5EVAA

Crystal structure of the human brpf1 bromodomain in complex with seed16
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 43
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5evaA00
3UW9A 5TB6A 5EGUA 4QSWA 5EWDA 5LKXA 5EWHA 5FE4A 1JSPB 5EP7A 4NR9A 5CUAA 5JWMA 5FDZA 4NYXA 2R10A 5CQ5A 5IGNA 4O74A 5FFVA 4BW4A 5IGLA 3LQHA 4MR5A 5DKDA 3RCWA 4YYJA 4WIVA 4QR4A 5D3SA 5E9LA 5HENA 4MR4A 2RNYA 5HFQA 5G4RA 5HRVA 4NXJA 4HXKA 4N4IA 5FE8A 5CUDA 5C8GA 4PS5A 5CUBA 5FE9A 5ENEA 3UVXA 5EA1A 5EWCA 4KV1A 3JVMA 5AMEA 5EPBA 4A9IA 5HQ6A 3U5MA 4O7AA 4PTBA 4IR6A 4YATA 4LR6A 4YH4A 5ENCA 2WP1A 5E7DA 4QUTA 4QBMA 2MJVB 5CUGA 4N4GA 4A9MA 5LKUA 3IU5A 4A9NA 1X0JA 3QZSA 5L8UA 4NUEA 5I1QA 4QSXA 4N4HA 4QNSA 5FE7A 5HRXA 4UIYA 2DVQA 5CRMA 4ZW1A 5H85A 4LYSA 5EWWA 4QSRA 3HMHA 4IOQA 5A85A 5D0CA 5D3RA 4OGIA 2N9GA 5H1VA 4J1PA 3U5OA 5E74A 4UYFB 4NQMA 4ZQLA 2L85A 4O76A 5HM0A 5ENIA 5EICA 4PY6A 5ENBA 4A9OA 3SVFA 3U5KA 2KTBB 5HEMA 4CUUA 4QUUA 5BT4A 4TYLA 3JVKA 4Z6IA 5F5ZA 5F36A 1ZS5A 4HXRA 3SVGA 5DFDA 5G4SA 5L8TA 3DAIA 5CP5A 5FH8A 4XYAA 4YYHA 4MR6A 1WUMA 4WHWA 4CUTA 4YYMA 4PCIA 3LQJA 4QC1A 5FE2A 4CUSA 5CY9A 2YDWA 4YK0A 5KU3A 5CQ4A 4Q0OA 5HCLA 1JM4B 5L98A 5A81A 5A7CA 2RI7A 4NR6A 5CQ3A 4MENA 5I83A 2RS9B 5D7XA 5II1A 4XUBA 4TU6A 5D3NA 4HXNA 4ALHA 2D82A 4O71A 4A9JA 4UYFA 3Q2EA 2D9EA 4C66A 4Z1SA 4QR3A 3P1FA 2DVSA 4HBWA 4HXOA 5L96A 4IR4A 5AD3A 5LVRA 5FH6A 5I7YA 4TS8A 4Z6HA 2LSPB 5DKHA 4HBVA 5I29A 5ENHA 2F6NA 4IORA 5C89A 4O7FA 4CLBA 4XUAA 5ENJA 2FSAA 4TQNA 5D3JA 4OGJA 5HQ5A 2E3KA 5II2A 3U5JA 4UYGA 4LYIA 3O34A 2NXBA 4QZSA 4C67A 4QSTA 3UV2A 5IGMA 4O75A 5D24A 4HXPA 5CZGA 5F1HA 4YYIA 5DYCA 5CRZA 4UIUA 2YYNA 4HXMA 5CS8A 5J0DA 4UYHA 4YBTA 5A82A 5H1UA 4NS5A 2OO1A 3LXJA 4NUCA 4ALGA 4E96A 4UIWA 4CFLA 5E0RA 4YY6A 4LZSA 5IG6A 5CGPA 5HJCA 5LJ0A 4A9EA 2G4AA 4MEQA 4QB3A 5BT3A 4NQNA 5HLSA 2RFJA 3UVYA 3I3JA 5E9YA 4NR5A 3QZTA 4NUDA 4QSVA 3TLPA 3UVDA 3NXBA 3MXFA 4NYWA 4KV4A 5CQ7A 4O77A 5DBMA 5JI8A 4Q0NA 5I86A 4XY8A 4IR3A 5EPRA 4LZRA 5DKCA 5A5NA 3S91A 2RO1A 3O35A 3K2JA 5D3HA 4LDFA 4O7EA 5BT5A 5E9VA 4O70A 3Q2FA 5A5SA 3U5PA 5FE1A 3P1DA 2YW5A 4TZ2A 5C87A 5ACYA 4NRAA 3MULA 4CUPA 3LJWA 4TZ8A 5C7NA 4YAXA 4YC9A 5DLXA 4J0RA 5FFWA 3JVLA 4MR3A 5E73A 4TT6A 5ETDA 5D3PA 4YYGA 4CFKA 2OSSA 4LZ2A 4QSUA 2DWWA 5E3DA 3P5OA 2YEMA 5CFWA 5CQ6A 5ENFA 3SVHA 5HRWA 3U5LA 4O72A 5EM3A 4NRBA 3HMFA 5E9KA 5I40A 4FLPA 4NR8A 4QYLA 5TCMA 4A9KA 4NR7A 4YH3A 5FB1A 5C85A 3LQIA 3P1EA 4UYDA 3JVJA 5LVQA 5FB0A 5FG6A 2YELA 5KHMA 5KTXA 4BJXA 3FKMX 1F68A 3AADA 4YYDA 5HQ7A 5IGKA 4LYWA 5COIA 4CL9A 5DW1A 3IU6A 4Y03A 5LJ2A 3MB4A 3ZYUA 3O36A 5D25A 5E3GA 4TT4A 5DW2A 5EV9A 5E9MA 5A5OA 2R0VA 3UV4A 5KO4A 5CQTA 5CQAA 5EK9A 4UYEA 4TT2A 4HBXA 2YQDA 5FE3A 4BHWA 5LKTA 5EPSA 4QC3A 4X2IA 5CUCA 5A5RA 4MEPA 2F6JA 4QSSA 4CUQA 4YYKA 5CU8A 5HELA 5ETBA 5L97A 4XY9A 5DYUA 5K29A 4A9FA 4IOOA 5AMFA 4UIXA 5D3TA 2DKWA 5EVAA 5DFCA 4J3IA 4N3WA 4O78A 3GG3A 4BW3A 5AD2A 5F63A 4TU4A 3O37A 5EQ1A 3S92A 2I7KA 5DFBA 2WP2A 5CUEA 4QSQA 4IR5A 1E6IA 2H60A 4UIVA 4UITA 3O33A 5FE0A 2I8NA 5EISA 3ONIA 3UV5A 5C4QA 2DVVA 2RNWA 3D7CA 2DATA 5FG5A 2E7OA 5DY7A 5F1LA 5L99A 3HMEA 5LJ1A 2L5EA 5DYXA 5FH7A 4DONA 5FE6A 5LKZA 4QYDA 4O7CA 4QEWA 5A83A 3DWYA 4PKLA 5FG4A 5CPEA 3P1CA 4J0SA 5F60A 5FBXA 1N72A 4YADA 3G0JA 4KCXA 3MB3A 1WUGA 5F2PA 4OUFA 3G0LA 5F62A 5D26A 5FFYA 4A9LA 2R0SA 5CTLA 5I88A 5IIDA 4RVRA 5LUUA 4YABA 4YYNA 2RNXA 4NR4A 5KTWA 2GRCA 4HXLA 4QR5A 5A5PA 4CURA 4GPJA 5FE5A 3MQMA 4ZC9A 2YEKA 4BW1A 4QEVA 4A9HA 2L84A 4UIZA 3MUKA 4TTEA 4LC2A 4YBMA 5I89A 3AQAA 2R0YA 4YBSA 4NYVA 5HFRA 2DVRA 4QEUA 5F3AA 5EWVA 4HBYA 1EQFA 4YY4A 5I7XA 3UVWA 5F61A 5KTUA 5I80A 3QZVA 5CQ8A 4LRGA 4O7BA 5EU1A 4NRCA 5ENGA 4QY4A 2OUOA 5DX4A 5D3LA 4MEOA 2E7NA 4PCEA 5DYAA 5E9IA 3U5NA 4N4FA 4Z93A 4F3IA 4Z1QA 5H1TA 5EI4A 4AKNA 5IBNA 4HXSA 5A5QA 4WHUA 5F25A 4BW2A 4QSPA 5DLZA
chains in the Genus database with same CATH superfamily
3UW9A 5TB6A 5EGUA 4QSWA 5EWDA 5LKXA 5EWHA 5FE4A 1JSPB 5EP7A 4NR9A 5CUAA 5JWMA 5FDZA 4NYXA 2R10A 5CQ5A 5IGNA 4O74A 5FFVA 4BW4A 5IGLA 3LQHA 4MR5A 5DKDA 3RCWA 4YYJA 4WIVA 4QR4A 5D3SA 5E9LA 5HENA 4MR4A 2RNYA 5HFQA 4AKGA 5G4RA 5HRVA 4NXJA 4HXKA 4N4IA 5FE8A 5CUDA 3VKHA 5C8GA 4AKHA 4PS5A 5CUBA 5FE9A 5ENEA 3UVXA 5EA1A 5EWCA 4KV1A 3JVMA 5AMEA 5EPBA 4A9IA 5HQ6A 3U5MA 4O7AA 4PTBA 4IR6A 4YATA 4LR6A 4YH4A 5ENCA 2WP1A 5E7DA 4QUTA 4QBMA 2MJVB 5CUGA 4N4GA 4A9MA 5LKUA 3IU5A 4A9NA 1X0JA 3QZSA 5L8UA 4NUEA 5I1QA 4QSXA 4N4HA 4QNSA 5FE7A 5HRXA 4UIYA 2DVQA 5CRMA 4ZW1A 5H85A 4LYSA 5EWWA 4QSRA 3HMHA 4IOQA 5A85A 5D0CA 5D3RA 4OGIA 2N9GA 5H1VA 4J1PA 3U5OA 5E74A 4UYFB 4NQMA 4ZQLA 2L85A 4O76A 5HM0A 5ENIA 5EICA 4PY6A 1PUOA 5ENBA 4A9OA 3SVFA 3U5KA 2KTBB 5HEMA 4CUUA 4QUUA 5BT4A 4TYLA 3JVKA 4Z6IA 5F5ZA 5F36A 1ZS5A 4HXRA 3SVGA 5DFDA 5G4SA 5L8TA 3DAIA 5CP5A 5FH8A 4XYAA 4YYHA 4MR6A 1WUMA 4WHWA 4CUTA 4YYMA 4PCIA 3LQJA 4QC1A 5FE2A 4CUSA 5CY9A 2YDWA 4YK0A 5KU3A 5CQ4A 4Q0OA 5HCLA 1JM4B 5L98A 5A81A 5A7CA 2RI7A 4NR6A 5CQ3A 4MENA 3ERRA 2RS9B 5D7XA 5I83A 5II1A 4XUBA 4TU6A 5D3NA 4HXNA 4ALHA 2D82A 4O71A 4A9JA 4UYFA 3Q2EA 2D9EA 4C66A 4Z1SA 4QR3A 3P1FA 2DVSA 4HBWA 4HXOA 5L96A 4IR4A 5AD3A 5LVRA 5FH6A 5I7YA 4TS8A 4Z6HA 2LSPB 5DKHA 4HBVA 5I29A 5ENHA 2F6NA 4IORA 5C89A 4O7FA 4CLBA 4XUAA 5ENJA 2FSAA 4TQNA 5D3JA 4OGJA 5HQ5A 2E3KA 5II2A 3U5JA 4UYGA 4LYIA 3O34A 2NXBA 4QZSA 4C67A 4QSTA 3UV2A 5IGMA 4O75A 5D24A 4HXPA 5CZGA 5F1HA 4YYIA 5DYCA 5CRZA 4UIUA 2YYNA 4HXMA 5CS8A 5J0DA 4UYHA 4YBTA 5A82A 5H1UA 4NS5A 2OO1A 3LXJA 4NUCA 4ALGA 4E96A 4UIWA 4CFLA 5E0RA 4YY6A 4LZSA 5IG6A 5CGPA 5HJCA 5LJ0A 4A9EA 2G4AA 4MEQA 3VKGA 4QB3A 5BT3A 4NQNA 5HLSA 2RFJA 3UVYA 1ZKRA 3I3JA 5E9YA 4NR5A 3QZTA 4NUDA 4QSVA 3TLPA 3UVDA 3NXBA 3MXFA 4NYWA 4KV4A 5CQ7A 4O77A 5DBMA 5JI8A 4Q0NA 5I86A 4XY8A 4IR3A 5EPRA 4LZRA 5DKCA 5A5NA 3S91A 2RO1A 3O35A 3K2JA 5D3HA 4LDFA 4O7EA 5BT5A 5E9VA 4O70A 3Q2FA 5A5SA 3U5PA 5FE1A 3P1DA 2YW5A 4TZ2A 5C87A 5ACYA 4NRAA 3MULA 4CUPA 3LJWA 4TZ8A 5C7NA 3D1BA 4YAXA 4YC9A 5DLXA 4J0RA 5FFWA 3JVLA 4MR3A 5E73A 4TT6A 5ETDA 5D3PA 4YYGA 4CFKA 2OSSA 4LZ2A 4QSUA 2DWWA 5E3DA 3P5OA 2YEMA 5CFWA 5CQ6A 5ENFA 3SVHA 5HRWA 3U5LA 4O72A 5EM3A 4NRBA 3HMFA 5E9KA 5I40A 3D1DA 4FLPA 4NR8A 4QYLA 5TCMA 4A9KA 4NR7A 4YH3A 5FB1A 5C85A 3LQIA 3P1EA 4UYDA 3JVJA 5LVQA 5FB0A 5FG6A 2YELA 5KHMA 5KTXA 4BJXA 3FKMX 1F68A 3AADA 4YYDA 5HQ7A 5IGKA 4LYWA 5COIA 4CL9A 5DW1A 3IU6A 4Y03A 5LJ2A 3MB4A 3ZYUA 3O36A 5D25A 5E3GA 4TT4A 5DW2A 5EV9A 5E9MA 5A5OA 2R0VA 3UV4A 5KO4A 5CQTA 5CQAA 5EK9A 4UYEA 4TT2A 4HBXA 2YQDA 5FE3A 4BHWA 5LKTA 5EPSA 4QC3A 4X2IA 5CUCA 5A5RA 4MEPA 2F6JA 4QSSA 4CUQA 4YYKA 5CU8A 5HELA 5ETBA 5L97A 4XY9A 5DYUA 5K29A 4A9FA 4IOOA 5AMFA 4UIXA 5D3TA 2DKWA 5EVAA 5DFCA 4J3IA 4N3WA 4O78A 3GG3A 4BW3A 5AD2A 5F63A 4TU4A 3O37A 5EQ1A 3S92A 2I7KA 5DFBA 2WP2A 5CUEA 4QSQA 4IR5A 1E6IA 2H60A 4UIVA 4UITA 3O33A 5FE0A 2I8NA 5EISA 3ONIA 3UV5A 5C4QA 2DVVA 2RNWA 3D7CA 2DATA 5FG5A 2E7OA 5DY7A 5F1LA 5L99A 3HMEA 5LJ1A 2L5EA 5DYXA 5FH7A 4DONA 5FE6A 5LKZA 4QYDA 4O7CA 4QEWA 5A83A 3DWYA 4PKLA 5FG4A 5CPEA 3P1CA 4J0SA 5F60A 5FBXA 1N72A 4YADA 3G0JA 4KCXA 3MB3A 1WUGA 5F2PA 4OUFA 3G0LA 5F62A 5D26A 5FFYA 4A9LA 2R0SA 5CTLA 5I88A 5IIDA 4RVRA 5LUUA 4YABA 4YYNA 2RNXA 4NR4A 5KTWA 2GRCA 4HXLA 4QR5A 5A5PA 4CURA 4GPJA 5FE5A 3MQMA 4ZC9A 2YEKA 4BW1A 4QEVA 4A9HA 2L84A 4UIZA 3MUKA 4TTEA 4LC2A 4YBMA 5I89A 3AQAA 2R0YA 4YBSA 4NYVA 5HFRA 2DVRA 4QEUA 5F3AA 5EWVA 4AI6A 4HBYA 1EQFA 4YY4A 5I7XA 3UVWA 5F61A 5KTUA 5I80A 3QZVA 5CQ8A 4LRGA 4O7BA 5EU1A 2EJNA 4NRCA 5ENGA 4QY4A 2OUOA 4AKIA 5DX4A 5D3LA 4MEOA 2E7NA 4PCEA 5DYAA 5E9IA 3U5NA 4N4FA 4Z93A 4F3IA 4Z1QA 5H1TA 5EI4A 4AKNA 5IBNA 4HXSA 5A5QA 4WHUA 5F25A 4BW2A 4QSPA 5DLZA
chains in the Genus database with same CATH topology
3UW9A 5TB6A 5EGUA 4QSWA 5EWDA 5LKXA 5EWHA 5FE4A 1JSPB 5EP7A 4NR9A 5CUAA 5JWMA 5FDZA 4NYXA 2R10A 5CQ5A 5IGNA 4O74A 5FFVA 4BW4A 5IGLA 3LQHA 4MR5A 5DKDA 3RCWA 4YYJA 4WIVA 4QR4A 5D3SA 5E9LA 5HENA 4MR4A 2RNYA 5HFQA 5G4RA 5HRVA 4NXJA 4HXKA 4N4IA 5FE8A 5CUDA 5C8GA 4PS5A 5CUBA 5FE9A 5ENEA 3UVXA 5EA1A 5EWCA 4KV1A 3JVMA 5AMEA 5EPBA 4A9IA 5HQ6A 3U5MA 4O7AA 4PTBA 4IR6A 4YATA 4LR6A 4YH4A 5ENCA 2WP1A 5E7DA 4QUTA 4QBMA 2MJVB 5CUGA 4N4GA 4A9MA 5LKUA 3IU5A 4A9NA 1X0JA 3QZSA 5L8UA 4NUEA 5I1QA 4QSXA 4N4HA 4QNSA 5FE7A 5HRXA 4UIYA 2DVQA 5CRMA 4ZW1A 5H85A 4LYSA 5EWWA 4QSRA 3HMHA 4IOQA 5A85A 5D0CA 5D3RA 4OGIA 2N9GA 5H1VA 4J1PA 3U5OA 5E74A 4UYFB 4NQMA 4ZQLA 2L85A 4O76A 5HM0A 5ENIA 5EICA 4PY6A 5ENBA 4A9OA 3SVFA 3U5KA 2KTBB 5HEMA 4CUUA 4QUUA 5BT4A 4TYLA 3JVKA 4Z6IA 5F5ZA 5F36A 1ZS5A 4HXRA 3SVGA 5DFDA 5G4SA 5L8TA 3DAIA 5CP5A 5FH8A 4XYAA 4YYHA 4MR6A 1WUMA 4WHWA 4CUTA 4YYMA 4PCIA 3LQJA 4QC1A 5FE2A 4CUSA 5CY9A 2YDWA 4YK0A 5KU3A 5CQ4A 4Q0OA 5HCLA 1JM4B 5L98A 5A81A 5A7CA 2RI7A 4NR6A 5CQ3A 4MENA 5I83A 2RS9B 5D7XA 5II1A 4XUBA 4TU6A 5D3NA 4HXNA 4ALHA 2D82A 4O71A 4A9JA 4UYFA 3Q2EA 2D9EA 4C66A 4Z1SA 4QR3A 3P1FA 2DVSA 4HBWA 4HXOA 5L96A 4IR4A 5AD3A 5LVRA 5FH6A 5I7YA 4TS8A 4Z6HA 2LSPB 5DKHA 4HBVA 5I29A 5ENHA 2F6NA 4IORA 5C89A 4O7FA 4CLBA 4XUAA 5ENJA 2FSAA 4TQNA 5D3JA 4OGJA 5HQ5A 2E3KA 5II2A 3U5JA 4UYGA 4LYIA 3O34A 2NXBA 4QZSA 4C67A 4QSTA 3UV2A 5IGMA 4O75A 5D24A 4HXPA 5CZGA 5F1HA 4YYIA 5DYCA 5CRZA 4UIUA 2YYNA 4HXMA 5CS8A 5J0DA 4UYHA 4YBTA 5A82A 5H1UA 4NS5A 2OO1A 3LXJA 4NUCA 4ALGA 4E96A 4UIWA 4CFLA 5E0RA 4YY6A 4LZSA 5IG6A 5CGPA 5HJCA 5LJ0A 4A9EA 2G4AA 4MEQA 4QB3A 5BT3A 4NQNA 5HLSA 2RFJA 3UVYA 3I3JA 5E9YA 4NR5A 3QZTA 4NUDA 4QSVA 3TLPA 3UVDA 3NXBA 3MXFA 4NYWA 4KV4A 5CQ7A 4O77A 5DBMA 5JI8A 4Q0NA 5I86A 4XY8A 4IR3A 5EPRA 4LZRA 5DKCA 5A5NA 3S91A 2RO1A 3O35A 3K2JA 5D3HA 4LDFA 4O7EA 5BT5A 5E9VA 4O70A 3Q2FA 5A5SA 3U5PA 5FE1A 3P1DA 2YW5A 4TZ2A 5C87A 5ACYA 4NRAA 3MULA 4CUPA 3LJWA 4TZ8A 5C7NA 4YAXA 4YC9A 5DLXA 4J0RA 5FFWA 3JVLA 4MR3A 5E73A 4TT6A 5ETDA 5D3PA 4YYGA 4CFKA 2OSSA 4LZ2A 4QSUA 2DWWA 5E3DA 3P5OA 2YEMA 5CFWA 5CQ6A 5ENFA 3SVHA 5HRWA 3U5LA 4O72A 5EM3A 4NRBA 3HMFA 5E9KA 5I40A 4FLPA 4NR8A 4QYLA 5TCMA 4A9KA 4NR7A 4YH3A 5FB1A 5C85A 3LQIA 3P1EA 4UYDA 3JVJA 5LVQA 5FB0A 5FG6A 2YELA 5KHMA 5KTXA 4BJXA 3FKMX 1F68A 3AADA 4YYDA 5HQ7A 5IGKA 4LYWA 5COIA 4CL9A 5DW1A 3IU6A 4Y03A 5LJ2A 3MB4A 3ZYUA 3O36A 5D25A 5E3GA 4TT4A 5DW2A 5EV9A 5E9MA 5A5OA 2R0VA 3UV4A 5KO4A 5CQTA 5CQAA 5EK9A 4UYEA 4TT2A 4HBXA 2YQDA 5FE3A 4BHWA 5LKTA 5EPSA 4QC3A 4X2IA 5CUCA 5A5RA 4MEPA 2F6JA 4QSSA 4CUQA 4YYKA 5CU8A 5HELA 5ETBA 5L97A 4XY9A 5DYUA 5K29A 4A9FA 4IOOA 5AMFA 4UIXA 5D3TA 2DKWA 5EVAA 5DFCA 4J3IA 4N3WA 4O78A 3GG3A 4BW3A 5AD2A 5F63A 4TU4A 3O37A 5EQ1A 3S92A 2I7KA 5DFBA 2WP2A 5CUEA 4QSQA 4IR5A 1E6IA 2H60A 4UIVA 4UITA 3O33A 5FE0A 2I8NA 5EISA 3ONIA 3UV5A 5C4QA 2DVVA 2RNWA 3D7CA 2DATA 5FG5A 2E7OA 5DY7A 5F1LA 5L99A 3HMEA 5LJ1A 2L5EA 5DYXA 5FH7A 4DONA 5FE6A 5LKZA 4QYDA 4O7CA 4QEWA 5A83A 3DWYA 4PKLA 5FG4A 5CPEA 3P1CA 4J0SA 5F60A 5FBXA 1N72A 4YADA 3G0JA 4KCXA 3MB3A 1WUGA 5F2PA 4OUFA 3G0LA 5F62A 5D26A 5FFYA 4A9LA 2R0SA 5CTLA 5I88A 5IIDA 4RVRA 5LUUA 4YABA 4YYNA 2RNXA 4NR4A 5KTWA 2GRCA 4HXLA 4QR5A 5A5PA 4CURA 4GPJA 5FE5A 3MQMA 4ZC9A 2YEKA 4BW1A 4QEVA 4A9HA 2L84A 4UIZA 3MUKA 4TTEA 4LC2A 4YBMA 5I89A 3AQAA 2R0YA 4YBSA 4NYVA 5HFRA 2DVRA 4QEUA 5F3AA 5EWVA 4HBYA 1EQFA 4YY4A 5I7XA 3UVWA 5F61A 5KTUA 5I80A 3QZVA 5CQ8A 4LRGA 4O7BA 5EU1A 4NRCA 5ENGA 4QY4A 2OUOA 5DX4A 5D3LA 4MEOA 2E7NA 4PCEA 5DYAA 5E9IA 3U5NA 4N4FA 4Z93A 4F3IA 4Z1QA 5H1TA 5EI4A 4AKNA 5IBNA 4HXSA 5A5QA 4WHUA 5F25A 4BW2A 4QSPA 5DLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UW9 A;  5TB6 A;  5EGU A;  4QSW A;  5EWD A;  5LKX A;  5EWH A;  5FE4 A;  1JSP B;  5EP7 A;  4NR9 A;  5CUA A;  5JWM A;  5FDZ A;  4NYX A;  2R10 A;  5CQ5 A;  5IGN A;  4O74 A;  5FFV A;  4BW4 A;  5IGL A;  3LQH A;  4MR5 A;  5DKD A;  3RCW A;  4YYJ A;  4WIV A;  4QR4 A;  5D3S A;  5E9L A;  5HEN A;  4MR4 A;  2RNY A;  5HFQ A;  5G4R A;  5HRV A;  4NXJ A;  4HXK A;  4N4I A;  5FE8 A;  5CUD A;  5C8G A;  4PS5 A;  5CUB A;  5FE9 A;  5ENE A;  3UVX A;  5EA1 A;  5EWC A;  4KV1 A;  3JVM A;  5AME A;  5EPB A;  4A9I A;  5HQ6 A;  3U5M A;  4O7A A;  4PTB A;  4IR6 A;  4YAT A;  4LR6 A;  4YH4 A;  5ENC A;  2WP1 A;  5E7D A;  4QUT A;  4QBM A;  2MJV B;  5CUG A;  4N4G A;  4A9M A;  5LKU A;  3IU5 A;  4A9N A;  1X0J A;  3QZS A;  5L8U A;  4NUE A;  5I1Q A;  4QSX A;  4N4H A;  4QNS A;  5FE7 A;  5HRX A;  4UIY A;  2DVQ A;  5CRM A;  4ZW1 A;  5H85 A;  4LYS A;  5EWW A;  4QSR A;  3HMH A;  4IOQ A;  5A85 A;  5D0C A;  5D3R A;  4OGI A;  2N9G A;  5H1V A;  4J1P A;  3U5O A;  5E74 A;  4UYF B;  4NQM A;  4ZQL A;  2L85 A;  4O76 A;  5HM0 A;  5ENI A;  5EIC A;  4PY6 A;  5ENB A;  4A9O A;  3SVF A;  3U5K A;  2KTB B;  5HEM A;  4CUU A;  4QUU A;  5BT4 A;  4TYL A;  3JVK A;  4Z6I A;  5F5Z A;  5F36 A;  1ZS5 A;  4HXR A;  3SVG A;  5DFD A;  5G4S A;  5L8T A;  3DAI A;  5CP5 A;  5FH8 A;  4XYA A;  4YYH A;  4MR6 A;  1WUM A;  4WHW A;  4CUT A;  4YYM A;  4PCI A;  3LQJ A;  4QC1 A;  5FE2 A;  4CUS A;  5CY9 A;  2YDW A;  4YK0 A;  5KU3 A;  5CQ4 A;  4Q0O A;  5HCL A;  1JM4 B;  5L98 A;  5A81 A;  5A7C A;  2RI7 A;  4NR6 A;  5CQ3 A;  4MEN A;  5I83 A;  2RS9 B;  5D7X A;  5II1 A;  4XUB A;  4TU6 A;  5D3N A;  4HXN A;  4ALH A;  2D82 A;  4O71 A;  4A9J A;  4UYF A;  3Q2E A;  2D9E A;  4C66 A;  4Z1S A;  4QR3 A;  3P1F A;  2DVS A;  4HBW A;  4HXO A;  5L96 A;  4IR4 A;  5AD3 A;  5LVR A;  5FH6 A;  5I7Y A;  4TS8 A;  4Z6H A;  2LSP B;  5DKH A;  4HBV A;  5I29 A;  5ENH A;  2F6N A;  4IOR A;  5C89 A;  4O7F A;  4CLB A;  4XUA A;  5ENJ A;  2FSA A;  4TQN A;  5D3J A;  4OGJ A;  5HQ5 A;  2E3K A;  5II2 A;  3U5J A;  4UYG A;  4LYI A;  3O34 A;  2NXB A;  4QZS A;  4C67 A;  4QST A;  3UV2 A;  5IGM A;  4O75 A;  5D24 A;  4HXP A;  5CZG A;  5F1H A;  4YYI A;  5DYC A;  5CRZ A;  4UIU A;  2YYN A;  4HXM A;  5CS8 A;  5J0D A;  4UYH A;  4YBT A;  5A82 A;  5H1U A;  4NS5 A;  2OO1 A;  3LXJ A;  4NUC A;  4ALG A;  4E96 A;  4UIW A;  4CFL A;  5E0R A;  4YY6 A;  4LZS A;  5IG6 A;  5CGP A;  5HJC A;  5LJ0 A;  4A9E A;  2G4A A;  4MEQ A;  4QB3 A;  5BT3 A;  4NQN A;  5HLS A;  2RFJ A;  3UVY A;  3I3J A;  5E9Y A;  4NR5 A;  3QZT A;  4NUD A;  4QSV A;  3TLP A;  3UVD A;  3NXB A;  3MXF A;  4NYW A;  4KV4 A;  5CQ7 A;  4O77 A;  5DBM A;  5JI8 A;  4Q0N A;  5I86 A;  4XY8 A;  4IR3 A;  5EPR A;  4LZR A;  5DKC A;  5A5N A;  3S91 A;  2RO1 A;  3O35 A;  3K2J A;  5D3H A;  4LDF A;  4O7E A;  5BT5 A;  5E9V A;  4O70 A;  3Q2F A;  5A5S A;  3U5P A;  5FE1 A;  3P1D A;  2YW5 A;  4TZ2 A;  5C87 A;  5ACY A;  4NRA A;  3MUL A;  4CUP A;  3LJW A;  4TZ8 A;  5C7N A;  4YAX A;  4YC9 A;  5DLX A;  4J0R A;  5FFW A;  3JVL A;  4MR3 A;  5E73 A;  4TT6 A;  5ETD A;  5D3P A;  4YYG A;  4CFK A;  2OSS A;  4LZ2 A;  4QSU A;  2DWW A;  5E3D A;  3P5O A;  2YEM A;  5CFW A;  5CQ6 A;  5ENF A;  3SVH A;  5HRW A;  3U5L A;  4O72 A;  5EM3 A;  4NRB A;  3HMF A;  5E9K A;  5I40 A;  4FLP A;  4NR8 A;  4QYL A;  5TCM A;  4A9K A;  4NR7 A;  4YH3 A;  5FB1 A;  5C85 A;  3LQI A;  3P1E A;  4UYD A;  3JVJ A;  5LVQ A;  5FB0 A;  5FG6 A;  2YEL A;  5KHM A;  5KTX A;  4BJX A;  3FKM X;  1F68 A;  3AAD A;  4YYD A;  5HQ7 A;  5IGK A;  4LYW A;  5COI A;  4CL9 A;  5DW1 A;  3IU6 A;  4Y03 A;  5LJ2 A;  3MB4 A;  3ZYU A;  3O36 A;  5D25 A;  5E3G A;  4TT4 A;  5DW2 A;  5EV9 A;  5E9M A;  5A5O A;  2R0V A;  3UV4 A;  5KO4 A;  5CQT A;  5CQA A;  5EK9 A;  4UYE A;  4TT2 A;  4HBX A;  2YQD A;  5FE3 A;  4BHW A;  5LKT A;  5EPS A;  4QC3 A;  4X2I A;  5CUC A;  5A5R A;  4MEP A;  2F6J A;  4QSS A;  4CUQ A;  4YYK A;  5CU8 A;  5HEL A;  5ETB A;  5L97 A;  4XY9 A;  5DYU A;  5K29 A;  4A9F A;  4IOO A;  5AMF A;  4UIX A;  5D3T A;  2DKW A;  5EVA A;  5DFC A;  4J3I A;  4N3W A;  4O78 A;  3GG3 A;  4BW3 A;  5AD2 A;  5F63 A;  4TU4 A;  3O37 A;  5EQ1 A;  3S92 A;  2I7K A;  5DFB A;  2WP2 A;  5CUE A;  4QSQ A;  4IR5 A;  1E6I A;  2H60 A;  4UIV A;  4UIT A;  3O33 A;  5FE0 A;  2I8N A;  5EIS A;  3ONI A;  3UV5 A;  5C4Q A;  2DVV A;  2RNW A;  3D7C A;  2DAT A;  5FG5 A;  2E7O A;  5DY7 A;  5F1L A;  5L99 A;  3HME A;  5LJ1 A;  2L5E A;  5DYX A;  5FH7 A;  4DON A;  5FE6 A;  5LKZ A;  4QYD A;  4O7C A;  4QEW A;  5A83 A;  3DWY A;  4PKL A;  5FG4 A;  5CPE A;  3P1C A;  4J0S A;  5F60 A;  5FBX A;  1N72 A;  4YAD A;  3G0J A;  4KCX A;  3MB3 A;  1WUG A;  5F2P A;  4OUF A;  3G0L A;  5F62 A;  5D26 A;  5FFY A;  4A9L A;  2R0S A;  5CTL A;  5I88 A;  5IID A;  4RVR A;  5LUU A;  4YAB A;  4YYN A;  2RNX A;  4NR4 A;  5KTW A;  2GRC A;  4HXL A;  4QR5 A;  5A5P A;  4CUR A;  4GPJ A;  5FE5 A;  3MQM A;  4ZC9 A;  2YEK A;  4BW1 A;  4QEV A;  4A9H A;  2L84 A;  4UIZ A;  3MUK A;  4TTE A;  4LC2 A;  4YBM A;  5I89 A;  3AQA A;  2R0Y A;  4YBS A;  4NYV A;  5HFR A;  2DVR A;  4QEU A;  5F3A A;  5EWV A;  4HBY A;  1EQF A;  4YY4 A;  5I7X A;  3UVW A;  5F61 A;  5KTU A;  5I80 A;  3QZV A;  5CQ8 A;  4LRG A;  4O7B A;  5EU1 A;  4NRC A;  5ENG A;  4QY4 A;  2OUO A;  5DX4 A;  5D3L A;  4MEO A;  2E7N A;  4PCE A;  5DYA A;  5E9I A;  3U5N A;  4N4F A;  4Z93 A;  4F3I A;  4Z1Q A;  5H1T A;  5EI4 A;  4AKN A;  5IBN A;  4HXS A;  5A5Q A;  4WHU A;  5F25 A;  4BW2 A;  4QSP A;  5DLZ A; 
#chains in the Genus database with same CATH topology
 3UW9 A;  5TB6 A;  5EGU A;  4QSW A;  5EWD A;  5LKX A;  5EWH A;  5FE4 A;  1JSP B;  5EP7 A;  4NR9 A;  5CUA A;  5JWM A;  5FDZ A;  4NYX A;  2R10 A;  5CQ5 A;  5IGN A;  4O74 A;  5FFV A;  4BW4 A;  5IGL A;  3LQH A;  4MR5 A;  5DKD A;  3RCW A;  4YYJ A;  4WIV A;  4QR4 A;  5D3S A;  5E9L A;  5HEN A;  4MR4 A;  2RNY A;  5HFQ A;  4AKG A;  5G4R A;  5HRV A;  4NXJ A;  4HXK A;  4N4I A;  5FE8 A;  5CUD A;  3VKH A;  5C8G A;  4AKH A;  4PS5 A;  5CUB A;  5FE9 A;  5ENE A;  3UVX A;  5EA1 A;  5EWC A;  4KV1 A;  3JVM A;  5AME A;  5EPB A;  4A9I A;  5HQ6 A;  3U5M A;  4O7A A;  4PTB A;  4IR6 A;  4YAT A;  4LR6 A;  4YH4 A;  5ENC A;  2WP1 A;  5E7D A;  4QUT A;  4QBM A;  2MJV B;  5CUG A;  4N4G A;  4A9M A;  5LKU A;  3IU5 A;  4A9N A;  1X0J A;  3QZS A;  5L8U A;  4NUE A;  5I1Q A;  4QSX A;  4N4H A;  4QNS A;  5FE7 A;  5HRX A;  4UIY A;  2DVQ A;  5CRM A;  4ZW1 A;  5H85 A;  4LYS A;  5EWW A;  4QSR A;  3HMH A;  4IOQ A;  5A85 A;  5D0C A;  5D3R A;  4OGI A;  2N9G A;  5H1V A;  4J1P A;  3U5O A;  5E74 A;  4UYF B;  4NQM A;  4ZQL A;  2L85 A;  4O76 A;  5HM0 A;  5ENI A;  5EIC A;  4PY6 A;  1PUO A;  5ENB A;  4A9O A;  3SVF A;  3U5K A;  2KTB B;  5HEM A;  4CUU A;  4QUU A;  5BT4 A;  4TYL A;  3JVK A;  4Z6I A;  5F5Z A;  5F36 A;  1ZS5 A;  4HXR A;  3SVG A;  5DFD A;  5G4S A;  5L8T A;  3DAI A;  5CP5 A;  5FH8 A;  4XYA A;  4YYH A;  4MR6 A;  1WUM A;  4WHW A;  4CUT A;  4YYM A;  4PCI A;  3LQJ A;  4QC1 A;  5FE2 A;  4CUS A;  5CY9 A;  2YDW A;  4YK0 A;  5KU3 A;  5CQ4 A;  4Q0O A;  5HCL A;  1JM4 B;  5L98 A;  5A81 A;  5A7C A;  2RI7 A;  4NR6 A;  5CQ3 A;  4MEN A;  3ERR A;  2RS9 B;  5D7X A;  5I83 A;  5II1 A;  4XUB A;  4TU6 A;  5D3N A;  4HXN A;  4ALH A;  2D82 A;  4O71 A;  4A9J A;  4UYF A;  3Q2E A;  2D9E A;  4C66 A;  4Z1S A;  4QR3 A;  3P1F A;  2DVS A;  4HBW A;  4HXO A;  5L96 A;  4IR4 A;  5AD3 A;  5LVR A;  5FH6 A;  5I7Y A;  4TS8 A;  4Z6H A;  2LSP B;  5DKH A;  4HBV A;  5I29 A;  5ENH A;  2F6N A;  4IOR A;  5C89 A;  4O7F A;  4CLB A;  4XUA A;  5ENJ A;  2FSA A;  4TQN A;  5D3J A;  4OGJ A;  5HQ5 A;  2E3K A;  5II2 A;  3U5J A;  4UYG A;  4LYI A;  3O34 A;  2NXB A;  4QZS A;  4C67 A;  4QST A;  3UV2 A;  5IGM A;  4O75 A;  5D24 A;  4HXP A;  5CZG A;  5F1H A;  4YYI A;  5DYC A;  5CRZ A;  4UIU A;  2YYN A;  4HXM A;  5CS8 A;  5J0D A;  4UYH A;  4YBT A;  5A82 A;  5H1U A;  4NS5 A;  2OO1 A;  3LXJ A;  4NUC A;  4ALG A;  4E96 A;  4UIW A;  4CFL A;  5E0R A;  4YY6 A;  4LZS A;  5IG6 A;  5CGP A;  5HJC A;  5LJ0 A;  4A9E A;  2G4A A;  4MEQ A;  3VKG A;  4QB3 A;  5BT3 A;  4NQN A;  5HLS A;  2RFJ A;  3UVY A;  1ZKR A;  3I3J A;  5E9Y A;  4NR5 A;  3QZT A;  4NUD A;  4QSV A;  3TLP A;  3UVD A;  3NXB A;  3MXF A;  4NYW A;  4KV4 A;  5CQ7 A;  4O77 A;  5DBM A;  5JI8 A;  4Q0N A;  5I86 A;  4XY8 A;  4IR3 A;  5EPR A;  4LZR A;  5DKC A;  5A5N A;  3S91 A;  2RO1 A;  3O35 A;  3K2J A;  5D3H A;  4LDF A;  4O7E A;  5BT5 A;  5E9V A;  4O70 A;  3Q2F A;  5A5S A;  3U5P A;  5FE1 A;  3P1D A;  2YW5 A;  4TZ2 A;  5C87 A;  5ACY A;  4NRA A;  3MUL A;  4CUP A;  3LJW A;  4TZ8 A;  5C7N A;  3D1B A;  4YAX A;  4YC9 A;  5DLX A;  4J0R A;  5FFW A;  3JVL A;  4MR3 A;  5E73 A;  4TT6 A;  5ETD A;  5D3P A;  4YYG A;  4CFK A;  2OSS A;  4LZ2 A;  4QSU A;  2DWW A;  5E3D A;  3P5O A;  2YEM A;  5CFW A;  5CQ6 A;  5ENF A;  3SVH A;  5HRW A;  3U5L A;  4O72 A;  5EM3 A;  4NRB A;  3HMF A;  5E9K A;  5I40 A;  3D1D A;  4FLP A;  4NR8 A;  4QYL A;  5TCM A;  4A9K A;  4NR7 A;  4YH3 A;  5FB1 A;  5C85 A;  3LQI A;  3P1E A;  4UYD A;  3JVJ A;  5LVQ A;  5FB0 A;  5FG6 A;  2YEL A;  5KHM A;  5KTX A;  4BJX A;  3FKM X;  1F68 A;  3AAD A;  4YYD A;  5HQ7 A;  5IGK A;  4LYW A;  5COI A;  4CL9 A;  5DW1 A;  3IU6 A;  4Y03 A;  5LJ2 A;  3MB4 A;  3ZYU A;  3O36 A;  5D25 A;  5E3G A;  4TT4 A;  5DW2 A;  5EV9 A;  5E9M A;  5A5O A;  2R0V A;  3UV4 A;  5KO4 A;  5CQT A;  5CQA A;  5EK9 A;  4UYE A;  4TT2 A;  4HBX A;  2YQD A;  5FE3 A;  4BHW A;  5LKT A;  5EPS A;  4QC3 A;  4X2I A;  5CUC A;  5A5R A;  4MEP A;  2F6J A;  4QSS A;  4CUQ A;  4YYK A;  5CU8 A;  5HEL A;  5ETB A;  5L97 A;  4XY9 A;  5DYU A;  5K29 A;  4A9F A;  4IOO A;  5AMF A;  4UIX A;  5D3T A;  2DKW A;  5EVA A;  5DFC A;  4J3I A;  4N3W A;  4O78 A;  3GG3 A;  4BW3 A;  5AD2 A;  5F63 A;  4TU4 A;  3O37 A;  5EQ1 A;  3S92 A;  2I7K A;  5DFB A;  2WP2 A;  5CUE A;  4QSQ A;  4IR5 A;  1E6I A;  2H60 A;  4UIV A;  4UIT A;  3O33 A;  5FE0 A;  2I8N A;  5EIS A;  3ONI A;  3UV5 A;  5C4Q A;  2DVV A;  2RNW A;  3D7C A;  2DAT A;  5FG5 A;  2E7O A;  5DY7 A;  5F1L A;  5L99 A;  3HME A;  5LJ1 A;  2L5E A;  5DYX A;  5FH7 A;  4DON A;  5FE6 A;  5LKZ A;  4QYD A;  4O7C A;  4QEW A;  5A83 A;  3DWY A;  4PKL A;  5FG4 A;  5CPE A;  3P1C A;  4J0S A;  5F60 A;  5FBX A;  1N72 A;  4YAD A;  3G0J A;  4KCX A;  3MB3 A;  1WUG A;  5F2P A;  4OUF A;  3G0L A;  5F62 A;  5D26 A;  5FFY A;  4A9L A;  2R0S A;  5CTL A;  5I88 A;  5IID A;  4RVR A;  5LUU A;  4YAB A;  4YYN A;  2RNX A;  4NR4 A;  5KTW A;  2GRC A;  4HXL A;  4QR5 A;  5A5P A;  4CUR A;  4GPJ A;  5FE5 A;  3MQM A;  4ZC9 A;  2YEK A;  4BW1 A;  4QEV A;  4A9H A;  2L84 A;  4UIZ A;  3MUK A;  4TTE A;  4LC2 A;  4YBM A;  5I89 A;  3AQA A;  2R0Y A;  4YBS A;  4NYV A;  5HFR A;  2DVR A;  4QEU A;  5F3A A;  5EWV A;  4AI6 A;  4HBY A;  1EQF A;  4YY4 A;  5I7X A;  3UVW A;  5F61 A;  5KTU A;  5I80 A;  3QZV A;  5CQ8 A;  4LRG A;  4O7B A;  5EU1 A;  2EJN A;  4NRC A;  5ENG A;  4QY4 A;  2OUO A;  4AKI A;  5DX4 A;  5D3L A;  4MEO A;  2E7N A;  4PCE A;  5DYA A;  5E9I A;  3U5N A;  4N4F A;  4Z93 A;  4F3I A;  4Z1Q A;  5H1T A;  5EI4 A;  4AKN A;  5IBN A;  4HXS A;  5A5Q A;  4WHU A;  5F25 A;  4BW2 A;  4QSP A;  5DLZ A; 
#chains in the Genus database with same CATH homology
 3UW9 A;  5TB6 A;  5EGU A;  4QSW A;  5EWD A;  5LKX A;  5EWH A;  5FE4 A;  1JSP B;  5EP7 A;  4NR9 A;  5CUA A;  5JWM A;  5FDZ A;  4NYX A;  2R10 A;  5CQ5 A;  5IGN A;  4O74 A;  5FFV A;  4BW4 A;  5IGL A;  3LQH A;  4MR5 A;  5DKD A;  3RCW A;  4YYJ A;  4WIV A;  4QR4 A;  5D3S A;  5E9L A;  5HEN A;  4MR4 A;  2RNY A;  5HFQ A;  5G4R A;  5HRV A;  4NXJ A;  4HXK A;  4N4I A;  5FE8 A;  5CUD A;  5C8G A;  4PS5 A;  5CUB A;  5FE9 A;  5ENE A;  3UVX A;  5EA1 A;  5EWC A;  4KV1 A;  3JVM A;  5AME A;  5EPB A;  4A9I A;  5HQ6 A;  3U5M A;  4O7A A;  4PTB A;  4IR6 A;  4YAT A;  4LR6 A;  4YH4 A;  5ENC A;  2WP1 A;  5E7D A;  4QUT A;  4QBM A;  2MJV B;  5CUG A;  4N4G A;  4A9M A;  5LKU A;  3IU5 A;  4A9N A;  1X0J A;  3QZS A;  5L8U A;  4NUE A;  5I1Q A;  4QSX A;  4N4H A;  4QNS A;  5FE7 A;  5HRX A;  4UIY A;  2DVQ A;  5CRM A;  4ZW1 A;  5H85 A;  4LYS A;  5EWW A;  4QSR A;  3HMH A;  4IOQ A;  5A85 A;  5D0C A;  5D3R A;  4OGI A;  2N9G A;  5H1V A;  4J1P A;  3U5O A;  5E74 A;  4UYF B;  4NQM A;  4ZQL A;  2L85 A;  4O76 A;  5HM0 A;  5ENI A;  5EIC A;  4PY6 A;  5ENB A;  4A9O A;  3SVF A;  3U5K A;  2KTB B;  5HEM A;  4CUU A;  4QUU A;  5BT4 A;  4TYL A;  3JVK A;  4Z6I A;  5F5Z A;  5F36 A;  1ZS5 A;  4HXR A;  3SVG A;  5DFD A;  5G4S A;  5L8T A;  3DAI A;  5CP5 A;  5FH8 A;  4XYA A;  4YYH A;  4MR6 A;  1WUM A;  4WHW A;  4CUT A;  4YYM A;  4PCI A;  3LQJ A;  4QC1 A;  5FE2 A;  4CUS A;  5CY9 A;  2YDW A;  4YK0 A;  5KU3 A;  5CQ4 A;  4Q0O A;  5HCL A;  1JM4 B;  5L98 A;  5A81 A;  5A7C A;  2RI7 A;  4NR6 A;  5CQ3 A;  4MEN A;  5I83 A;  2RS9 B;  5D7X A;  5II1 A;  4XUB A;  4TU6 A;  5D3N A;  4HXN A;  4ALH A;  2D82 A;  4O71 A;  4A9J A;  4UYF A;  3Q2E A;  2D9E A;  4C66 A;  4Z1S A;  4QR3 A;  3P1F A;  2DVS A;  4HBW A;  4HXO A;  5L96 A;  4IR4 A;  5AD3 A;  5LVR A;  5FH6 A;  5I7Y A;  4TS8 A;  4Z6H A;  2LSP B;  5DKH A;  4HBV A;  5I29 A;  5ENH A;  2F6N A;  4IOR A;  5C89 A;  4O7F A;  4CLB A;  4XUA A;  5ENJ A;  2FSA A;  4TQN A;  5D3J A;  4OGJ A;  5HQ5 A;  2E3K A;  5II2 A;  3U5J A;  4UYG A;  4LYI A;  3O34 A;  2NXB A;  4QZS A;  4C67 A;  4QST A;  3UV2 A;  5IGM A;  4O75 A;  5D24 A;  4HXP A;  5CZG A;  5F1H A;  4YYI A;  5DYC A;  5CRZ A;  4UIU A;  2YYN A;  4HXM A;  5CS8 A;  5J0D A;  4UYH A;  4YBT A;  5A82 A;  5H1U A;  4NS5 A;  2OO1 A;  3LXJ A;  4NUC A;  4ALG A;  4E96 A;  4UIW A;  4CFL A;  5E0R A;  4YY6 A;  4LZS A;  5IG6 A;  5CGP A;  5HJC A;  5LJ0 A;  4A9E A;  2G4A A;  4MEQ A;  4QB3 A;  5BT3 A;  4NQN A;  5HLS A;  2RFJ A;  3UVY A;  3I3J A;  5E9Y A;  4NR5 A;  3QZT A;  4NUD A;  4QSV A;  3TLP A;  3UVD A;  3NXB A;  3MXF A;  4NYW A;  4KV4 A;  5CQ7 A;  4O77 A;  5DBM A;  5JI8 A;  4Q0N A;  5I86 A;  4XY8 A;  4IR3 A;  5EPR A;  4LZR A;  5DKC A;  5A5N A;  3S91 A;  2RO1 A;  3O35 A;  3K2J A;  5D3H A;  4LDF A;  4O7E A;  5BT5 A;  5E9V A;  4O70 A;  3Q2F A;  5A5S A;  3U5P A;  5FE1 A;  3P1D A;  2YW5 A;  4TZ2 A;  5C87 A;  5ACY A;  4NRA A;  3MUL A;  4CUP A;  3LJW A;  4TZ8 A;  5C7N A;  4YAX A;  4YC9 A;  5DLX A;  4J0R A;  5FFW A;  3JVL A;  4MR3 A;  5E73 A;  4TT6 A;  5ETD A;  5D3P A;  4YYG A;  4CFK A;  2OSS A;  4LZ2 A;  4QSU A;  2DWW A;  5E3D A;  3P5O A;  2YEM A;  5CFW A;  5CQ6 A;  5ENF A;  3SVH A;  5HRW A;  3U5L A;  4O72 A;  5EM3 A;  4NRB A;  3HMF A;  5E9K A;  5I40 A;  4FLP A;  4NR8 A;  4QYL A;  5TCM A;  4A9K A;  4NR7 A;  4YH3 A;  5FB1 A;  5C85 A;  3LQI A;  3P1E A;  4UYD A;  3JVJ A;  5LVQ A;  5FB0 A;  5FG6 A;  2YEL A;  5KHM A;  5KTX A;  4BJX A;  3FKM X;  1F68 A;  3AAD A;  4YYD A;  5HQ7 A;  5IGK A;  4LYW A;  5COI A;  4CL9 A;  5DW1 A;  3IU6 A;  4Y03 A;  5LJ2 A;  3MB4 A;  3ZYU A;  3O36 A;  5D25 A;  5E3G A;  4TT4 A;  5DW2 A;  5EV9 A;  5E9M A;  5A5O A;  2R0V A;  3UV4 A;  5KO4 A;  5CQT A;  5CQA A;  5EK9 A;  4UYE A;  4TT2 A;  4HBX A;  2YQD A;  5FE3 A;  4BHW A;  5LKT A;  5EPS A;  4QC3 A;  4X2I A;  5CUC A;  5A5R A;  4MEP A;  2F6J A;  4QSS A;  4CUQ A;  4YYK A;  5CU8 A;  5HEL A;  5ETB A;  5L97 A;  4XY9 A;  5DYU A;  5K29 A;  4A9F A;  4IOO A;  5AMF A;  4UIX A;  5D3T A;  2DKW A;  5EVA A;  5DFC A;  4J3I A;  4N3W A;  4O78 A;  3GG3 A;  4BW3 A;  5AD2 A;  5F63 A;  4TU4 A;  3O37 A;  5EQ1 A;  3S92 A;  2I7K A;  5DFB A;  2WP2 A;  5CUE A;  4QSQ A;  4IR5 A;  1E6I A;  2H60 A;  4UIV A;  4UIT A;  3O33 A;  5FE0 A;  2I8N A;  5EIS A;  3ONI A;  3UV5 A;  5C4Q A;  2DVV A;  2RNW A;  3D7C A;  2DAT A;  5FG5 A;  2E7O A;  5DY7 A;  5F1L A;  5L99 A;  3HME A;  5LJ1 A;  2L5E A;  5DYX A;  5FH7 A;  4DON A;  5FE6 A;  5LKZ A;  4QYD A;  4O7C A;  4QEW A;  5A83 A;  3DWY A;  4PKL A;  5FG4 A;  5CPE A;  3P1C A;  4J0S A;  5F60 A;  5FBX A;  1N72 A;  4YAD A;  3G0J A;  4KCX A;  3MB3 A;  1WUG A;  5F2P A;  4OUF A;  3G0L A;  5F62 A;  5D26 A;  5FFY A;  4A9L A;  2R0S A;  5CTL A;  5I88 A;  5IID A;  4RVR A;  5LUU A;  4YAB A;  4YYN A;  2RNX A;  4NR4 A;  5KTW A;  2GRC A;  4HXL A;  4QR5 A;  5A5P A;  4CUR A;  4GPJ A;  5FE5 A;  3MQM A;  4ZC9 A;  2YEK A;  4BW1 A;  4QEV A;  4A9H A;  2L84 A;  4UIZ A;  3MUK A;  4TTE A;  4LC2 A;  4YBM A;  5I89 A;  3AQA A;  2R0Y A;  4YBS A;  4NYV A;  5HFR A;  2DVR A;  4QEU A;  5F3A A;  5EWV A;  4HBY A;  1EQF A;  4YY4 A;  5I7X A;  3UVW A;  5F61 A;  5KTU A;  5I80 A;  3QZV A;  5CQ8 A;  4LRG A;  4O7B A;  5EU1 A;  4NRC A;  5ENG A;  4QY4 A;  2OUO A;  5DX4 A;  5D3L A;  4MEO A;  2E7N A;  4PCE A;  5DYA A;  5E9I A;  3U5N A;  4N4F A;  4Z93 A;  4F3I A;  4Z1Q A;  5H1T A;  5EI4 A;  4AKN A;  5IBN A;  4HXS A;  5A5Q A;  4WHU A;  5F25 A;  4BW2 A;  4QSP A;  5DLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...