5EVAA

Crystal structure of the human brpf1 bromodomain in complex with seed16
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5evaA00
5TB6A 4HXRA 4MENA 4NR5A 4YADA 3O37A 2DATA 4O7CA 4UIYA 2E3KA 3HMFA 4YYIA 2R10A 4F3IA 4CFLA 4N4IA 5DKCA 5HFRA 5LKXA 4HXKA 5FE6A 5LUUA 2YQDA 5A7CA 3LQIA 4Z6IA 5HQ5A 4KCXA 4HBVA 2DVVA 3IU6A 1ZS5A 4YBMA 4TT4A 5CU8A 4YYHA 3LQHA 4OGJA 4O77A 5D25A 3DAIA 2YW5A 4NYWA 2LSPB 4WHUA 5AD2A 4Q0OA 5FG4A 5CUAA 4YK0A 4NQNA 2L85A 4QY4A 3U5KA 5EP7A 4NR8A 5HEMA 4MEOA 4N4GA 5I7YA 3MB3A 2OUOA 4QSVA 4MR6A 5EU1A 5ENGA 5KU3A 5E9KA 5JI8A 5EQ1A 4A9LA 4UYFA 3U5NA 4CFKA 2DVRA 5FDZA 5CUGA 5I7XA 4TT2A 4NYVA 4A9OA 5IGLA 4DONA 5FE1A 4A9IA 4O72A 5J0DA 4ALHA 5DKDA 2D9EA 5FE9A 4A9NA 2RNXA 4QYLA 5DBMA 4YATA 4WIVA 4UYGA 4IOOA 5A5RA 4CLBA 4O74A 4A9HA 5H1VA 2RS9B 5HRWA 4KV1A 4PTBA 2DKWA 2DVSA 5EM3A 4UITA 1EQFA 4MEQA 4CUSA 4QR3A 4Z1SA 5HLSA 5H1UA 5BT4A 5DLXA 5KTWA 5HQ6A 4NXJA 4TZ8A 2YYNA 4KV4A 4NUCA 5HELA 5FB0A 4QR4A 3U5LA 4CUTA 3S91A 3ZYUA 5F60A 4QYDA 4YC9A 4HXSA 4CURA 3HMEA 5C7NA 4Y03A 4YY6A 3QZSA 3JVKA 2GRCA 4UYFB 5D3NA 4LZ2A 4TU6A 5F5ZA 3MUKA 5FB1A 4HBWA 3UV2A 4MEPA 2I7KA 4LZRA 5EV9A 2R0VA 4LYWA 5JWMA 4ZC9A 5D0CA 3GG3A 4NR9A 2YEKA 2L84A 5ETDA 5ENIA 4UIWA 5FFWA 5HQ7A 4QUTA 3RCWA 4YH4A 3G0JA 4HXNA 5CQ5A 4LC2A 4TYLA 4UIVA 4QSSA 4NUDA 5II1A 5A83A 5EA1A 5IGNA 4ZQLA 5KTXA 5D3LA 4HBYA 5HCLA 5L8TA 5EPBA 5CS8A 5F3AA 3UVXA 4E96A 3U5PA 5LJ0A 5E9MA 4AKNA 5TCMA 5I29A 3FKMX 2F6NA 4N4FA 4QSWA 4HXOA 3JVMA 4O78A 4O7EA 1E6IA 5G4RA 4NYXA 5DYUA 4YYKA 5A5QA 5BT5A 5H1TA 5EGUA 5LJ2A 4QC3A 2FSAA 3MULA 3P1CA 5CUCA 5C8GA 5D24A 5FE8A 5CRMA 3MQMA 5C85A 3P5OA 4IR4A 4UYHA 5I80A 5F25A 5FE3A 4YYGA 4A9EA 3QZVA 4O71A 3MXFA 5CUBA 5CQTA 3AADA 4HXLA 5DFBA 5A5PA 3P1EA 4MR4A 5FH8A 4Z93A 4QC1A 2YELA 2RNWA 4HBXA 4NR6A 2H60A 5HRXA 5FE5A 4RVRA 5HENA 3U5JA 3O35A 4QSTA 3O34A 4C67A 4QEUA 4CL9A 4GPJA 5ETBA 5CQ7A 1JM4B 2I8NA 2YEMA 3O33A 5A5SA 5CQ8A 4CUPA 2L5EA 5I88A 5D3RA 4PCEA 5KHMA 4BW4A 3SVHA 4TS8A 5ENBA 4QZSA 5A81A 3ONIA 2RFJA 2OSSA 5L8UA 3D7CA 5E9LA 4O70A 5E7DA 4BHWA 5ACYA 5FE2A 5F36A 4LRGA 4YBSA 4YY4A 3P1DA 3UVDA 4LYIA 5I40A 5DYCA 5D3HA 5EK9A 4BW2A 4XYAA 4OUFA 5HFQA 5EWVA 5EVAA 5C89A 5I1QA 4TT6A 4C66A 3UVWA 5DX4A 5CPEA 4A9JA 4UYDA 4OGIA 2NXBA 2E7OA 2WP2A 4TU4A 4TQNA 5CRZA 4QBMA 4FLPA 4HXPA 5L98A 4BW1A 4IORA 5D3TA 4PCIA 5DYXA 3I3JA 5HRVA 5IGMA 4NQMA 2RNYA 5AMEA 4NUEA 5LKZA 4YBTA 5LKUA 5IBNA 4XY8A 2R0YA 1JSPB 5FH7A 2OO1A 2RO1A 4NRBA 5FE7A 4XUAA 4QEVA 2KTBB 4QSQA 3TLPA 5CFWA 4QB3A 5KTUA 5DW2A 5F61A 4XY9A 3UV5A 4LZSA 5EPSA 5FFVA 5I89A 4N4HA 2E7NA 3K2JA 4LYSA 5II2A 4QNSA 2D82A 4IR5A 4YH3A 5CUEA 3LJWA 4QR5A 4PKLA 5F2PA 2WP1A 4NR7A 3DWYA 3LXJA 5L99A 4O7FA 5E3GA 5K29A 4PY6A 3Q2EA 5D26A 3NXBA 4NS5A 4Q0NA 5LVQA 3U5MA 5CQ6A 4UIXA 5E3DA 5F1LA 4LR6A 5DFCA 4YABA 5FG6A 5G4SA 5LVRA 5L97A 4IR6A 4J1PA 4YYDA 5CGPA 4Z1QA 2N9GA 4YYMA 4MR3A 5A5OA 4UIZA 4WHWA 4A9FA 5C87A 5E73A 5DYAA 4NRAA 1N72A 5CTLA 5D3JA 4LDFA 5D3PA 5DY7A 4ZW1A 5LJ1A 5A5NA 4QSXA 4N3WA 5EI4A 5IGKA 4TTEA 5BT3A 4J3IA 4XUBA 5ENHA 4X2IA 5CQ4A 4IR3A 5COIA 4A9MA 2DVQA 5EWCA 4CUQA 4QEWA 5CQAA 2G4AA 3HMHA 4PS5A 5CY9A 3SVFA 4NRCA 5DFDA 5EICA 4QSRA 4YYJA 5E9IA 5CP5A 3JVJA 5E9VA 5I86A 5H85A 4CUUA 4J0SA 5ENEA 4J0RA 5AMFA 5LKTA 3Q2FA 4QUUA 5F62A 5FH6A 5I83A 4O7BA 5ENFA 3QZTA 4QSUA 3UW9A 3AQAA 5F63A 5EWHA 5HJCA 5CUDA 4YYNA 2YDWA 5F1HA 4IOQA 5L96A 5C4QA 4YAXA 3SVGA 3O36A 2RI7A 5A85A 5ENCA 5D7XA 4NR4A 5E0RA 5FBXA 5EISA 4TZ2A 4HXMA 5IIDA 5ENJA 5FE4A 4UYEA 5E9YA 5FG5A 5IG6A 3MB4A 4UIUA 3IU5A 1WUMA 2MJVB 5E74A 5FE0A 5DW1A 5D3SA 1WUGA 4MR5A 4O76A 4O7AA 5EWDA 3U5OA 4Z6HA 5A82A 5DKHA 3LQJA 4A9KA 5EWWA 3UV4A 5EPRA 3JVLA 5AD3A 2DWWA 2F6JA 3S92A 4BW3A 5CZGA 1F68A 3P1FA 4O75A 3UVYA 4QSPA 5KO4A 1X0JA 5FFYA 5DLZA 5CQ3A 5HM0A 3G0LA 4ALGA 2R0SA 4BJXA
chains in the Genus database with same CATH superfamily
5TB6A 4HXRA 4MENA 4NR5A 4YADA 3O37A 2DATA 4O7CA 4UIYA 2E3KA 3HMFA 4YYIA 2R10A 2EJNA 4CFLA 4F3IA 4N4IA 5DKCA 5HFRA 5LKXA 4HXKA 5FE6A 5LUUA 2YQDA 5A7CA 3LQIA 4Z6IA 5HQ5A 4KCXA 4HBVA 2DVVA 3IU6A 1ZS5A 4YBMA 4TT4A 5CU8A 4YYHA 3LQHA 4OGJA 4O77A 5D25A 3DAIA 2YW5A 4NYWA 2LSPB 4WHUA 5AD2A 4Q0OA 5FG4A 5CUAA 4YK0A 4NQNA 2L85A 3VKHA 4QY4A 3U5KA 5EP7A 4NR8A 5HEMA 4MEOA 4N4GA 5I7YA 3MB3A 2OUOA 4QSVA 4MR6A 5EU1A 4AKHA 5ENGA 5KU3A 5E9KA 5JI8A 5EQ1A 4A9LA 4UYFA 3U5NA 4CFKA 2DVRA 5FDZA 5CUGA 5I7XA 4TT2A 4NYVA 4A9OA 5IGLA 4DONA 5FE1A 4A9IA 4O72A 5J0DA 4ALHA 5DKDA 2D9EA 5FE9A 4A9NA 2RNXA 4QYLA 5DBMA 4YATA 4WIVA 4UYGA 4IOOA 5A5RA 4CLBA 4O74A 4A9HA 5H1VA 2RS9B 5HRWA 4KV1A 4PTBA 2DKWA 2DVSA 5EM3A 4UITA 1EQFA 4MEQA 4CUSA 4QR3A 4Z1SA 5HLSA 5H1UA 5BT4A 5DLXA 5KTWA 5HQ6A 4NXJA 4TZ8A 2YYNA 4KV4A 4NUCA 5HELA 5FB0A 4QR4A 3U5LA 4CUTA 3S91A 3ZYUA 5F60A 4QYDA 4YC9A 4HXSA 4CURA 3HMEA 5C7NA 4Y03A 4YY6A 3QZSA 3JVKA 2GRCA 4UYFB 5D3NA 4LZ2A 4TU6A 5F5ZA 3MUKA 5FB1A 4HBWA 3UV2A 4MEPA 2I7KA 4LZRA 5EV9A 2R0VA 4LYWA 5JWMA 4ZC9A 5D0CA 3GG3A 4NR9A 2YEKA 2L84A 5ETDA 5ENIA 4UIWA 5FFWA 5HQ7A 4QUTA 3RCWA 4YH4A 3G0JA 4HXNA 5CQ5A 4LC2A 4TYLA 4UIVA 4QSSA 4NUDA 5II1A 5A83A 5EA1A 5IGNA 4ZQLA 5KTXA 5D3LA 4HBYA 5HCLA 5L8TA 4AI6A 5EPBA 5CS8A 5F3AA 3UVXA 4E96A 3U5PA 5LJ0A 5E9MA 4AKNA 5TCMA 5I29A 3FKMX 2F6NA 4N4FA 1ZKRA 4QSWA 4HXOA 3JVMA 4AKGA 3ERRA 4O78A 4O7EA 1E6IA 5G4RA 4NYXA 5DYUA 4YYKA 5A5QA 5BT5A 5H1TA 5EGUA 5LJ2A 4QC3A 2FSAA 3MULA 3P1CA 5CUCA 5C8GA 5D24A 5FE8A 5CRMA 3MQMA 5C85A 3P5OA 4IR4A 4UYHA 5I80A 5F25A 5FE3A 4YYGA 4A9EA 3QZVA 4O71A 3MXFA 5CUBA 3D1BA 5CQTA 3AADA 4HXLA 5DFBA 5A5PA 3P1EA 4MR4A 5FH8A 4Z93A 4QC1A 2YELA 2RNWA 4HBXA 4NR6A 2H60A 5HRXA 5FE5A 4RVRA 5HENA 3U5JA 3O35A 4QSTA 3O34A 4C67A 4QEUA 4CL9A 4GPJA 5ETBA 5CQ7A 1JM4B 2I8NA 2YEMA 3O33A 5A5SA 5CQ8A 4CUPA 2L5EA 5I88A 5D3RA 4PCEA 5KHMA 4BW4A 3SVHA 4TS8A 5ENBA 4QZSA 5A81A 3ONIA 2RFJA 2OSSA 5L8UA 3D7CA 5E9LA 4O70A 5E7DA 4BHWA 5ACYA 5FE2A 5F36A 4LRGA 4YBSA 4YY4A 3P1DA 3UVDA 4LYIA 5I40A 5DYCA 5D3HA 5EK9A 4BW2A 4XYAA 4OUFA 5HFQA 5EWVA 5EVAA 5C89A 5I1QA 4TT6A 4C66A 3UVWA 5DX4A 5CPEA 4A9JA 4UYDA 4OGIA 2NXBA 2E7OA 2WP2A 4TU4A 4TQNA 5CRZA 4QBMA 4FLPA 4HXPA 5L98A 4BW1A 4IORA 5D3TA 4PCIA 5DYXA 3I3JA 5HRVA 5IGMA 4NQMA 2RNYA 5AMEA 4NUEA 5LKZA 4YBTA 5LKUA 5IBNA 4XY8A 2R0YA 1JSPB 5FH7A 2OO1A 2RO1A 4NRBA 5FE7A 4XUAA 4QEVA 2KTBB 4QSQA 3TLPA 5CFWA 4QB3A 5KTUA 5DW2A 5F61A 4XY9A 3UV5A 4LZSA 5EPSA 5FFVA 5I89A 4N4HA 2E7NA 3K2JA 4LYSA 5II2A 4QNSA 2D82A 4IR5A 4YH3A 5CUEA 3LJWA 4QR5A 4PKLA 5F2PA 2WP1A 4NR7A 3DWYA 3LXJA 5L99A 4O7FA 5E3GA 5K29A 4PY6A 3Q2EA 5D26A 3NXBA 4NS5A 4Q0NA 5LVQA 3U5MA 5CQ6A 4UIXA 5E3DA 5F1LA 4LR6A 5DFCA 4YABA 5FG6A 5G4SA 5LVRA 5L97A 4IR6A 4J1PA 4YYDA 5CGPA 4Z1QA 2N9GA 4YYMA 4MR3A 5A5OA 4UIZA 4WHWA 4A9FA 5C87A 5E73A 5DYAA 4NRAA 1N72A 5CTLA 5D3JA 4LDFA 5D3PA 5DY7A 4ZW1A 5LJ1A 5A5NA 4QSXA 4N3WA 5EI4A 5IGKA 4TTEA 5BT3A 4J3IA 4XUBA 5ENHA 4X2IA 5CQ4A 4IR3A 5COIA 4A9MA 2DVQA 5EWCA 4CUQA 4QEWA 5CQAA 2G4AA 3HMHA 4PS5A 5CY9A 3SVFA 4NRCA 5DFDA 5EICA 4QSRA 4YYJA 5E9IA 5CP5A 3JVJA 5E9VA 5I86A 5H85A 4CUUA 4J0SA 5ENEA 4J0RA 5AMFA 5LKTA 3Q2FA 4QUUA 5F62A 5FH6A 5I83A 4O7BA 5ENFA 3QZTA 4QSUA 3UW9A 3AQAA 5F63A 5EWHA 5HJCA 5CUDA 4YYNA 2YDWA 5F1HA 4IOQA 5L96A 5C4QA 4YAXA 3SVGA 3O36A 2RI7A 5A85A 5ENCA 5D7XA 4NR4A 5E0RA 5FBXA 5EISA 3D1DA 4TZ2A 4HXMA 5IIDA 5ENJA 5FE4A 4UYEA 5E9YA 5FG5A 5IG6A 3MB4A 4UIUA 4AKIA 3IU5A 1WUMA 2MJVB 5E74A 5FE0A 5DW1A 5D3SA 1WUGA 4MR5A 4O76A 4O7AA 5EWDA 3U5OA 4Z6HA 5A82A 5DKHA 3VKGA 3LQJA 4A9KA 5EWWA 3UV4A 5EPRA 3JVLA 5AD3A 2DWWA 2F6JA 3S92A 4BW3A 5CZGA 1F68A 1PUOA 3P1FA 4O75A 3UVYA 4QSPA 5KO4A 1X0JA 5FFYA 5DLZA 5CQ3A 5HM0A 3G0LA 4ALGA 2R0SA 4BJXA
chains in the Genus database with same CATH topology
5TB6A 4HXRA 4MENA 4NR5A 4YADA 3O37A 2DATA 4O7CA 4UIYA 2E3KA 3HMFA 4YYIA 2R10A 4F3IA 4CFLA 4N4IA 5DKCA 5HFRA 5LKXA 4HXKA 5FE6A 5LUUA 2YQDA 5A7CA 3LQIA 4Z6IA 5HQ5A 4KCXA 4HBVA 2DVVA 3IU6A 1ZS5A 4YBMA 4TT4A 5CU8A 4YYHA 3LQHA 4OGJA 4O77A 5D25A 3DAIA 2YW5A 4NYWA 2LSPB 4WHUA 5AD2A 4Q0OA 5FG4A 5CUAA 4YK0A 4NQNA 2L85A 4QY4A 3U5KA 5EP7A 4NR8A 5HEMA 4MEOA 4N4GA 5I7YA 3MB3A 2OUOA 4QSVA 4MR6A 5EU1A 5ENGA 5KU3A 5E9KA 5JI8A 5EQ1A 4A9LA 4UYFA 3U5NA 4CFKA 2DVRA 5FDZA 5CUGA 5I7XA 4TT2A 4NYVA 4A9OA 5IGLA 4DONA 5FE1A 4A9IA 4O72A 5J0DA 4ALHA 5DKDA 2D9EA 5FE9A 4A9NA 2RNXA 4QYLA 5DBMA 4YATA 4WIVA 4UYGA 4IOOA 5A5RA 4CLBA 4O74A 4A9HA 5H1VA 2RS9B 5HRWA 4KV1A 4PTBA 2DKWA 2DVSA 5EM3A 4UITA 1EQFA 4MEQA 4CUSA 4QR3A 4Z1SA 5HLSA 5H1UA 5BT4A 5DLXA 5KTWA 5HQ6A 4NXJA 4TZ8A 2YYNA 4KV4A 4NUCA 5HELA 5FB0A 4QR4A 3U5LA 4CUTA 3S91A 3ZYUA 5F60A 4QYDA 4YC9A 4HXSA 4CURA 3HMEA 5C7NA 4Y03A 4YY6A 3QZSA 3JVKA 2GRCA 4UYFB 5D3NA 4LZ2A 4TU6A 5F5ZA 3MUKA 5FB1A 4HBWA 3UV2A 4MEPA 2I7KA 4LZRA 5EV9A 2R0VA 4LYWA 5JWMA 4ZC9A 5D0CA 3GG3A 4NR9A 2YEKA 2L84A 5ETDA 5ENIA 4UIWA 5FFWA 5HQ7A 4QUTA 3RCWA 4YH4A 3G0JA 4HXNA 5CQ5A 4LC2A 4TYLA 4UIVA 4QSSA 4NUDA 5II1A 5A83A 5EA1A 5IGNA 4ZQLA 5KTXA 5D3LA 4HBYA 5HCLA 5L8TA 5EPBA 5CS8A 5F3AA 3UVXA 4E96A 3U5PA 5LJ0A 5E9MA 4AKNA 5TCMA 5I29A 3FKMX 2F6NA 4N4FA 4QSWA 4HXOA 3JVMA 4O78A 4O7EA 1E6IA 5G4RA 4NYXA 5DYUA 4YYKA 5A5QA 5BT5A 5H1TA 5EGUA 5LJ2A 4QC3A 2FSAA 3MULA 3P1CA 5CUCA 5C8GA 5D24A 5FE8A 5CRMA 3MQMA 5C85A 3P5OA 4IR4A 4UYHA 5I80A 5F25A 5FE3A 4YYGA 4A9EA 3QZVA 4O71A 3MXFA 5CUBA 5CQTA 3AADA 4HXLA 5DFBA 5A5PA 3P1EA 4MR4A 5FH8A 4Z93A 4QC1A 2YELA 2RNWA 4HBXA 4NR6A 2H60A 5HRXA 5FE5A 4RVRA 5HENA 3U5JA 3O35A 4QSTA 3O34A 4C67A 4QEUA 4CL9A 4GPJA 5ETBA 5CQ7A 1JM4B 2I8NA 2YEMA 3O33A 5A5SA 5CQ8A 4CUPA 2L5EA 5I88A 5D3RA 4PCEA 5KHMA 4BW4A 3SVHA 4TS8A 5ENBA 4QZSA 5A81A 3ONIA 2RFJA 2OSSA 5L8UA 3D7CA 5E9LA 4O70A 5E7DA 4BHWA 5ACYA 5FE2A 5F36A 4LRGA 4YBSA 4YY4A 3P1DA 3UVDA 4LYIA 5I40A 5DYCA 5D3HA 5EK9A 4BW2A 4XYAA 4OUFA 5HFQA 5EWVA 5EVAA 5C89A 5I1QA 4TT6A 4C66A 3UVWA 5DX4A 5CPEA 4A9JA 4UYDA 4OGIA 2NXBA 2E7OA 2WP2A 4TU4A 4TQNA 5CRZA 4QBMA 4FLPA 4HXPA 5L98A 4BW1A 4IORA 5D3TA 4PCIA 5DYXA 3I3JA 5HRVA 5IGMA 4NQMA 2RNYA 5AMEA 4NUEA 5LKZA 4YBTA 5LKUA 5IBNA 4XY8A 2R0YA 1JSPB 5FH7A 2OO1A 2RO1A 4NRBA 5FE7A 4XUAA 4QEVA 2KTBB 4QSQA 3TLPA 5CFWA 4QB3A 5KTUA 5DW2A 5F61A 4XY9A 3UV5A 4LZSA 5EPSA 5FFVA 5I89A 4N4HA 2E7NA 3K2JA 4LYSA 5II2A 4QNSA 2D82A 4IR5A 4YH3A 5CUEA 3LJWA 4QR5A 4PKLA 5F2PA 2WP1A 4NR7A 3DWYA 3LXJA 5L99A 4O7FA 5E3GA 5K29A 4PY6A 3Q2EA 5D26A 3NXBA 4NS5A 4Q0NA 5LVQA 3U5MA 5CQ6A 4UIXA 5E3DA 5F1LA 4LR6A 5DFCA 4YABA 5FG6A 5G4SA 5LVRA 5L97A 4IR6A 4J1PA 4YYDA 5CGPA 4Z1QA 2N9GA 4YYMA 4MR3A 5A5OA 4UIZA 4WHWA 4A9FA 5C87A 5E73A 5DYAA 4NRAA 1N72A 5CTLA 5D3JA 4LDFA 5D3PA 5DY7A 4ZW1A 5LJ1A 5A5NA 4QSXA 4N3WA 5EI4A 5IGKA 4TTEA 5BT3A 4J3IA 4XUBA 5ENHA 4X2IA 5CQ4A 4IR3A 5COIA 4A9MA 2DVQA 5EWCA 4CUQA 4QEWA 5CQAA 2G4AA 3HMHA 4PS5A 5CY9A 3SVFA 4NRCA 5DFDA 5EICA 4QSRA 4YYJA 5E9IA 5CP5A 3JVJA 5E9VA 5I86A 5H85A 4CUUA 4J0SA 5ENEA 4J0RA 5AMFA 5LKTA 3Q2FA 4QUUA 5F62A 5FH6A 5I83A 4O7BA 5ENFA 3QZTA 4QSUA 3UW9A 3AQAA 5F63A 5EWHA 5HJCA 5CUDA 4YYNA 2YDWA 5F1HA 4IOQA 5L96A 5C4QA 4YAXA 3SVGA 3O36A 2RI7A 5A85A 5ENCA 5D7XA 4NR4A 5E0RA 5FBXA 5EISA 4TZ2A 4HXMA 5IIDA 5ENJA 5FE4A 4UYEA 5E9YA 5FG5A 5IG6A 3MB4A 4UIUA 3IU5A 1WUMA 2MJVB 5E74A 5FE0A 5DW1A 5D3SA 1WUGA 4MR5A 4O76A 4O7AA 5EWDA 3U5OA 4Z6HA 5A82A 5DKHA 3LQJA 4A9KA 5EWWA 3UV4A 5EPRA 3JVLA 5AD3A 2DWWA 2F6JA 3S92A 4BW3A 5CZGA 1F68A 3P1FA 4O75A 3UVYA 4QSPA 5KO4A 1X0JA 5FFYA 5DLZA 5CQ3A 5HM0A 3G0LA 4ALGA 2R0SA 4BJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TB6 A;  4HXR A;  4MEN A;  4NR5 A;  4YAD A;  3O37 A;  2DAT A;  4O7C A;  4UIY A;  2E3K A;  3HMF A;  4YYI A;  2R10 A;  4F3I A;  4CFL A;  4N4I A;  5DKC A;  5HFR A;  5LKX A;  4HXK A;  5FE6 A;  5LUU A;  2YQD A;  5A7C A;  3LQI A;  4Z6I A;  5HQ5 A;  4KCX A;  4HBV A;  2DVV A;  3IU6 A;  1ZS5 A;  4YBM A;  4TT4 A;  5CU8 A;  4YYH A;  3LQH A;  4OGJ A;  4O77 A;  5D25 A;  3DAI A;  2YW5 A;  4NYW A;  2LSP B;  4WHU A;  5AD2 A;  4Q0O A;  5FG4 A;  5CUA A;  4YK0 A;  4NQN A;  2L85 A;  4QY4 A;  3U5K A;  5EP7 A;  4NR8 A;  5HEM A;  4MEO A;  4N4G A;  5I7Y A;  3MB3 A;  2OUO A;  4QSV A;  4MR6 A;  5EU1 A;  5ENG A;  5KU3 A;  5E9K A;  5JI8 A;  5EQ1 A;  4A9L A;  4UYF A;  3U5N A;  4CFK A;  2DVR A;  5FDZ A;  5CUG A;  5I7X A;  4TT2 A;  4NYV A;  4A9O A;  5IGL A;  4DON A;  5FE1 A;  4A9I A;  4O72 A;  5J0D A;  4ALH A;  5DKD A;  2D9E A;  5FE9 A;  4A9N A;  2RNX A;  4QYL A;  5DBM A;  4YAT A;  4WIV A;  4UYG A;  4IOO A;  5A5R A;  4CLB A;  4O74 A;  4A9H A;  5H1V A;  2RS9 B;  5HRW A;  4KV1 A;  4PTB A;  2DKW A;  2DVS A;  5EM3 A;  4UIT A;  1EQF A;  4MEQ A;  4CUS A;  4QR3 A;  4Z1S A;  5HLS A;  5H1U A;  5BT4 A;  5DLX A;  5KTW A;  5HQ6 A;  4NXJ A;  4TZ8 A;  2YYN A;  4KV4 A;  4NUC A;  5HEL A;  5FB0 A;  4QR4 A;  3U5L A;  4CUT A;  3S91 A;  3ZYU A;  5F60 A;  4QYD A;  4YC9 A;  4HXS A;  4CUR A;  3HME A;  5C7N A;  4Y03 A;  4YY6 A;  3QZS A;  3JVK A;  2GRC A;  4UYF B;  5D3N A;  4LZ2 A;  4TU6 A;  5F5Z A;  3MUK A;  5FB1 A;  4HBW A;  3UV2 A;  4MEP A;  2I7K A;  4LZR A;  5EV9 A;  2R0V A;  4LYW A;  5JWM A;  4ZC9 A;  5D0C A;  3GG3 A;  4NR9 A;  2YEK A;  2L84 A;  5ETD A;  5ENI A;  4UIW A;  5FFW A;  5HQ7 A;  4QUT A;  3RCW A;  4YH4 A;  3G0J A;  4HXN A;  5CQ5 A;  4LC2 A;  4TYL A;  4UIV A;  4QSS A;  4NUD A;  5II1 A;  5A83 A;  5EA1 A;  5IGN A;  4ZQL A;  5KTX A;  5D3L A;  4HBY A;  5HCL A;  5L8T A;  5EPB A;  5CS8 A;  5F3A A;  3UVX A;  4E96 A;  3U5P A;  5LJ0 A;  5E9M A;  4AKN A;  5TCM A;  5I29 A;  3FKM X;  2F6N A;  4N4F A;  4QSW A;  4HXO A;  3JVM A;  4O78 A;  4O7E A;  1E6I A;  5G4R A;  4NYX A;  5DYU A;  4YYK A;  5A5Q A;  5BT5 A;  5H1T A;  5EGU A;  5LJ2 A;  4QC3 A;  2FSA A;  3MUL A;  3P1C A;  5CUC A;  5C8G A;  5D24 A;  5FE8 A;  5CRM A;  3MQM A;  5C85 A;  3P5O A;  4IR4 A;  4UYH A;  5I80 A;  5F25 A;  5FE3 A;  4YYG A;  4A9E A;  3QZV A;  4O71 A;  3MXF A;  5CUB A;  5CQT A;  3AAD A;  4HXL A;  5DFB A;  5A5P A;  3P1E A;  4MR4 A;  5FH8 A;  4Z93 A;  4QC1 A;  2YEL A;  2RNW A;  4HBX A;  4NR6 A;  2H60 A;  5HRX A;  5FE5 A;  4RVR A;  5HEN A;  3U5J A;  3O35 A;  4QST A;  3O34 A;  4C67 A;  4QEU A;  4CL9 A;  4GPJ A;  5ETB A;  5CQ7 A;  1JM4 B;  2I8N A;  2YEM A;  3O33 A;  5A5S A;  5CQ8 A;  4CUP A;  2L5E A;  5I88 A;  5D3R A;  4PCE A;  5KHM A;  4BW4 A;  3SVH A;  4TS8 A;  5ENB A;  4QZS A;  5A81 A;  3ONI A;  2RFJ A;  2OSS A;  5L8U A;  3D7C A;  5E9L A;  4O70 A;  5E7D A;  4BHW A;  5ACY A;  5FE2 A;  5F36 A;  4LRG A;  4YBS A;  4YY4 A;  3P1D A;  3UVD A;  4LYI A;  5I40 A;  5DYC A;  5D3H A;  5EK9 A;  4BW2 A;  4XYA A;  4OUF A;  5HFQ A;  5EWV A;  5EVA A;  5C89 A;  5I1Q A;  4TT6 A;  4C66 A;  3UVW A;  5DX4 A;  5CPE A;  4A9J A;  4UYD A;  4OGI A;  2NXB A;  2E7O A;  2WP2 A;  4TU4 A;  4TQN A;  5CRZ A;  4QBM A;  4FLP A;  4HXP A;  5L98 A;  4BW1 A;  4IOR A;  5D3T A;  4PCI A;  5DYX A;  3I3J A;  5HRV A;  5IGM A;  4NQM A;  2RNY A;  5AME A;  4NUE A;  5LKZ A;  4YBT A;  5LKU A;  5IBN A;  4XY8 A;  2R0Y A;  1JSP B;  5FH7 A;  2OO1 A;  2RO1 A;  4NRB A;  5FE7 A;  4XUA A;  4QEV A;  2KTB B;  4QSQ A;  3TLP A;  5CFW A;  4QB3 A;  5KTU A;  5DW2 A;  5F61 A;  4XY9 A;  3UV5 A;  4LZS A;  5EPS A;  5FFV A;  5I89 A;  4N4H A;  2E7N A;  3K2J A;  4LYS A;  5II2 A;  4QNS A;  2D82 A;  4IR5 A;  4YH3 A;  5CUE A;  3LJW A;  4QR5 A;  4PKL A;  5F2P A;  2WP1 A;  4NR7 A;  3DWY A;  3LXJ A;  5L99 A;  4O7F A;  5E3G A;  5K29 A;  4PY6 A;  3Q2E A;  5D26 A;  3NXB A;  4NS5 A;  4Q0N A;  5LVQ A;  3U5M A;  5CQ6 A;  4UIX A;  5E3D A;  5F1L A;  4LR6 A;  5DFC A;  4YAB A;  5FG6 A;  5G4S A;  5LVR A;  5L97 A;  4IR6 A;  4J1P A;  4YYD A;  5CGP A;  4Z1Q A;  2N9G A;  4YYM A;  4MR3 A;  5A5O A;  4UIZ A;  4WHW A;  4A9F A;  5C87 A;  5E73 A;  5DYA A;  4NRA A;  1N72 A;  5CTL A;  5D3J A;  4LDF A;  5D3P A;  5DY7 A;  4ZW1 A;  5LJ1 A;  5A5N A;  4QSX A;  4N3W A;  5EI4 A;  5IGK A;  4TTE A;  5BT3 A;  4J3I A;  4XUB A;  5ENH A;  4X2I A;  5CQ4 A;  4IR3 A;  5COI A;  4A9M A;  2DVQ A;  5EWC A;  4CUQ A;  4QEW A;  5CQA A;  2G4A A;  3HMH A;  4PS5 A;  5CY9 A;  3SVF A;  4NRC A;  5DFD A;  5EIC A;  4QSR A;  4YYJ A;  5E9I A;  5CP5 A;  3JVJ A;  5E9V A;  5I86 A;  5H85 A;  4CUU A;  4J0S A;  5ENE A;  4J0R A;  5AMF A;  5LKT A;  3Q2F A;  4QUU A;  5F62 A;  5FH6 A;  5I83 A;  4O7B A;  5ENF A;  3QZT A;  4QSU A;  3UW9 A;  3AQA A;  5F63 A;  5EWH A;  5HJC A;  5CUD A;  4YYN A;  2YDW A;  5F1H A;  4IOQ A;  5L96 A;  5C4Q A;  4YAX A;  3SVG A;  3O36 A;  2RI7 A;  5A85 A;  5ENC A;  5D7X A;  4NR4 A;  5E0R A;  5FBX A;  5EIS A;  4TZ2 A;  4HXM A;  5IID A;  5ENJ A;  5FE4 A;  4UYE A;  5E9Y A;  5FG5 A;  5IG6 A;  3MB4 A;  4UIU A;  3IU5 A;  1WUM A;  2MJV B;  5E74 A;  5FE0 A;  5DW1 A;  5D3S A;  1WUG A;  4MR5 A;  4O76 A;  4O7A A;  5EWD A;  3U5O A;  4Z6H A;  5A82 A;  5DKH A;  3LQJ A;  4A9K A;  5EWW A;  3UV4 A;  5EPR A;  3JVL A;  5AD3 A;  2DWW A;  2F6J A;  3S92 A;  4BW3 A;  5CZG A;  1F68 A;  3P1F A;  4O75 A;  3UVY A;  4QSP A;  5KO4 A;  1X0J A;  5FFY A;  5DLZ A;  5CQ3 A;  5HM0 A;  3G0L A;  4ALG A;  2R0S A;  4BJX A; 
#chains in the Genus database with same CATH topology
 5TB6 A;  4HXR A;  4MEN A;  4NR5 A;  4YAD A;  3O37 A;  2DAT A;  4O7C A;  4UIY A;  2E3K A;  3HMF A;  4YYI A;  2R10 A;  2EJN A;  4CFL A;  4F3I A;  4N4I A;  5DKC A;  5HFR A;  5LKX A;  4HXK A;  5FE6 A;  5LUU A;  2YQD A;  5A7C A;  3LQI A;  4Z6I A;  5HQ5 A;  4KCX A;  4HBV A;  2DVV A;  3IU6 A;  1ZS5 A;  4YBM A;  4TT4 A;  5CU8 A;  4YYH A;  3LQH A;  4OGJ A;  4O77 A;  5D25 A;  3DAI A;  2YW5 A;  4NYW A;  2LSP B;  4WHU A;  5AD2 A;  4Q0O A;  5FG4 A;  5CUA A;  4YK0 A;  4NQN A;  2L85 A;  3VKH A;  4QY4 A;  3U5K A;  5EP7 A;  4NR8 A;  5HEM A;  4MEO A;  4N4G A;  5I7Y A;  3MB3 A;  2OUO A;  4QSV A;  4MR6 A;  5EU1 A;  4AKH A;  5ENG A;  5KU3 A;  5E9K A;  5JI8 A;  5EQ1 A;  4A9L A;  4UYF A;  3U5N A;  4CFK A;  2DVR A;  5FDZ A;  5CUG A;  5I7X A;  4TT2 A;  4NYV A;  4A9O A;  5IGL A;  4DON A;  5FE1 A;  4A9I A;  4O72 A;  5J0D A;  4ALH A;  5DKD A;  2D9E A;  5FE9 A;  4A9N A;  2RNX A;  4QYL A;  5DBM A;  4YAT A;  4WIV A;  4UYG A;  4IOO A;  5A5R A;  4CLB A;  4O74 A;  4A9H A;  5H1V A;  2RS9 B;  5HRW A;  4KV1 A;  4PTB A;  2DKW A;  2DVS A;  5EM3 A;  4UIT A;  1EQF A;  4MEQ A;  4CUS A;  4QR3 A;  4Z1S A;  5HLS A;  5H1U A;  5BT4 A;  5DLX A;  5KTW A;  5HQ6 A;  4NXJ A;  4TZ8 A;  2YYN A;  4KV4 A;  4NUC A;  5HEL A;  5FB0 A;  4QR4 A;  3U5L A;  4CUT A;  3S91 A;  3ZYU A;  5F60 A;  4QYD A;  4YC9 A;  4HXS A;  4CUR A;  3HME A;  5C7N A;  4Y03 A;  4YY6 A;  3QZS A;  3JVK A;  2GRC A;  4UYF B;  5D3N A;  4LZ2 A;  4TU6 A;  5F5Z A;  3MUK A;  5FB1 A;  4HBW A;  3UV2 A;  4MEP A;  2I7K A;  4LZR A;  5EV9 A;  2R0V A;  4LYW A;  5JWM A;  4ZC9 A;  5D0C A;  3GG3 A;  4NR9 A;  2YEK A;  2L84 A;  5ETD A;  5ENI A;  4UIW A;  5FFW A;  5HQ7 A;  4QUT A;  3RCW A;  4YH4 A;  3G0J A;  4HXN A;  5CQ5 A;  4LC2 A;  4TYL A;  4UIV A;  4QSS A;  4NUD A;  5II1 A;  5A83 A;  5EA1 A;  5IGN A;  4ZQL A;  5KTX A;  5D3L A;  4HBY A;  5HCL A;  5L8T A;  4AI6 A;  5EPB A;  5CS8 A;  5F3A A;  3UVX A;  4E96 A;  3U5P A;  5LJ0 A;  5E9M A;  4AKN A;  5TCM A;  5I29 A;  3FKM X;  2F6N A;  4N4F A;  1ZKR A;  4QSW A;  4HXO A;  3JVM A;  4AKG A;  3ERR A;  4O78 A;  4O7E A;  1E6I A;  5G4R A;  4NYX A;  5DYU A;  4YYK A;  5A5Q A;  5BT5 A;  5H1T A;  5EGU A;  5LJ2 A;  4QC3 A;  2FSA A;  3MUL A;  3P1C A;  5CUC A;  5C8G A;  5D24 A;  5FE8 A;  5CRM A;  3MQM A;  5C85 A;  3P5O A;  4IR4 A;  4UYH A;  5I80 A;  5F25 A;  5FE3 A;  4YYG A;  4A9E A;  3QZV A;  4O71 A;  3MXF A;  5CUB A;  3D1B A;  5CQT A;  3AAD A;  4HXL A;  5DFB A;  5A5P A;  3P1E A;  4MR4 A;  5FH8 A;  4Z93 A;  4QC1 A;  2YEL A;  2RNW A;  4HBX A;  4NR6 A;  2H60 A;  5HRX A;  5FE5 A;  4RVR A;  5HEN A;  3U5J A;  3O35 A;  4QST A;  3O34 A;  4C67 A;  4QEU A;  4CL9 A;  4GPJ A;  5ETB A;  5CQ7 A;  1JM4 B;  2I8N A;  2YEM A;  3O33 A;  5A5S A;  5CQ8 A;  4CUP A;  2L5E A;  5I88 A;  5D3R A;  4PCE A;  5KHM A;  4BW4 A;  3SVH A;  4TS8 A;  5ENB A;  4QZS A;  5A81 A;  3ONI A;  2RFJ A;  2OSS A;  5L8U A;  3D7C A;  5E9L A;  4O70 A;  5E7D A;  4BHW A;  5ACY A;  5FE2 A;  5F36 A;  4LRG A;  4YBS A;  4YY4 A;  3P1D A;  3UVD A;  4LYI A;  5I40 A;  5DYC A;  5D3H A;  5EK9 A;  4BW2 A;  4XYA A;  4OUF A;  5HFQ A;  5EWV A;  5EVA A;  5C89 A;  5I1Q A;  4TT6 A;  4C66 A;  3UVW A;  5DX4 A;  5CPE A;  4A9J A;  4UYD A;  4OGI A;  2NXB A;  2E7O A;  2WP2 A;  4TU4 A;  4TQN A;  5CRZ A;  4QBM A;  4FLP A;  4HXP A;  5L98 A;  4BW1 A;  4IOR A;  5D3T A;  4PCI A;  5DYX A;  3I3J A;  5HRV A;  5IGM A;  4NQM A;  2RNY A;  5AME A;  4NUE A;  5LKZ A;  4YBT A;  5LKU A;  5IBN A;  4XY8 A;  2R0Y A;  1JSP B;  5FH7 A;  2OO1 A;  2RO1 A;  4NRB A;  5FE7 A;  4XUA A;  4QEV A;  2KTB B;  4QSQ A;  3TLP A;  5CFW A;  4QB3 A;  5KTU A;  5DW2 A;  5F61 A;  4XY9 A;  3UV5 A;  4LZS A;  5EPS A;  5FFV A;  5I89 A;  4N4H A;  2E7N A;  3K2J A;  4LYS A;  5II2 A;  4QNS A;  2D82 A;  4IR5 A;  4YH3 A;  5CUE A;  3LJW A;  4QR5 A;  4PKL A;  5F2P A;  2WP1 A;  4NR7 A;  3DWY A;  3LXJ A;  5L99 A;  4O7F A;  5E3G A;  5K29 A;  4PY6 A;  3Q2E A;  5D26 A;  3NXB A;  4NS5 A;  4Q0N A;  5LVQ A;  3U5M A;  5CQ6 A;  4UIX A;  5E3D A;  5F1L A;  4LR6 A;  5DFC A;  4YAB A;  5FG6 A;  5G4S A;  5LVR A;  5L97 A;  4IR6 A;  4J1P A;  4YYD A;  5CGP A;  4Z1Q A;  2N9G A;  4YYM A;  4MR3 A;  5A5O A;  4UIZ A;  4WHW A;  4A9F A;  5C87 A;  5E73 A;  5DYA A;  4NRA A;  1N72 A;  5CTL A;  5D3J A;  4LDF A;  5D3P A;  5DY7 A;  4ZW1 A;  5LJ1 A;  5A5N A;  4QSX A;  4N3W A;  5EI4 A;  5IGK A;  4TTE A;  5BT3 A;  4J3I A;  4XUB A;  5ENH A;  4X2I A;  5CQ4 A;  4IR3 A;  5COI A;  4A9M A;  2DVQ A;  5EWC A;  4CUQ A;  4QEW A;  5CQA A;  2G4A A;  3HMH A;  4PS5 A;  5CY9 A;  3SVF A;  4NRC A;  5DFD A;  5EIC A;  4QSR A;  4YYJ A;  5E9I A;  5CP5 A;  3JVJ A;  5E9V A;  5I86 A;  5H85 A;  4CUU A;  4J0S A;  5ENE A;  4J0R A;  5AMF A;  5LKT A;  3Q2F A;  4QUU A;  5F62 A;  5FH6 A;  5I83 A;  4O7B A;  5ENF A;  3QZT A;  4QSU A;  3UW9 A;  3AQA A;  5F63 A;  5EWH A;  5HJC A;  5CUD A;  4YYN A;  2YDW A;  5F1H A;  4IOQ A;  5L96 A;  5C4Q A;  4YAX A;  3SVG A;  3O36 A;  2RI7 A;  5A85 A;  5ENC A;  5D7X A;  4NR4 A;  5E0R A;  5FBX A;  5EIS A;  3D1D A;  4TZ2 A;  4HXM A;  5IID A;  5ENJ A;  5FE4 A;  4UYE A;  5E9Y A;  5FG5 A;  5IG6 A;  3MB4 A;  4UIU A;  4AKI A;  3IU5 A;  1WUM A;  2MJV B;  5E74 A;  5FE0 A;  5DW1 A;  5D3S A;  1WUG A;  4MR5 A;  4O76 A;  4O7A A;  5EWD A;  3U5O A;  4Z6H A;  5A82 A;  5DKH A;  3VKG A;  3LQJ A;  4A9K A;  5EWW A;  3UV4 A;  5EPR A;  3JVL A;  5AD3 A;  2DWW A;  2F6J A;  3S92 A;  4BW3 A;  5CZG A;  1F68 A;  1PUO A;  3P1F A;  4O75 A;  3UVY A;  4QSP A;  5KO4 A;  1X0J A;  5FFY A;  5DLZ A;  5CQ3 A;  5HM0 A;  3G0L A;  4ALG A;  2R0S A;  4BJX A; 
#chains in the Genus database with same CATH homology
 5TB6 A;  4HXR A;  4MEN A;  4NR5 A;  4YAD A;  3O37 A;  2DAT A;  4O7C A;  4UIY A;  2E3K A;  3HMF A;  4YYI A;  2R10 A;  4F3I A;  4CFL A;  4N4I A;  5DKC A;  5HFR A;  5LKX A;  4HXK A;  5FE6 A;  5LUU A;  2YQD A;  5A7C A;  3LQI A;  4Z6I A;  5HQ5 A;  4KCX A;  4HBV A;  2DVV A;  3IU6 A;  1ZS5 A;  4YBM A;  4TT4 A;  5CU8 A;  4YYH A;  3LQH A;  4OGJ A;  4O77 A;  5D25 A;  3DAI A;  2YW5 A;  4NYW A;  2LSP B;  4WHU A;  5AD2 A;  4Q0O A;  5FG4 A;  5CUA A;  4YK0 A;  4NQN A;  2L85 A;  4QY4 A;  3U5K A;  5EP7 A;  4NR8 A;  5HEM A;  4MEO A;  4N4G A;  5I7Y A;  3MB3 A;  2OUO A;  4QSV A;  4MR6 A;  5EU1 A;  5ENG A;  5KU3 A;  5E9K A;  5JI8 A;  5EQ1 A;  4A9L A;  4UYF A;  3U5N A;  4CFK A;  2DVR A;  5FDZ A;  5CUG A;  5I7X A;  4TT2 A;  4NYV A;  4A9O A;  5IGL A;  4DON A;  5FE1 A;  4A9I A;  4O72 A;  5J0D A;  4ALH A;  5DKD A;  2D9E A;  5FE9 A;  4A9N A;  2RNX A;  4QYL A;  5DBM A;  4YAT A;  4WIV A;  4UYG A;  4IOO A;  5A5R A;  4CLB A;  4O74 A;  4A9H A;  5H1V A;  2RS9 B;  5HRW A;  4KV1 A;  4PTB A;  2DKW A;  2DVS A;  5EM3 A;  4UIT A;  1EQF A;  4MEQ A;  4CUS A;  4QR3 A;  4Z1S A;  5HLS A;  5H1U A;  5BT4 A;  5DLX A;  5KTW A;  5HQ6 A;  4NXJ A;  4TZ8 A;  2YYN A;  4KV4 A;  4NUC A;  5HEL A;  5FB0 A;  4QR4 A;  3U5L A;  4CUT A;  3S91 A;  3ZYU A;  5F60 A;  4QYD A;  4YC9 A;  4HXS A;  4CUR A;  3HME A;  5C7N A;  4Y03 A;  4YY6 A;  3QZS A;  3JVK A;  2GRC A;  4UYF B;  5D3N A;  4LZ2 A;  4TU6 A;  5F5Z A;  3MUK A;  5FB1 A;  4HBW A;  3UV2 A;  4MEP A;  2I7K A;  4LZR A;  5EV9 A;  2R0V A;  4LYW A;  5JWM A;  4ZC9 A;  5D0C A;  3GG3 A;  4NR9 A;  2YEK A;  2L84 A;  5ETD A;  5ENI A;  4UIW A;  5FFW A;  5HQ7 A;  4QUT A;  3RCW A;  4YH4 A;  3G0J A;  4HXN A;  5CQ5 A;  4LC2 A;  4TYL A;  4UIV A;  4QSS A;  4NUD A;  5II1 A;  5A83 A;  5EA1 A;  5IGN A;  4ZQL A;  5KTX A;  5D3L A;  4HBY A;  5HCL A;  5L8T A;  5EPB A;  5CS8 A;  5F3A A;  3UVX A;  4E96 A;  3U5P A;  5LJ0 A;  5E9M A;  4AKN A;  5TCM A;  5I29 A;  3FKM X;  2F6N A;  4N4F A;  4QSW A;  4HXO A;  3JVM A;  4O78 A;  4O7E A;  1E6I A;  5G4R A;  4NYX A;  5DYU A;  4YYK A;  5A5Q A;  5BT5 A;  5H1T A;  5EGU A;  5LJ2 A;  4QC3 A;  2FSA A;  3MUL A;  3P1C A;  5CUC A;  5C8G A;  5D24 A;  5FE8 A;  5CRM A;  3MQM A;  5C85 A;  3P5O A;  4IR4 A;  4UYH A;  5I80 A;  5F25 A;  5FE3 A;  4YYG A;  4A9E A;  3QZV A;  4O71 A;  3MXF A;  5CUB A;  5CQT A;  3AAD A;  4HXL A;  5DFB A;  5A5P A;  3P1E A;  4MR4 A;  5FH8 A;  4Z93 A;  4QC1 A;  2YEL A;  2RNW A;  4HBX A;  4NR6 A;  2H60 A;  5HRX A;  5FE5 A;  4RVR A;  5HEN A;  3U5J A;  3O35 A;  4QST A;  3O34 A;  4C67 A;  4QEU A;  4CL9 A;  4GPJ A;  5ETB A;  5CQ7 A;  1JM4 B;  2I8N A;  2YEM A;  3O33 A;  5A5S A;  5CQ8 A;  4CUP A;  2L5E A;  5I88 A;  5D3R A;  4PCE A;  5KHM A;  4BW4 A;  3SVH A;  4TS8 A;  5ENB A;  4QZS A;  5A81 A;  3ONI A;  2RFJ A;  2OSS A;  5L8U A;  3D7C A;  5E9L A;  4O70 A;  5E7D A;  4BHW A;  5ACY A;  5FE2 A;  5F36 A;  4LRG A;  4YBS A;  4YY4 A;  3P1D A;  3UVD A;  4LYI A;  5I40 A;  5DYC A;  5D3H A;  5EK9 A;  4BW2 A;  4XYA A;  4OUF A;  5HFQ A;  5EWV A;  5EVA A;  5C89 A;  5I1Q A;  4TT6 A;  4C66 A;  3UVW A;  5DX4 A;  5CPE A;  4A9J A;  4UYD A;  4OGI A;  2NXB A;  2E7O A;  2WP2 A;  4TU4 A;  4TQN A;  5CRZ A;  4QBM A;  4FLP A;  4HXP A;  5L98 A;  4BW1 A;  4IOR A;  5D3T A;  4PCI A;  5DYX A;  3I3J A;  5HRV A;  5IGM A;  4NQM A;  2RNY A;  5AME A;  4NUE A;  5LKZ A;  4YBT A;  5LKU A;  5IBN A;  4XY8 A;  2R0Y A;  1JSP B;  5FH7 A;  2OO1 A;  2RO1 A;  4NRB A;  5FE7 A;  4XUA A;  4QEV A;  2KTB B;  4QSQ A;  3TLP A;  5CFW A;  4QB3 A;  5KTU A;  5DW2 A;  5F61 A;  4XY9 A;  3UV5 A;  4LZS A;  5EPS A;  5FFV A;  5I89 A;  4N4H A;  2E7N A;  3K2J A;  4LYS A;  5II2 A;  4QNS A;  2D82 A;  4IR5 A;  4YH3 A;  5CUE A;  3LJW A;  4QR5 A;  4PKL A;  5F2P A;  2WP1 A;  4NR7 A;  3DWY A;  3LXJ A;  5L99 A;  4O7F A;  5E3G A;  5K29 A;  4PY6 A;  3Q2E A;  5D26 A;  3NXB A;  4NS5 A;  4Q0N A;  5LVQ A;  3U5M A;  5CQ6 A;  4UIX A;  5E3D A;  5F1L A;  4LR6 A;  5DFC A;  4YAB A;  5FG6 A;  5G4S A;  5LVR A;  5L97 A;  4IR6 A;  4J1P A;  4YYD A;  5CGP A;  4Z1Q A;  2N9G A;  4YYM A;  4MR3 A;  5A5O A;  4UIZ A;  4WHW A;  4A9F A;  5C87 A;  5E73 A;  5DYA A;  4NRA A;  1N72 A;  5CTL A;  5D3J A;  4LDF A;  5D3P A;  5DY7 A;  4ZW1 A;  5LJ1 A;  5A5N A;  4QSX A;  4N3W A;  5EI4 A;  5IGK A;  4TTE A;  5BT3 A;  4J3I A;  4XUB A;  5ENH A;  4X2I A;  5CQ4 A;  4IR3 A;  5COI A;  4A9M A;  2DVQ A;  5EWC A;  4CUQ A;  4QEW A;  5CQA A;  2G4A A;  3HMH A;  4PS5 A;  5CY9 A;  3SVF A;  4NRC A;  5DFD A;  5EIC A;  4QSR A;  4YYJ A;  5E9I A;  5CP5 A;  3JVJ A;  5E9V A;  5I86 A;  5H85 A;  4CUU A;  4J0S A;  5ENE A;  4J0R A;  5AMF A;  5LKT A;  3Q2F A;  4QUU A;  5F62 A;  5FH6 A;  5I83 A;  4O7B A;  5ENF A;  3QZT A;  4QSU A;  3UW9 A;  3AQA A;  5F63 A;  5EWH A;  5HJC A;  5CUD A;  4YYN A;  2YDW A;  5F1H A;  4IOQ A;  5L96 A;  5C4Q A;  4YAX A;  3SVG A;  3O36 A;  2RI7 A;  5A85 A;  5ENC A;  5D7X A;  4NR4 A;  5E0R A;  5FBX A;  5EIS A;  4TZ2 A;  4HXM A;  5IID A;  5ENJ A;  5FE4 A;  4UYE A;  5E9Y A;  5FG5 A;  5IG6 A;  3MB4 A;  4UIU A;  3IU5 A;  1WUM A;  2MJV B;  5E74 A;  5FE0 A;  5DW1 A;  5D3S A;  1WUG A;  4MR5 A;  4O76 A;  4O7A A;  5EWD A;  3U5O A;  4Z6H A;  5A82 A;  5DKH A;  3LQJ A;  4A9K A;  5EWW A;  3UV4 A;  5EPR A;  3JVL A;  5AD3 A;  2DWW A;  2F6J A;  3S92 A;  4BW3 A;  5CZG A;  1F68 A;  3P1F A;  4O75 A;  3UVY A;  4QSP A;  5KO4 A;  1X0J A;  5FFY A;  5DLZ A;  5CQ3 A;  5HM0 A;  3G0L A;  4ALG A;  2R0S A;  4BJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...