3TLPA 1F68A 2YEKA 3DWYA 5CPEA 4UYGA 4YATA 5FDZA 5DX4A 4YY6A 5FG6A 5I7YA 5CQ8A 5C7NA 3RCWA 4J1PA 5LJ1A 3MB4A 5ETDA 5FB1A 3AADA 5F3AA 4NYWA 5DYXA 4YYIA 5HFRA 5FH6A 5CFWA 5FE5A 2OSSA 5HRXA
chains in the Genus database with same CATH superfamily
2DVSA 4A9IA 4RVRA 5HFQA 3ZYUA 4UYDA 5I80A 5EICA 5A85A 4YBMA 4Q0NA 4PTBA 3IU6A 5CQ3A 2H60A 4C66A 4TT4A 4Z93A 2DVVA 1EQFA 5CQ6A 2RNWA 5FFWA 5HJCA 4AKNA 4QZSA 5HM0A 5C85A 5ENGA 2I8NA 4XUAA 4O71A 2E3KA 3UV4A 4O7AA 4CUUA 5HRWA 5CUCA 5FFYA 3UVXA 2N9GA 5DKHA 4CFKA 4XUBA 4PKLA 5D3HA 2DWWA 4UIUA 5IGNA 4TYLA 5H85A 3D1DA 4BJXA 5I83A 4QSTA 5EWDA 4TZ8A 4YYKA 5HLSA 5FBXA 5E0RA 5HENA 2L5EA 5E9MA 3ONIA 4TTEA 4AKIA 2YDWA 3QZTA 4A9EA 3VKGA 4HBXA 5A83A 4N4IA 2OO1A 5C4QA 4MR5A 4YYGA 3NXBA 4MEPA 4AI6A 3JVMA 3P1DA 5E3GA 4MR3A 5I1QA 3MXFA 4YADA 3MUKA 4A9NA 5KTXA 2GRCA 4QEUA 5IGMA 4QR4A 3LQIA 5F62A 5CQ5A 4ZC9A 5A82A 4KCXA 5DY7A 4MEOA 4QR3A 5DYCA 3IU5A 5BT5A 4ZW1A 5JWMA 5A5OA 4HXRA 5ENIA 2F6JA 4LC2A 5II1A 5FFVA 4WIVA 3D7CA 5BT3A 4A9FA 2D82A 4QSVA 2DATA 3MULA 3UV5A 4UIZA 4E96A 5I40A 4WHUA 2DVRA 4Q0OA 4LYWA 5A5SA 5ENFA 3S91A 5FE2A 5LVQA 4HXPA 5L8TA 3O33A 3LQHA 4OUFA 5I86A 4NYXA 5HQ6A 5E9VA 5IGLA 4LYSA 2DKWA 4PCIA 4IOOA 4A9OA 4NUCA 4YAXA 5DFBA 4YYMA 4LZRA 3LJWA 5EPRA 5DLZA 4Y03A 4TZ2A 5D25A 5CQTA 4XYAA 4A9LA 5CTLA 4YYDA 5A5NA 1JSPB 4BW1A 4O7CA 5C8GA 4F3IA 2WP2A 5E3DA 5CP5A 5CUGA 5FB0A 5KU3A 4BHWA 5ENBA 2YW5A 3UVYA 4LR6A 5EV9A 4C67A 2E7NA 5F2PA 5H1UA 4BW2A 4YBTA 4IR4A 5CQAA 5CQ7A 5CRMA 5L98A 4QSQA 3QZVA 4NRAA 3D1BA 4QSWA 4BW3A 5EPBA 5LKXA 5DKCA 5FG4A 4WHWA 5DFCA 3HMHA 5FH7A 1PUOA 4IR3A 5EISA 5A5QA 4O7EA 1X0JA 4UYEA 5DFDA 4N4GA 2RS9B 2D9EA 5TB6A 4J0SA 3P5OA 4J3IA 4TS8A 3UVWA 4CURA 4UITA 4IR6A 4Z1SA 4QUUA 4FLPA 4O72A 4UIWA 5I88A 2EJNA 4MR4A 5FE7A 5E9KA 5LKTA 5H1VA 5E9IA 5D3JA 2RO1A 5CUEA 5CU8A 2OUOA 4QSPA 5L97A 4Z6HA 5E9LA 3DAIA 4QSUA 5FG5A 5DKDA 4O70A 5KTUA 5AMFA 4TT2A 4LZ2A 4HBWA 3FKMX 3G0JA 5CUDA 4CL9A 5D3RA 4NXJA 2RI7A 5CQ4A 4A9MA 5A5RA 3JVLA 4KV1A 5HELA 4NR7A 2RNYA 5EWVA 3SVFA 4NR5A 3P1FA 4AKGA 5EK9A 4A9HA 5F5ZA 4NQNA 5F25A 2I7KA 4KV4A 1ZS5A 2YELA 5KHMA 4NRBA 4TU4A 4QUTA 3AQAA 5CS8A 4GPJA 5FE4A 3SVGA 3SVHA 4HXOA 4IR5A 5TCMA 4O75A 5C89A 4HBYA 5FE9A 4OGJA 4BW4A 1E6IA 5EWHA 2YQDA 4MENA 4MR6A 4QC3A 3U5LA 3MB3A 5EVAA 3U5KA 4QB3A 3I3JA 4LZSA 4O7FA 4O74A 5L99A 5EM3A 5KO4A 5FE8A 5FH8A 5G4RA 4NR4A 5A7CA 5D3SA 5EI4A 5DW2A 5II2A 4ALGA 5BT4A 4XY9A 5AD2A 4YY4A 4IORA 2NXBA 3HMEA 5LJ2A 3U5MA 5HQ7A 5A81A 4LYIA 2FSAA 3O37A 4UYFB 5D3PA 3K2JA 5ENCA 1WUMA 2R0SA 4QBMA 2R0VA 4UIVA 5I7XA 4O76A 2G4AA 1WUGA 4QSRA 5AMEA 4O7BA 4QY4A 5L96A 5ENHA 4TQNA 5D0CA 2R10A 4YH3A 5DBMA 4QC1A 4QEWA 5ENJA 4QEVA 4CUQA 5IBNA 3Q2EA 5EWCA 4CFLA 5F61A 5F1LA 4ALHA 5A5PA 4YH4A 3ERRA 2R0YA 4Z1QA 4LRGA 4CLBA 4YYJA 4IOQA 3P1CA 5EU1A 5F36A 2E7OA 4MEQA 5CZGA 4CUSA 2RFJA 4YBSA 2KTBB 5IG6A 4ZQLA 3O34A 4A9JA 4LDFA 5IGKA 5LKZA 4OGIA 5AD3A 5EA1A 2F6NA 3U5NA 4HXKA 4AKHA 5D3NA 5LKUA 3MQMA 5D3LA 3P1EA 5LUUA 5E9YA 2WP1A 5E73A 5HRVA 5F1HA 5G4SA 5HEMA 3UV2A 4DONA 3UVDA 1JM4B 5I89A 5CUBA 5L8UA 4HXNA 4QNSA 5COIA 5FE0A 4UIXA 4HXMA 4NUEA 3UW9A 3Q2FA 5FE1A 3JVJA 5F60A 4N3WA 2YYNA 4QSXA 5D24A 4YC9A 2MJVB 2YEMA 5KTWA 5IIDA 4NRCA 5ETBA 4O77A 4Z6IA 5E74A 5HCLA 4CUPA 4NQMA 5DYUA 2LSPB 5F63A 4J0RA 5ACYA 5I29A 5LVRA 5D3TA 5J0DA 4PS5A 3HMFA 5K29A 4X2IA 4NR6A 4PY6A 5EPSA 4NUDA 4QYDA 1N72A 4UIYA 5CY9A 5FE6A 4HXLA 2L85A 3O35A 5EP7A 5C87A 4TT6A 5LJ0A 5EGUA 5CGPA 4UYFA 5DW1A 5DLXA 5DYAA 5EWWA 5D26A 4NR9A 5HQ5A 4YYHA 3QZSA 4NS5A 4PCEA 4YYNA 4CUTA 2RNXA 4HBVA 5EQ1A 3U5OA 5H1TA 5CRZA 4UYHA 3U5JA 3GG3A 2L84A 5FE3A 4YK0A 5JI8A 3G0LA 3O36A 4QSSA 4N4HA 4YABA 5D7XA 5CUAA 3JVKA 4HXSA 4QYLA 5ENEA 3LQJA 4NYVA 4TU6A 4O78A 4QR5A 4NR8A 3U5PA 3LXJA 4XY8A 5E7DA 3S92A 4N4FA 4A9KA 2DVQA 3TLPA 1F68A 2YEKA 3DWYA 5CPEA 3VKHA 4UYGA 4YATA 5FDZA 5DX4A 4YY6A 5FG6A 5I7YA 5CQ8A 5C7NA 3RCWA 4J1PA 5LJ1A 1ZKRA 3MB4A 5ETDA 5FB1A 3AADA 5F3AA 4NYWA 5DYXA 4YYIA 5HFRA 5FH6A 5CFWA 5FE5A 2OSSA 5HRXA
chains in the Genus database with same CATH topology
2DVSA 4A9IA 4RVRA 5HFQA 3ZYUA 4UYDA 5I80A 5EICA 5A85A 4YBMA 4Q0NA 4PTBA 3IU6A 5CQ3A 2H60A 4C66A 4TT4A 4Z93A 2DVVA 1EQFA 5CQ6A 2RNWA 5FFWA 5HJCA 4AKNA 4QZSA 5HM0A 5C85A 5ENGA 2I8NA 4XUAA 4O71A 2E3KA 3UV4A 4O7AA 4CUUA 5HRWA 5CUCA 5FFYA 3UVXA 2N9GA 5DKHA 4CFKA 4XUBA 4PKLA 5D3HA 2DWWA 4UIUA 5IGNA 4TYLA 5H85A 4BJXA 5I83A 4QSTA 5EWDA 4TZ8A 4YYKA 5HLSA 5FBXA 5E0RA 5HENA 2L5EA 5E9MA 3ONIA 4TTEA 2YDWA 3QZTA 4A9EA 4HBXA 5A83A 4N4IA 2OO1A 5C4QA 4MR5A 4YYGA 3NXBA 4MEPA 3JVMA 3P1DA 5E3GA 4MR3A 5I1QA 3MXFA 4YADA 3MUKA 4A9NA 5KTXA 2GRCA 4QEUA 5IGMA 4QR4A 3LQIA 5F62A 5CQ5A 4ZC9A 5A82A 4KCXA 5DY7A 4MEOA 4QR3A 5DYCA 3IU5A 5BT5A 4ZW1A 5JWMA 5A5OA 4HXRA 5ENIA 2F6JA 4LC2A 5II1A 5FFVA 4WIVA 3D7CA 5BT3A 4A9FA 2D82A 4QSVA 2DATA 3MULA 3UV5A 4UIZA 4E96A 5I40A 4WHUA 2DVRA 4Q0OA 4LYWA 5A5SA 5ENFA 3S91A 5FE2A 5LVQA 4HXPA 5L8TA 3O33A 3LQHA 4OUFA 5I86A 4NYXA 5HQ6A 5E9VA 5IGLA 4LYSA 2DKWA 4PCIA 4IOOA 4A9OA 4NUCA 4YAXA 5DFBA 4YYMA 4LZRA 3LJWA 5EPRA 5DLZA 4Y03A 4TZ2A 5D25A 5CQTA 4XYAA 4A9LA 5CTLA 4YYDA 5A5NA 1JSPB 4BW1A 4O7CA 5C8GA 4F3IA 2WP2A 5E3DA 5CP5A 5CUGA 5FB0A 5KU3A 4BHWA 5ENBA 2YW5A 3UVYA 4LR6A 5EV9A 4C67A 2E7NA 5F2PA 5H1UA 4BW2A 4YBTA 4IR4A 5CQAA 5CQ7A 5CRMA 5L98A 4QSQA 3QZVA 4NRAA 4QSWA 4BW3A 5EPBA 5LKXA 5DKCA 5FG4A 4WHWA 5DFCA 3HMHA 5FH7A 4IR3A 5EISA 5A5QA 4O7EA 1X0JA 4UYEA 5DFDA 4N4GA 2RS9B 2D9EA 5TB6A 4J0SA 3P5OA 4J3IA 4TS8A 3UVWA 4CURA 4UITA 4IR6A 4Z1SA 4QUUA 4FLPA 4O72A 4UIWA 5I88A 5LKTA 4MR4A 5FE7A 5E9KA 5H1VA 5E9IA 5D3JA 2RO1A 5CUEA 5CU8A 2OUOA 4QSPA 5L97A 4Z6HA 5E9LA 3DAIA 4QSUA 5FG5A 5DKDA 4O70A 5KTUA 5AMFA 4TT2A 4LZ2A 4HBWA 3FKMX 3G0JA 5CUDA 4CL9A 5D3RA 4NXJA 2RI7A 5CQ4A 4A9MA 5A5RA 3JVLA 4KV1A 5HELA 4NR7A 2RNYA 5EWVA 3SVFA 4NR5A 3P1FA 5EK9A 4A9HA 5F5ZA 4NQNA 5F25A 2I7KA 4KV4A 1ZS5A 2YELA 5KHMA 4NRBA 4TU4A 4QUTA 3AQAA 5CS8A 4GPJA 5FE4A 3SVGA 3SVHA 4HXOA 4IR5A 5TCMA 4O75A 5C89A 4HBYA 5FE9A 4OGJA 4BW4A 1E6IA 5EWHA 2YQDA 4MENA 4MR6A 4QC3A 3U5LA 3MB3A 5EVAA 3U5KA 4QB3A 3I3JA 4LZSA 4O7FA 4O74A 5L99A 5EM3A 5KO4A 5FE8A 5FH8A 5G4RA 4NR4A 5A7CA 5D3SA 5EI4A 5DW2A 5II2A 4ALGA 5BT4A 4XY9A 5AD2A 4YY4A 4IORA 2NXBA 3HMEA 5LJ2A 3U5MA 5HQ7A 5A81A 4LYIA 2FSAA 3O37A 4UYFB 5D3PA 3K2JA 5ENCA 1WUMA 2R0SA 4QBMA 2R0VA 4UIVA 5I7XA 4O76A 2G4AA 1WUGA 4QSRA 5AMEA 4O7BA 4QY4A 5L96A 5ENHA 4TQNA 5D0CA 2R10A 4YH3A 5DBMA 4QC1A 4QEWA 5ENJA 4QEVA 4CUQA 5IBNA 3Q2EA 5EWCA 4CFLA 5F61A 5F1LA 4ALHA 5A5PA 4YH4A 2R0YA 4Z1QA 4LRGA 4CLBA 4YYJA 4IOQA 3P1CA 5EU1A 5F36A 2E7OA 4MEQA 5CZGA 4CUSA 2RFJA 4YBSA 2KTBB 5IG6A 4ZQLA 3O34A 4A9JA 4LDFA 5IGKA 5LKZA 4OGIA 5AD3A 5EA1A 2F6NA 3U5NA 4HXKA 5D3NA 5LKUA 3MQMA 5D3LA 3P1EA 5LUUA 5E9YA 2WP1A 5E73A 5HRVA 5F1HA 5G4SA 5HEMA 3UV2A 4DONA 3UVDA 1JM4B 5I89A 5CUBA 5L8UA 4HXNA 4QNSA 5COIA 5FE0A 4UIXA 4HXMA 4NUEA 3UW9A 3Q2FA 5FE1A 3JVJA 5F60A 4N3WA 2YYNA 4QSXA 5D24A 4YC9A 2MJVB 2YEMA 5KTWA 5IIDA 4NRCA 5ETBA 4O77A 4Z6IA 5E74A 5HCLA 4CUPA 4NQMA 5DYUA 2LSPB 5F63A 4J0RA 5ACYA 5I29A 5LVRA 5D3TA 5J0DA 4PS5A 3HMFA 5K29A 4X2IA 4NR6A 4PY6A 5EPSA 4NUDA 4QYDA 1N72A 4UIYA 5CY9A 5FE6A 4HXLA 2L85A 3O35A 5EP7A 5C87A 4TT6A 5LJ0A 5EGUA 5CGPA 4UYFA 5DW1A 5DLXA 5DYAA 5EWWA 5D26A 4NR9A 5HQ5A 4YYHA 3QZSA 4NS5A 4PCEA 4YYNA 4CUTA 2RNXA 4HBVA 5EQ1A 3U5OA 5H1TA 5CRZA 4UYHA 3U5JA 3GG3A 2L84A 5FE3A 4YK0A 5JI8A 3G0LA 3O36A 4QSSA 4N4HA 4YABA 5D7XA 5CUAA 3JVKA 4HXSA 4QYLA 5ENEA 3LQJA 4NYVA 4TU6A 4O78A 4QR5A 4NR8A 3U5PA 3LXJA 4XY8A 5E7DA 3S92A 4N4FA 4A9KA 2DVQA 3TLPA 1F68A 2YEKA 3DWYA 5CPEA 4UYGA 4YATA 5FDZA 5DX4A 4YY6A 5FG6A 5I7YA 5CQ8A 5C7NA 3RCWA 4J1PA 5LJ1A 3MB4A 5ETDA 5FB1A 3AADA 5F3AA 4NYWA 5DYXA 4YYIA 5HFRA 5FH6A 5CFWA 5FE5A 2OSSA 5HRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVS A;  4A9I A;  4RVR A;  5HFQ A;  3ZYU A;  4UYD A;  5I80 A;  5EIC A;  5A85 A;  4YBM A;  4Q0N A;  4PTB A;  3IU6 A;  5CQ3 A;  2H60 A;  4C66 A;  4TT4 A;  4Z93 A;  2DVV A;  1EQF A;  5CQ6 A;  2RNW A;  5FFW A;  5HJC A;  4AKN A;  4QZS A;  5HM0 A;  5C85 A;  5ENG A;  2I8N A;  4XUA A;  4O71 A;  2E3K A;  3UV4 A;  4O7A A;  4CUU A;  5HRW A;  5CUC A;  5FFY A;  3UVX A;  2N9G A;  5DKH A;  4CFK A;  4XUB A;  4PKL A;  5D3H A;  2DWW A;  4UIU A;  5IGN A;  4TYL A;  5H85 A;  4BJX A;  5I83 A;  4QST A;  5EWD A;  4TZ8 A;  4YYK A;  5HLS A;  5FBX A;  5E0R A;  5HEN A;  2L5E A;  5E9M A;  3ONI A;  4TTE A;  2YDW A;  3QZT A;  4A9E A;  4HBX A;  5A83 A;  4N4I A;  2OO1 A;  5C4Q A;  4MR5 A;  4YYG A;  3NXB A;  4MEP A;  3JVM A;  3P1D A;  5E3G A;  4MR3 A;  5I1Q A;  3MXF A;  4YAD A;  3MUK A;  4A9N A;  5KTX A;  2GRC A;  4QEU A;  5IGM A;  4QR4 A;  3LQI A;  5F62 A;  5CQ5 A;  4ZC9 A;  5A82 A;  4KCX A;  5DY7 A;  4MEO A;  4QR3 A;  5DYC A;  3IU5 A;  5BT5 A;  4ZW1 A;  5JWM A;  5A5O A;  4HXR A;  5ENI A;  2F6J A;  4LC2 A;  5II1 A;  5FFV A;  4WIV A;  3D7C A;  5BT3 A;  4A9F A;  2D82 A;  4QSV A;  2DAT A;  3MUL A;  3UV5 A;  4UIZ A;  4E96 A;  5I40 A;  4WHU A;  2DVR A;  4Q0O A;  4LYW A;  5A5S A;  5ENF A;  3S91 A;  5FE2 A;  5LVQ A;  4HXP A;  5L8T A;  3O33 A;  3LQH A;  4OUF A;  5I86 A;  4NYX A;  5HQ6 A;  5E9V A;  5IGL A;  4LYS A;  2DKW A;  4PCI A;  4IOO A;  4A9O A;  4NUC A;  4YAX A;  5DFB A;  4YYM A;  4LZR A;  3LJW A;  5EPR A;  5DLZ A;  4Y03 A;  4TZ2 A;  5D25 A;  5CQT A;  4XYA A;  4A9L A;  5CTL A;  4YYD A;  5A5N A;  1JSP B;  4BW1 A;  4O7C A;  5C8G A;  4F3I A;  2WP2 A;  5E3D A;  5CP5 A;  5CUG A;  5FB0 A;  5KU3 A;  4BHW A;  5ENB A;  2YW5 A;  3UVY A;  4LR6 A;  5EV9 A;  4C67 A;  2E7N A;  5F2P A;  5H1U A;  4BW2 A;  4YBT A;  4IR4 A;  5CQA A;  5CQ7 A;  5CRM A;  5L98 A;  4QSQ A;  3QZV A;  4NRA A;  4QSW A;  4BW3 A;  5EPB A;  5LKX A;  5DKC A;  5FG4 A;  4WHW A;  5DFC A;  3HMH A;  5FH7 A;  4IR3 A;  5EIS A;  5A5Q A;  4O7E A;  1X0J A;  4UYE A;  5DFD A;  4N4G A;  2RS9 B;  2D9E A;  5TB6 A;  4J0S A;  3P5O A;  4J3I A;  4TS8 A;  3UVW A;  4CUR A;  4UIT A;  4IR6 A;  4Z1S A;  4QUU A;  4FLP A;  4O72 A;  4UIW A;  5I88 A;  5LKT A;  4MR4 A;  5FE7 A;  5E9K A;  5H1V A;  5E9I A;  5D3J A;  2RO1 A;  5CUE A;  5CU8 A;  2OUO A;  4QSP A;  5L97 A;  4Z6H A;  5E9L A;  3DAI A;  4QSU A;  5FG5 A;  5DKD A;  4O70 A;  5KTU A;  5AMF A;  4TT2 A;  4LZ2 A;  4HBW A;  3FKM X;  3G0J A;  5CUD A;  4CL9 A;  5D3R A;  4NXJ A;  2RI7 A;  5CQ4 A;  4A9M A;  5A5R A;  3JVL A;  4KV1 A;  5HEL A;  4NR7 A;  2RNY A;  5EWV A;  3SVF A;  4NR5 A;  3P1F A;  5EK9 A;  4A9H A;  5F5Z A;  4NQN A;  5F25 A;  2I7K A;  4KV4 A;  1ZS5 A;  2YEL A;  5KHM A;  4NRB A;  4TU4 A;  4QUT A;  3AQA A;  5CS8 A;  4GPJ A;  5FE4 A;  3SVG A;  3SVH A;  4HXO A;  4IR5 A;  5TCM A;  4O75 A;  5C89 A;  4HBY A;  5FE9 A;  4OGJ A;  4BW4 A;  1E6I A;  5EWH A;  2YQD A;  4MEN A;  4MR6 A;  4QC3 A;  3U5L A;  3MB3 A;  5EVA A;  3U5K A;  4QB3 A;  3I3J A;  4LZS A;  4O7F A;  4O74 A;  5L99 A;  5EM3 A;  5KO4 A;  5FE8 A;  5FH8 A;  5G4R A;  4NR4 A;  5A7C A;  5D3S A;  5EI4 A;  5DW2 A;  5II2 A;  4ALG A;  5BT4 A;  4XY9 A;  5AD2 A;  4YY4 A;  4IOR A;  2NXB A;  3HME A;  5LJ2 A;  3U5M A;  5HQ7 A;  5A81 A;  4LYI A;  2FSA A;  3O37 A;  4UYF B;  5D3P A;  3K2J A;  5ENC A;  1WUM A;  2R0S A;  4QBM A;  2R0V A;  4UIV A;  5I7X A;  4O76 A;  2G4A A;  1WUG A;  4QSR A;  5AME A;  4O7B A;  4QY4 A;  5L96 A;  5ENH A;  4TQN A;  5D0C A;  2R10 A;  4YH3 A;  5DBM A;  4QC1 A;  4QEW A;  5ENJ A;  4QEV A;  4CUQ A;  5IBN A;  3Q2E A;  5EWC A;  4CFL A;  5F61 A;  5F1L A;  4ALH A;  5A5P A;  4YH4 A;  2R0Y A;  4Z1Q A;  4LRG A;  4CLB A;  4YYJ A;  4IOQ A;  3P1C A;  5EU1 A;  5F36 A;  2E7O A;  4MEQ A;  5CZG A;  4CUS A;  2RFJ A;  4YBS A;  2KTB B;  5IG6 A;  4ZQL A;  3O34 A;  4A9J A;  4LDF A;  5IGK A;  5LKZ A;  4OGI A;  5AD3 A;  5EA1 A;  2F6N A;  3U5N A;  4HXK A;  5D3N A;  5LKU A;  3MQM A;  5D3L A;  3P1E A;  5LUU A;  5E9Y A;  2WP1 A;  5E73 A;  5HRV A;  5F1H A;  5G4S A;  5HEM A;  3UV2 A;  4DON A;  3UVD A;  1JM4 B;  5I89 A;  5CUB A;  5L8U A;  4HXN A;  4QNS A;  5COI A;  5FE0 A;  4UIX A;  4HXM A;  4NUE A;  3UW9 A;  3Q2F A;  5FE1 A;  3JVJ A;  5F60 A;  4N3W A;  2YYN A;  4QSX A;  5D24 A;  4YC9 A;  2MJV B;  2YEM A;  5KTW A;  5IID A;  4NRC A;  5ETB A;  4O77 A;  4Z6I A;  5E74 A;  5HCL A;  4CUP A;  4NQM A;  5DYU A;  2LSP B;  5F63 A;  4J0R A;  5ACY A;  5I29 A;  5LVR A;  5D3T A;  5J0D A;  4PS5 A;  3HMF A;  5K29 A;  4X2I A;  4NR6 A;  4PY6 A;  5EPS A;  4NUD A;  4QYD A;  1N72 A;  4UIY A;  5CY9 A;  5FE6 A;  4HXL A;  2L85 A;  3O35 A;  5EP7 A;  5C87 A;  4TT6 A;  5LJ0 A;  5EGU A;  5CGP A;  4UYF A;  5DW1 A;  5DLX A;  5DYA A;  5EWW A;  5D26 A;  4NR9 A;  5HQ5 A;  4YYH A;  3QZS A;  4NS5 A;  4PCE A;  4YYN A;  4CUT A;  2RNX A;  4HBV A;  5EQ1 A;  3U5O A;  5H1T A;  5CRZ A;  4UYH A;  3U5J A;  3GG3 A;  2L84 A;  5FE3 A;  4YK0 A;  5JI8 A;  3G0L A;  3O36 A;  4QSS A;  4N4H A;  4YAB A;  5D7X A;  5CUA A;  3JVK A;  4HXS A;  4QYL A;  5ENE A;  3LQJ A;  4NYV A;  4TU6 A;  4O78 A;  4QR5 A;  4NR8 A;  3U5P A;  3LXJ A;  4XY8 A;  5E7D A;  3S92 A;  4N4F A;  4A9K A;  2DVQ A;  3TLP A;  1F68 A;  2YEK A;  3DWY A;  5CPE A;  4UYG A;  4YAT A;  5FDZ A;  5DX4 A;  4YY6 A;  5FG6 A;  5I7Y A;  5CQ8 A;  5C7N A;  3RCW A;  4J1P A;  5LJ1 A;  3MB4 A;  5ETD A;  5FB1 A;  3AAD A;  5F3A A;  4NYW A;  5DYX A;  4YYI A;  5HFR A;  5FH6 A;  5CFW A;  5FE5 A;  2OSS A;  5HRX A; 
#chains in the Genus database with same CATH topology
 2DVS A;  4A9I A;  4RVR A;  5HFQ A;  3ZYU A;  4UYD A;  5I80 A;  5EIC A;  5A85 A;  4YBM A;  4Q0N A;  4PTB A;  3IU6 A;  5CQ3 A;  2H60 A;  4C66 A;  4TT4 A;  4Z93 A;  2DVV A;  1EQF A;  5CQ6 A;  2RNW A;  5FFW A;  5HJC A;  4AKN A;  4QZS A;  5HM0 A;  5C85 A;  5ENG A;  2I8N A;  4XUA A;  4O71 A;  2E3K A;  3UV4 A;  4O7A A;  4CUU A;  5HRW A;  5CUC A;  5FFY A;  3UVX A;  2N9G A;  5DKH A;  4CFK A;  4XUB A;  4PKL A;  5D3H A;  2DWW A;  4UIU A;  5IGN A;  4TYL A;  5H85 A;  3D1D A;  4BJX A;  5I83 A;  4QST A;  5EWD A;  4TZ8 A;  4YYK A;  5HLS A;  5FBX A;  5E0R A;  5HEN A;  2L5E A;  5E9M A;  3ONI A;  4TTE A;  4AKI A;  2YDW A;  3QZT A;  4A9E A;  3VKG A;  4HBX A;  5A83 A;  4N4I A;  2OO1 A;  5C4Q A;  4MR5 A;  4YYG A;  3NXB A;  4MEP A;  4AI6 A;  3JVM A;  3P1D A;  5E3G A;  4MR3 A;  5I1Q A;  3MXF A;  4YAD A;  3MUK A;  4A9N A;  5KTX A;  2GRC A;  4QEU A;  5IGM A;  4QR4 A;  3LQI A;  5F62 A;  5CQ5 A;  4ZC9 A;  5A82 A;  4KCX A;  5DY7 A;  4MEO A;  4QR3 A;  5DYC A;  3IU5 A;  5BT5 A;  4ZW1 A;  5JWM A;  5A5O A;  4HXR A;  5ENI A;  2F6J A;  4LC2 A;  5II1 A;  5FFV A;  4WIV A;  3D7C A;  5BT3 A;  4A9F A;  2D82 A;  4QSV A;  2DAT A;  3MUL A;  3UV5 A;  4UIZ A;  4E96 A;  5I40 A;  4WHU A;  2DVR A;  4Q0O A;  4LYW A;  5A5S A;  5ENF A;  3S91 A;  5FE2 A;  5LVQ A;  4HXP A;  5L8T A;  3O33 A;  3LQH A;  4OUF A;  5I86 A;  4NYX A;  5HQ6 A;  5E9V A;  5IGL A;  4LYS A;  2DKW A;  4PCI A;  4IOO A;  4A9O A;  4NUC A;  4YAX A;  5DFB A;  4YYM A;  4LZR A;  3LJW A;  5EPR A;  5DLZ A;  4Y03 A;  4TZ2 A;  5D25 A;  5CQT A;  4XYA A;  4A9L A;  5CTL A;  4YYD A;  5A5N A;  1JSP B;  4BW1 A;  4O7C A;  5C8G A;  4F3I A;  2WP2 A;  5E3D A;  5CP5 A;  5CUG A;  5FB0 A;  5KU3 A;  4BHW A;  5ENB A;  2YW5 A;  3UVY A;  4LR6 A;  5EV9 A;  4C67 A;  2E7N A;  5F2P A;  5H1U A;  4BW2 A;  4YBT A;  4IR4 A;  5CQA A;  5CQ7 A;  5CRM A;  5L98 A;  4QSQ A;  3QZV A;  4NRA A;  3D1B A;  4QSW A;  4BW3 A;  5EPB A;  5LKX A;  5DKC A;  5FG4 A;  4WHW A;  5DFC A;  3HMH A;  5FH7 A;  1PUO A;  4IR3 A;  5EIS A;  5A5Q A;  4O7E A;  1X0J A;  4UYE A;  5DFD A;  4N4G A;  2RS9 B;  2D9E A;  5TB6 A;  4J0S A;  3P5O A;  4J3I A;  4TS8 A;  3UVW A;  4CUR A;  4UIT A;  4IR6 A;  4Z1S A;  4QUU A;  4FLP A;  4O72 A;  4UIW A;  5I88 A;  2EJN A;  4MR4 A;  5FE7 A;  5E9K A;  5LKT A;  5H1V A;  5E9I A;  5D3J A;  2RO1 A;  5CUE A;  5CU8 A;  2OUO A;  4QSP A;  5L97 A;  4Z6H A;  5E9L A;  3DAI A;  4QSU A;  5FG5 A;  5DKD A;  4O70 A;  5KTU A;  5AMF A;  4TT2 A;  4LZ2 A;  4HBW A;  3FKM X;  3G0J A;  5CUD A;  4CL9 A;  5D3R A;  4NXJ A;  2RI7 A;  5CQ4 A;  4A9M A;  5A5R A;  3JVL A;  4KV1 A;  5HEL A;  4NR7 A;  2RNY A;  5EWV A;  3SVF A;  4NR5 A;  3P1F A;  4AKG A;  5EK9 A;  4A9H A;  5F5Z A;  4NQN A;  5F25 A;  2I7K A;  4KV4 A;  1ZS5 A;  2YEL A;  5KHM A;  4NRB A;  4TU4 A;  4QUT A;  3AQA A;  5CS8 A;  4GPJ A;  5FE4 A;  3SVG A;  3SVH A;  4HXO A;  4IR5 A;  5TCM A;  4O75 A;  5C89 A;  4HBY A;  5FE9 A;  4OGJ A;  4BW4 A;  1E6I A;  5EWH A;  2YQD A;  4MEN A;  4MR6 A;  4QC3 A;  3U5L A;  3MB3 A;  5EVA A;  3U5K A;  4QB3 A;  3I3J A;  4LZS A;  4O7F A;  4O74 A;  5L99 A;  5EM3 A;  5KO4 A;  5FE8 A;  5FH8 A;  5G4R A;  4NR4 A;  5A7C A;  5D3S A;  5EI4 A;  5DW2 A;  5II2 A;  4ALG A;  5BT4 A;  4XY9 A;  5AD2 A;  4YY4 A;  4IOR A;  2NXB A;  3HME A;  5LJ2 A;  3U5M A;  5HQ7 A;  5A81 A;  4LYI A;  2FSA A;  3O37 A;  4UYF B;  5D3P A;  3K2J A;  5ENC A;  1WUM A;  2R0S A;  4QBM A;  2R0V A;  4UIV A;  5I7X A;  4O76 A;  2G4A A;  1WUG A;  4QSR A;  5AME A;  4O7B A;  4QY4 A;  5L96 A;  5ENH A;  4TQN A;  5D0C A;  2R10 A;  4YH3 A;  5DBM A;  4QC1 A;  4QEW A;  5ENJ A;  4QEV A;  4CUQ A;  5IBN A;  3Q2E A;  5EWC A;  4CFL A;  5F61 A;  5F1L A;  4ALH A;  5A5P A;  4YH4 A;  3ERR A;  2R0Y A;  4Z1Q A;  4LRG A;  4CLB A;  4YYJ A;  4IOQ A;  3P1C A;  5EU1 A;  5F36 A;  2E7O A;  4MEQ A;  5CZG A;  4CUS A;  2RFJ A;  4YBS A;  2KTB B;  5IG6 A;  4ZQL A;  3O34 A;  4A9J A;  4LDF A;  5IGK A;  5LKZ A;  4OGI A;  5AD3 A;  5EA1 A;  2F6N A;  3U5N A;  4HXK A;  4AKH A;  5D3N A;  5LKU A;  3MQM A;  5D3L A;  3P1E A;  5LUU A;  5E9Y A;  2WP1 A;  5E73 A;  5HRV A;  5F1H A;  5G4S A;  5HEM A;  3UV2 A;  4DON A;  3UVD A;  1JM4 B;  5I89 A;  5CUB A;  5L8U A;  4HXN A;  4QNS A;  5COI A;  5FE0 A;  4UIX A;  4HXM A;  4NUE A;  3UW9 A;  3Q2F A;  5FE1 A;  3JVJ A;  5F60 A;  4N3W A;  2YYN A;  4QSX A;  5D24 A;  4YC9 A;  2MJV B;  2YEM A;  5KTW A;  5IID A;  4NRC A;  5ETB A;  4O77 A;  4Z6I A;  5E74 A;  5HCL A;  4CUP A;  4NQM A;  5DYU A;  2LSP B;  5F63 A;  4J0R A;  5ACY A;  5I29 A;  5LVR A;  5D3T A;  5J0D A;  4PS5 A;  3HMF A;  5K29 A;  4X2I A;  4NR6 A;  4PY6 A;  5EPS A;  4NUD A;  4QYD A;  1N72 A;  4UIY A;  5CY9 A;  5FE6 A;  4HXL A;  2L85 A;  3O35 A;  5EP7 A;  5C87 A;  4TT6 A;  5LJ0 A;  5EGU A;  5CGP A;  4UYF A;  5DW1 A;  5DLX A;  5DYA A;  5EWW A;  5D26 A;  4NR9 A;  5HQ5 A;  4YYH A;  3QZS A;  4NS5 A;  4PCE A;  4YYN A;  4CUT A;  2RNX A;  4HBV A;  5EQ1 A;  3U5O A;  5H1T A;  5CRZ A;  4UYH A;  3U5J A;  3GG3 A;  2L84 A;  5FE3 A;  4YK0 A;  5JI8 A;  3G0L A;  3O36 A;  4QSS A;  4N4H A;  4YAB A;  5D7X A;  5CUA A;  3JVK A;  4HXS A;  4QYL A;  5ENE A;  3LQJ A;  4NYV A;  4TU6 A;  4O78 A;  4QR5 A;  4NR8 A;  3U5P A;  3LXJ A;  4XY8 A;  5E7D A;  3S92 A;  4N4F A;  4A9K A;  2DVQ A;  3TLP A;  1F68 A;  2YEK A;  3DWY A;  5CPE A;  3VKH A;  4UYG A;  4YAT A;  5FDZ A;  5DX4 A;  4YY6 A;  5FG6 A;  5I7Y A;  5CQ8 A;  5C7N A;  3RCW A;  4J1P A;  5LJ1 A;  1ZKR A;  3MB4 A;  5ETD A;  5FB1 A;  3AAD A;  5F3A A;  4NYW A;  5DYX A;  4YYI A;  5HFR A;  5FH6 A;  5CFW A;  5FE5 A;  2OSS A;  5HRX A; 
#chains in the Genus database with same CATH homology
 2DVS A;  4A9I A;  4RVR A;  5HFQ A;  3ZYU A;  4UYD A;  5I80 A;  5EIC A;  5A85 A;  4YBM A;  4Q0N A;  4PTB A;  3IU6 A;  5CQ3 A;  2H60 A;  4C66 A;  4TT4 A;  4Z93 A;  2DVV A;  1EQF A;  5CQ6 A;  2RNW A;  5FFW A;  5HJC A;  4AKN A;  4QZS A;  5HM0 A;  5C85 A;  5ENG A;  2I8N A;  4XUA A;  4O71 A;  2E3K A;  3UV4 A;  4O7A A;  4CUU A;  5HRW A;  5CUC A;  5FFY A;  3UVX A;  2N9G A;  5DKH A;  4CFK A;  4XUB A;  4PKL A;  5D3H A;  2DWW A;  4UIU A;  5IGN A;  4TYL A;  5H85 A;  4BJX A;  5I83 A;  4QST A;  5EWD A;  4TZ8 A;  4YYK A;  5HLS A;  5FBX A;  5E0R A;  5HEN A;  2L5E A;  5E9M A;  3ONI A;  4TTE A;  2YDW A;  3QZT A;  4A9E A;  4HBX A;  5A83 A;  4N4I A;  2OO1 A;  5C4Q A;  4MR5 A;  4YYG A;  3NXB A;  4MEP A;  3JVM A;  3P1D A;  5E3G A;  4MR3 A;  5I1Q A;  3MXF A;  4YAD A;  3MUK A;  4A9N A;  5KTX A;  2GRC A;  4QEU A;  5IGM A;  4QR4 A;  3LQI A;  5F62 A;  5CQ5 A;  4ZC9 A;  5A82 A;  4KCX A;  5DY7 A;  4MEO A;  4QR3 A;  5DYC A;  3IU5 A;  5BT5 A;  4ZW1 A;  5JWM A;  5A5O A;  4HXR A;  5ENI A;  2F6J A;  4LC2 A;  5II1 A;  5FFV A;  4WIV A;  3D7C A;  5BT3 A;  4A9F A;  2D82 A;  4QSV A;  2DAT A;  3MUL A;  3UV5 A;  4UIZ A;  4E96 A;  5I40 A;  4WHU A;  2DVR A;  4Q0O A;  4LYW A;  5A5S A;  5ENF A;  3S91 A;  5FE2 A;  5LVQ A;  4HXP A;  5L8T A;  3O33 A;  3LQH A;  4OUF A;  5I86 A;  4NYX A;  5HQ6 A;  5E9V A;  5IGL A;  4LYS A;  2DKW A;  4PCI A;  4IOO A;  4A9O A;  4NUC A;  4YAX A;  5DFB A;  4YYM A;  4LZR A;  3LJW A;  5EPR A;  5DLZ A;  4Y03 A;  4TZ2 A;  5D25 A;  5CQT A;  4XYA A;  4A9L A;  5CTL A;  4YYD A;  5A5N A;  1JSP B;  4BW1 A;  4O7C A;  5C8G A;  4F3I A;  2WP2 A;  5E3D A;  5CP5 A;  5CUG A;  5FB0 A;  5KU3 A;  4BHW A;  5ENB A;  2YW5 A;  3UVY A;  4LR6 A;  5EV9 A;  4C67 A;  2E7N A;  5F2P A;  5H1U A;  4BW2 A;  4YBT A;  4IR4 A;  5CQA A;  5CQ7 A;  5CRM A;  5L98 A;  4QSQ A;  3QZV A;  4NRA A;  4QSW A;  4BW3 A;  5EPB A;  5LKX A;  5DKC A;  5FG4 A;  4WHW A;  5DFC A;  3HMH A;  5FH7 A;  4IR3 A;  5EIS A;  5A5Q A;  4O7E A;  1X0J A;  4UYE A;  5DFD A;  4N4G A;  2RS9 B;  2D9E A;  5TB6 A;  4J0S A;  3P5O A;  4J3I A;  4TS8 A;  3UVW A;  4CUR A;  4UIT A;  4IR6 A;  4Z1S A;  4QUU A;  4FLP A;  4O72 A;  4UIW A;  5I88 A;  5LKT A;  4MR4 A;  5FE7 A;  5E9K A;  5H1V A;  5E9I A;  5D3J A;  2RO1 A;  5CUE A;  5CU8 A;  2OUO A;  4QSP A;  5L97 A;  4Z6H A;  5E9L A;  3DAI A;  4QSU A;  5FG5 A;  5DKD A;  4O70 A;  5KTU A;  5AMF A;  4TT2 A;  4LZ2 A;  4HBW A;  3FKM X;  3G0J A;  5CUD A;  4CL9 A;  5D3R A;  4NXJ A;  2RI7 A;  5CQ4 A;  4A9M A;  5A5R A;  3JVL A;  4KV1 A;  5HEL A;  4NR7 A;  2RNY A;  5EWV A;  3SVF A;  4NR5 A;  3P1F A;  5EK9 A;  4A9H A;  5F5Z A;  4NQN A;  5F25 A;  2I7K A;  4KV4 A;  1ZS5 A;  2YEL A;  5KHM A;  4NRB A;  4TU4 A;  4QUT A;  3AQA A;  5CS8 A;  4GPJ A;  5FE4 A;  3SVG A;  3SVH A;  4HXO A;  4IR5 A;  5TCM A;  4O75 A;  5C89 A;  4HBY A;  5FE9 A;  4OGJ A;  4BW4 A;  1E6I A;  5EWH A;  2YQD A;  4MEN A;  4MR6 A;  4QC3 A;  3U5L A;  3MB3 A;  5EVA A;  3U5K A;  4QB3 A;  3I3J A;  4LZS A;  4O7F A;  4O74 A;  5L99 A;  5EM3 A;  5KO4 A;  5FE8 A;  5FH8 A;  5G4R A;  4NR4 A;  5A7C A;  5D3S A;  5EI4 A;  5DW2 A;  5II2 A;  4ALG A;  5BT4 A;  4XY9 A;  5AD2 A;  4YY4 A;  4IOR A;  2NXB A;  3HME A;  5LJ2 A;  3U5M A;  5HQ7 A;  5A81 A;  4LYI A;  2FSA A;  3O37 A;  4UYF B;  5D3P A;  3K2J A;  5ENC A;  1WUM A;  2R0S A;  4QBM A;  2R0V A;  4UIV A;  5I7X A;  4O76 A;  2G4A A;  1WUG A;  4QSR A;  5AME A;  4O7B A;  4QY4 A;  5L96 A;  5ENH A;  4TQN A;  5D0C A;  2R10 A;  4YH3 A;  5DBM A;  4QC1 A;  4QEW A;  5ENJ A;  4QEV A;  4CUQ A;  5IBN A;  3Q2E A;  5EWC A;  4CFL A;  5F61 A;  5F1L A;  4ALH A;  5A5P A;  4YH4 A;  2R0Y A;  4Z1Q A;  4LRG A;  4CLB A;  4YYJ A;  4IOQ A;  3P1C A;  5EU1 A;  5F36 A;  2E7O A;  4MEQ A;  5CZG A;  4CUS A;  2RFJ A;  4YBS A;  2KTB B;  5IG6 A;  4ZQL A;  3O34 A;  4A9J A;  4LDF A;  5IGK A;  5LKZ A;  4OGI A;  5AD3 A;  5EA1 A;  2F6N A;  3U5N A;  4HXK A;  5D3N A;  5LKU A;  3MQM A;  5D3L A;  3P1E A;  5LUU A;  5E9Y A;  2WP1 A;  5E73 A;  5HRV A;  5F1H A;  5G4S A;  5HEM A;  3UV2 A;  4DON A;  3UVD A;  1JM4 B;  5I89 A;  5CUB A;  5L8U A;  4HXN A;  4QNS A;  5COI A;  5FE0 A;  4UIX A;  4HXM A;  4NUE A;  3UW9 A;  3Q2F A;  5FE1 A;  3JVJ A;  5F60 A;  4N3W A;  2YYN A;  4QSX A;  5D24 A;  4YC9 A;  2MJV B;  2YEM A;  5KTW A;  5IID A;  4NRC A;  5ETB A;  4O77 A;  4Z6I A;  5E74 A;  5HCL A;  4CUP A;  4NQM A;  5DYU A;  2LSP B;  5F63 A;  4J0R A;  5ACY A;  5I29 A;  5LVR A;  5D3T A;  5J0D A;  4PS5 A;  3HMF A;  5K29 A;  4X2I A;  4NR6 A;  4PY6 A;  5EPS A;  4NUD A;  4QYD A;  1N72 A;  4UIY A;  5CY9 A;  5FE6 A;  4HXL A;  2L85 A;  3O35 A;  5EP7 A;  5C87 A;  4TT6 A;  5LJ0 A;  5EGU A;  5CGP A;  4UYF A;  5DW1 A;  5DLX A;  5DYA A;  5EWW A;  5D26 A;  4NR9 A;  5HQ5 A;  4YYH A;  3QZS A;  4NS5 A;  4PCE A;  4YYN A;  4CUT A;  2RNX A;  4HBV A;  5EQ1 A;  3U5O A;  5H1T A;  5CRZ A;  4UYH A;  3U5J A;  3GG3 A;  2L84 A;  5FE3 A;  4YK0 A;  5JI8 A;  3G0L A;  3O36 A;  4QSS A;  4N4H A;  4YAB A;  5D7X A;  5CUA A;  3JVK A;  4HXS A;  4QYL A;  5ENE A;  3LQJ A;  4NYV A;  4TU6 A;  4O78 A;  4QR5 A;  4NR8 A;  3U5P A;  3LXJ A;  4XY8 A;  5E7D A;  3S92 A;  4N4F A;  4A9K A;  2DVQ A;  3TLP A;  1F68 A;  2YEK A;  3DWY A;  5CPE A;  4UYG A;  4YAT A;  5FDZ A;  5DX4 A;  4YY6 A;  5FG6 A;  5I7Y A;  5CQ8 A;  5C7N A;  3RCW A;  4J1P A;  5LJ1 A;  3MB4 A;  5ETD A;  5FB1 A;  3AAD A;  5F3A A;  4NYW A;  5DYX A;  4YYI A;  5HFR A;  5FH6 A;  5CFW A;  5FE5 A;  2OSS A;  5HRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...