1F68A

Nmr solution structure of the bromodomain from human gcn5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
103
structure length
103
Chain Sequence
GDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HISTONE ACETYLTRANSFERASE
publication title Solution structure and acetyl-lysine binding activity of the GCN5 bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 103
sequence length 103
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1f68A00
3P1CA 3LXJA 4ZC9A 4QEVA 4CUTA 5C8GA 4BW1A 4QSVA 4QBMA 5FE0A 5KO4A 4TZ2A 5LJ1A 5E74A 4J0SA 4Z1SA 5E3GA 5D3TA 5D3LA 5EPBA 4UITA 3HMHA 4O7FA 5CUEA 4XUAA 5A5SA 4RVRA 4TYLA 5CUCA 4UIVA 2RFJA 4ALHA 4NR5A 5A81A 5D24A 4YBSA 3MXFA 4QYLA 4PTBA 5BT3A 5I89A 4NYVA 3SVHA 1E6IA 5FE6A 3QZSA 3DAIA 4LZRA 5LJ2A 4HXSA 5AD2A 5I29A 5CQ8A 4YATA 4QEUA 4YYKA 5FH6A 4J0RA 4N4FA 2OSSA 5II1A 5II2A 4ZQLA 1ZS5A 3JVKA 5E7DA 5D0CA 4NYXA 5L99A 5CUBA 3MQMA 3TLPA 5LVQA 4Z1QA 5HRXA 3FKMX 2I7KA 4MEPA 4TT6A 5KHMA 3HMEA 5C89A 4NR9A 5HLSA 3DWYA 5CRZA 5H1UA 3RCWA 5A5RA 3U5NA 5A5PA 5FFWA 5E9YA 5CUAA 3I3JA 5CP5A 1EQFA 3UV5A 5D25A 4IR5A 4HXPA 4O72A 4N4IA 4NUDA 2RNYA 4TQNA 5D3NA 5ENIA 5FH8A 4A9HA 3UW9A 3NXBA 5E3DA 5G4RA 4UIXA 4TTEA 2OUOA 4NRAA 2DVQA 5E0RA 5LKTA 4LZSA 4UYFB 3U5MA 3U5OA 5D7XA 2YELA 4MR6A 4J1PA 4MR3A 2YYNA 5G4SA 3MUKA 5HJCA 4XY8A 4YAXA 5FG4A 4AKNA 3P1FA 4YYDA 4IR6A 5DLZA 4HXMA 4QUUA 5FE9A 3JVJA 5CFWA 4HBXA 4A9LA 4NRBA 4A9FA 5FG5A 4QUTA 4QZSA 4A9NA 3U5JA 2D9EA 2N9GA 5CPEA 5FE2A 5HENA 5I80A 5E9IA 4CUUA 4YY6A 2R0YA 5ETBA 2E3KA 4HBYA 5FDZA 5FE1A 5DKDA 5EU1A 2NXBA 3U5KA 4NQMA 5D3RA 5CZGA 4O7CA 4XYAA 2DVVA 5HM0A 5K29A 5IBNA 2MJVB 3GG3A 5FH7A 5CU8A 1JSPB 2DVSA 4LDFA 2OO1A 4WHWA 5F1HA 2RI7A 2G4AA 4CFKA 5JI8A 2YEKA 5I7XA 1WUGA 5FE8A 5AMFA 3AADA 2DWWA 4QY4A 2GRCA 5C7NA 4Q0OA 5A7CA 5A5NA 5E9LA 4BJXA 4NRCA 5C87A 5EWDA 5DW1A 5HFRA 4O76A 4TU6A 4HXNA 4YH3A 4HBVA 4ALGA 5BT5A 5DFCA 4HXRA 4C67A 2H60A 5HCLA 5E73A 5H1TA 5HELA 4QR3A 4QC3A 4BHWA 4IORA 4X2IA 5C85A 4TT2A 5L8UA 3O36A 3MB4A 5F60A 4LYIA 2WP1A 3K2JA 4O7BA 5HFQA 4NR6A 2R10A 4YYIA 5IIDA 5DKCA 5CQ6A 4TT4A 5EISA 3SVFA 4Z6IA 4CURA 5JWMA 4NR4A 5F36A 5LKUA 3O35A 5F61A 5E9KA 4TU4A 2L84A 5EPRA 5EV9A 3U5PA 2DVRA 4YH4A 5F3AA 5I83A 4IOOA 4YY4A 5LKZA 2WP2A 4PCIA 4YYMA 4NR8A 3G0JA 4A9IA 5CUGA 4YYHA 5COIA 5F1LA 5I7YA 3JVMA 4QSSA 5FFVA 4UYDA 3UVXA 1WUMA 4QSPA 5KTUA 5L97A 4CL9A 4YC9A 3HMFA 1X0JA 5D3SA 5EWWA 5DYAA 4QSXA 5ENCA 5KTXA 5DKHA 5FE7A 5DFDA 4QSUA 4WIVA 4DONA 5FG6A 5FE4A 2E7OA 5EGUA 3S91A 4F3IA 2RO1A 4Y03A 5I86A 4BW3A 3D7CA 3Q2EA 4O78A 4YYJA 5HQ7A 5EQ1A 5H85A 5TB6A 5HQ6A 2R0SA 5EVAA 4QR5A 5EPSA 4E96A 3UVYA 3ZYUA 5ENHA 4MEOA 2DATA 4UIZA 2KTBB 5CQTA 2YW5A 5A5OA 3P5OA 2LSPB 3O37A 5IG6A 3LJWA 5D3HA 2R0VA 4TS8A 4OGJA 4UYFA 5FE3A 3UVWA 4MR4A 5EA1A 4LYWA 5DW2A 2E7NA 1N72A 5L98A 5HEMA 5EK9A 5AMEA 2YDWA 3QZTA 5LUUA 5A82A 2DKWA 4A9MA 5IGLA 4QB3A 5FB0A 5HRWA 4YK0A 3MB3A 4UYGA 5DLXA 2D82A 4UIYA 4BW2A 4YABA 5CQ3A 5EI4A 4O7AA 5DYXA 5ACYA 4N3WA 4C66A 4LZ2A 5IGMA 3QZVA 5DFBA 5EWHA 5EP7A 5FBXA 4ZW1A 3LQHA 5BT4A 5F2PA 3G0LA 4N4HA 3IU5A 1JM4B 3AQAA 5E9VA 5EWVA 4QSTA 3UV4A 3IU6A 2L5EA 4PS5A 4KV1A 4NYWA 4QR4A 4HBWA 4CLBA 4QC1A 4NUCA 3MULA 3JVLA 4PY6A 3SVGA 5HRVA 4UIWA 4LR6A 4MENA 5FB1A 5D3PA 3Q2FA 4J3IA 4O70A 5L96A 4OGIA 4IR3A 4HXLA 4UIUA 3S92A 5IGKA 4NS5A 5ENFA 5HQ5A 5D26A 4QSQA 5DX4A 2F6NA 5DY7A 4O74A 5TCMA 5I40A 4O75A 3UVDA 4XY9A 4A9KA 5CY9A 4O7EA 5I1QA 3O34A 5ENJA 4BW4A 5CGPA 5A5QA 5CQ5A 5FFYA 5CQAA 5KTWA 5ETDA 5ENEA 4WHUA 4Z6HA 2RS9B 5LJ0A 4UYHA 5F5ZA 4YBMA 5LKXA 5DBMA 3LQIA 4LC2A 4KCXA 5FE5A 4NQNA 4NUEA 5CUDA 2YQDA 4O71A 5F63A 4IOQA 4NR7A 4XUBA 4IR4A 5AD3A 4N4GA 5F25A 5J0DA 4OUFA 5ENBA 4QSRA 5I88A 4QEWA 4UYEA 2RNXA 4MEQA 5KU3A 5A85A 5IGNA 4PCEA 5ENGA 5C4QA 5EM3A 4CFLA 1F68A 4A9EA 4CUSA 2L85A 5CS8A 4QSWA 3U5LA 5DYCA 4YYNA 4QNSA 5CTLA 4LRGA 4TZ8A 3LQJA 5EWCA 5H1VA 4GPJA 4HXOA 2I8NA 4QYDA 4YYGA 4CUQA 5CRMA 3P1DA 2YEMA 4O77A 4Q0NA 4YBTA 5DYUA 3ONIA 4PKLA 4CUPA 4A9OA 5CQ4A 2RNWA 2F6JA 5E9MA 5EICA 3P1EA 5D3JA 4YADA 2FSAA 3UV2A 4LYSA 4KV4A 4HXKA 5LVRA 4A9JA 4FLPA 5F62A 4NXJA 5L8TA 4MR5A 3O33A 5A83A 4Z93A 5CQ7A
chains in the Genus database with same CATH superfamily
3P1CA 3LXJA 4ZC9A 4QEVA 4CUTA 5C8GA 4BW1A 4QSVA 4QBMA 5FE0A 2EJNA 5KO4A 4TZ2A 5LJ1A 5E74A 4J0SA 4Z1SA 5E3GA 5D3TA 5D3LA 5EPBA 4UITA 3HMHA 4O7FA 5CUEA 4XUAA 5A5SA 4RVRA 4TYLA 5CUCA 4UIVA 2RFJA 4ALHA 4NR5A 5A81A 5D24A 4YBSA 3MXFA 4QYLA 4PTBA 5BT3A 5I89A 4NYVA 3SVHA 1E6IA 5FE6A 3QZSA 3DAIA 4LZRA 5LJ2A 4HXSA 5AD2A 5I29A 5CQ8A 4YATA 4QEUA 4YYKA 5FH6A 4J0RA 4N4FA 2OSSA 5II1A 5II2A 4ZQLA 1ZS5A 3JVKA 5E7DA 5D0CA 4NYXA 5L99A 5CUBA 3ERRA 3MQMA 3TLPA 5LVQA 4Z1QA 5HRXA 3FKMX 2I7KA 4MEPA 4TT6A 5KHMA 3HMEA 5C89A 4NR9A 5HLSA 3DWYA 5CRZA 5H1UA 3RCWA 5A5RA 3U5NA 5A5PA 5FFWA 5E9YA 5CUAA 3I3JA 5CP5A 1EQFA 3UV5A 5D25A 4IR5A 4HXPA 4O72A 4N4IA 4NUDA 2RNYA 4TQNA 5D3NA 5ENIA 5FH8A 4A9HA 3UW9A 3NXBA 5E3DA 5G4RA 4UIXA 4TTEA 2OUOA 4NRAA 2DVQA 5E0RA 5LKTA 4LZSA 4UYFB 3U5MA 3U5OA 5D7XA 2YELA 4MR6A 4J1PA 4MR3A 2YYNA 5G4SA 3MUKA 5HJCA 4XY8A 4YAXA 5FG4A 4AKNA 3P1FA 4YYDA 4IR6A 5DLZA 4HXMA 4QUUA 5FE9A 3JVJA 5CFWA 4HBXA 4A9LA 4NRBA 4A9FA 5FG5A 4QUTA 4QZSA 4A9NA 3U5JA 2D9EA 2N9GA 5CPEA 5FE2A 5HENA 5I80A 5E9IA 4CUUA 4YY6A 2R0YA 5ETBA 2E3KA 4HBYA 5FDZA 5FE1A 5DKDA 5EU1A 2NXBA 3U5KA 4NQMA 5D3RA 5CZGA 4O7CA 4XYAA 2DVVA 5HM0A 5K29A 5IBNA 2MJVB 3GG3A 5FH7A 5CU8A 1JSPB 2DVSA 4LDFA 2OO1A 4WHWA 5F1HA 2RI7A 2G4AA 4CFKA 5JI8A 2YEKA 5I7XA 1WUGA 5FE8A 5AMFA 3AADA 2DWWA 4QY4A 2GRCA 5C7NA 4Q0OA 5A7CA 5A5NA 5E9LA 4BJXA 4NRCA 5C87A 5EWDA 5DW1A 5HFRA 4O76A 4TU6A 4HXNA 4YH3A 4HBVA 4ALGA 5BT5A 5DFCA 4HXRA 4C67A 2H60A 5HCLA 5E73A 5H1TA 5HELA 4QR3A 4QC3A 4BHWA 4IORA 4X2IA 3D1DA 4TT2A 5C85A 5L8UA 3O36A 3MB4A 5F60A 4LYIA 2WP1A 3K2JA 4O7BA 5HFQA 4NR6A 2R10A 4YYIA 5IIDA 5DKCA 5CQ6A 4TT4A 5EISA 3SVFA 4Z6IA 4CURA 5JWMA 4NR4A 5F36A 5LKUA 3O35A 5F61A 5E9KA 4TU4A 2L84A 5EPRA 5EV9A 3U5PA 2DVRA 4YH4A 5F3AA 5I83A 4IOOA 4YY4A 5LKZA 2WP2A 4PCIA 4YYMA 4NR8A 3G0JA 4A9IA 5CUGA 4YYHA 5COIA 5F1LA 5I7YA 3JVMA 4QSSA 5FFVA 4UYDA 3UVXA 1WUMA 4QSPA 5KTUA 5L97A 4CL9A 4YC9A 3HMFA 1X0JA 5D3SA 5EWWA 5DYAA 4QSXA 5ENCA 5KTXA 5DKHA 5FE7A 5DFDA 4QSUA 4WIVA 4DONA 5FG6A 5FE4A 2E7OA 5EGUA 3S91A 4F3IA 4AKIA 2RO1A 4Y03A 5I86A 4BW3A 3D7CA 3Q2EA 4O78A 4YYJA 5HQ7A 5EQ1A 5H85A 5TB6A 5HQ6A 2R0SA 5EVAA 4QR5A 5EPSA 3VKGA 4E96A 3UVYA 3ZYUA 5ENHA 4MEOA 2DATA 4UIZA 2KTBB 5CQTA 2YW5A 5A5OA 3P5OA 2LSPB 3O37A 5IG6A 3LJWA 5D3HA 2R0VA 4TS8A 4OGJA 4UYFA 5FE3A 3UVWA 4MR4A 5EA1A 4LYWA 5DW2A 2E7NA 1N72A 5L98A 5HEMA 5EK9A 5AMEA 2YDWA 3QZTA 5LUUA 5A82A 2DKWA 4A9MA 5IGLA 4QB3A 5FB0A 5HRWA 4YK0A 3MB3A 4UYGA 1PUOA 5DLXA 2D82A 4UIYA 4BW2A 4YABA 5CQ3A 5EI4A 4O7AA 5DYXA 5ACYA 4N3WA 4C66A 4LZ2A 5IGMA 3QZVA 5DFBA 5EWHA 5EP7A 5FBXA 4ZW1A 3LQHA 5BT4A 5F2PA 3G0LA 4N4HA 1ZKRA 3IU5A 1JM4B 3AQAA 5E9VA 5EWVA 4QSTA 3UV4A 3IU6A 2L5EA 4PS5A 3D1BA 4KV1A 4NYWA 4QR4A 4HBWA 4CLBA 4QC1A 4NUCA 3MULA 3JVLA 4PY6A 3SVGA 5HRVA 4UIWA 4LR6A 4MENA 5FB1A 5D3PA 3Q2FA 4J3IA 4O70A 5L96A 4OGIA 4IR3A 4HXLA 4UIUA 3S92A 5IGKA 4NS5A 5ENFA 5HQ5A 5D26A 4QSQA 5DX4A 2F6NA 5DY7A 4O74A 5TCMA 5I40A 4O75A 3UVDA 4XY9A 4A9KA 5CY9A 4O7EA 5I1QA 3O34A 5ENJA 3VKHA 4BW4A 5CGPA 5A5QA 5CQ5A 5FFYA 5CQAA 5KTWA 5ETDA 5ENEA 4WHUA 4Z6HA 2RS9B 5LJ0A 4UYHA 5F5ZA 4YBMA 5LKXA 5DBMA 3LQIA 4LC2A 4KCXA 5FE5A 4NQNA 4NUEA 5CUDA 2YQDA 4O71A 5F63A 4IOQA 4NR7A 4XUBA 4IR4A 5AD3A 4N4GA 5F25A 5J0DA 4OUFA 5ENBA 4QSRA 5I88A 4AI6A 4QEWA 4UYEA 2RNXA 4MEQA 5KU3A 4AKGA 5A85A 5IGNA 4PCEA 5ENGA 5C4QA 5EM3A 4CFLA 1F68A 4A9EA 4CUSA 2L85A 5CS8A 4QSWA 3U5LA 5DYCA 4YYNA 4QNSA 5CTLA 4LRGA 4TZ8A 3LQJA 5EWCA 5H1VA 4GPJA 4HXOA 2I8NA 4QYDA 4YYGA 4CUQA 4AKHA 5CRMA 3P1DA 2YEMA 4O77A 4Q0NA 4YBTA 5DYUA 3ONIA 4PKLA 4CUPA 4A9OA 5CQ4A 2RNWA 2F6JA 5E9MA 5EICA 3P1EA 5D3JA 4YADA 2FSAA 3UV2A 4LYSA 4KV4A 4HXKA 5LVRA 4A9JA 4FLPA 5F62A 4NXJA 5L8TA 4MR5A 3O33A 5A83A 4Z93A 5CQ7A
chains in the Genus database with same CATH topology
3P1CA 3LXJA 4ZC9A 4QEVA 4CUTA 5C8GA 4BW1A 4QSVA 4QBMA 5FE0A 5KO4A 4TZ2A 5LJ1A 5E74A 4J0SA 4Z1SA 5E3GA 5D3TA 5D3LA 5EPBA 4UITA 3HMHA 4O7FA 5CUEA 4XUAA 5A5SA 4RVRA 4TYLA 5CUCA 4UIVA 2RFJA 4ALHA 4NR5A 5A81A 5D24A 4YBSA 3MXFA 4QYLA 4PTBA 5BT3A 5I89A 4NYVA 3SVHA 1E6IA 5FE6A 3QZSA 3DAIA 4LZRA 5LJ2A 4HXSA 5AD2A 5I29A 5CQ8A 4YATA 4QEUA 4YYKA 5FH6A 4J0RA 4N4FA 2OSSA 5II1A 5II2A 4ZQLA 1ZS5A 3JVKA 5E7DA 5D0CA 4NYXA 5L99A 5CUBA 3MQMA 3TLPA 5LVQA 4Z1QA 5HRXA 3FKMX 2I7KA 4MEPA 4TT6A 5KHMA 3HMEA 5C89A 4NR9A 5HLSA 3DWYA 5CRZA 5H1UA 3RCWA 5A5RA 3U5NA 5A5PA 5FFWA 5E9YA 5CUAA 3I3JA 5CP5A 1EQFA 3UV5A 5D25A 4IR5A 4HXPA 4O72A 4N4IA 4NUDA 2RNYA 4TQNA 5D3NA 5ENIA 5FH8A 4A9HA 3UW9A 3NXBA 5E3DA 5G4RA 4UIXA 4TTEA 2OUOA 4NRAA 2DVQA 5E0RA 5LKTA 4LZSA 4UYFB 3U5MA 3U5OA 5D7XA 2YELA 4MR6A 4J1PA 4MR3A 2YYNA 5G4SA 3MUKA 5HJCA 4XY8A 4YAXA 5FG4A 4AKNA 3P1FA 4YYDA 4IR6A 5DLZA 4HXMA 4QUUA 5FE9A 3JVJA 5CFWA 4HBXA 4A9LA 4NRBA 4A9FA 5FG5A 4QUTA 4QZSA 4A9NA 3U5JA 2D9EA 2N9GA 5CPEA 5FE2A 5HENA 5I80A 5E9IA 4CUUA 4YY6A 2R0YA 5ETBA 2E3KA 4HBYA 5FDZA 5FE1A 5DKDA 5EU1A 2NXBA 3U5KA 4NQMA 5D3RA 5CZGA 4O7CA 4XYAA 2DVVA 5HM0A 5K29A 5IBNA 2MJVB 3GG3A 5FH7A 5CU8A 1JSPB 2DVSA 4LDFA 2OO1A 4WHWA 5F1HA 2RI7A 2G4AA 4CFKA 5JI8A 2YEKA 5I7XA 1WUGA 5FE8A 5AMFA 3AADA 2DWWA 4QY4A 2GRCA 5C7NA 4Q0OA 5A7CA 5A5NA 5E9LA 4BJXA 4NRCA 5C87A 5EWDA 5DW1A 5HFRA 4O76A 4TU6A 4HXNA 4YH3A 4HBVA 4ALGA 5BT5A 5DFCA 4HXRA 4C67A 2H60A 5HCLA 5E73A 5H1TA 5HELA 4QR3A 4QC3A 4BHWA 4IORA 4X2IA 5C85A 4TT2A 5L8UA 3O36A 3MB4A 5F60A 4LYIA 2WP1A 3K2JA 4O7BA 5HFQA 4NR6A 2R10A 4YYIA 5IIDA 5DKCA 5CQ6A 4TT4A 5EISA 3SVFA 4Z6IA 4CURA 5JWMA 4NR4A 5F36A 5LKUA 3O35A 5F61A 5E9KA 4TU4A 2L84A 5EPRA 5EV9A 3U5PA 2DVRA 4YH4A 5F3AA 5I83A 4IOOA 4YY4A 5LKZA 2WP2A 4PCIA 4YYMA 4NR8A 3G0JA 4A9IA 5CUGA 4YYHA 5COIA 5F1LA 5I7YA 3JVMA 4QSSA 5FFVA 4UYDA 3UVXA 1WUMA 4QSPA 5KTUA 5L97A 4CL9A 4YC9A 3HMFA 1X0JA 5D3SA 5EWWA 5DYAA 4QSXA 5ENCA 5KTXA 5DKHA 5FE7A 5DFDA 4QSUA 4WIVA 4DONA 5FG6A 5FE4A 2E7OA 5EGUA 3S91A 4F3IA 2RO1A 4Y03A 5I86A 4BW3A 3D7CA 3Q2EA 4O78A 4YYJA 5HQ7A 5EQ1A 5H85A 5TB6A 5HQ6A 2R0SA 5EVAA 4QR5A 5EPSA 4E96A 3UVYA 3ZYUA 5ENHA 4MEOA 2DATA 4UIZA 2KTBB 5CQTA 2YW5A 5A5OA 3P5OA 2LSPB 3O37A 5IG6A 3LJWA 5D3HA 2R0VA 4TS8A 4OGJA 4UYFA 5FE3A 3UVWA 4MR4A 5EA1A 4LYWA 5DW2A 2E7NA 1N72A 5L98A 5HEMA 5EK9A 5AMEA 2YDWA 3QZTA 5LUUA 5A82A 2DKWA 4A9MA 5IGLA 4QB3A 5FB0A 5HRWA 4YK0A 3MB3A 4UYGA 5DLXA 2D82A 4UIYA 4BW2A 4YABA 5CQ3A 5EI4A 4O7AA 5DYXA 5ACYA 4N3WA 4C66A 4LZ2A 5IGMA 3QZVA 5DFBA 5EWHA 5EP7A 5FBXA 4ZW1A 3LQHA 5BT4A 5F2PA 3G0LA 4N4HA 3IU5A 1JM4B 3AQAA 5E9VA 5EWVA 4QSTA 3UV4A 3IU6A 2L5EA 4PS5A 4KV1A 4NYWA 4QR4A 4HBWA 4CLBA 4QC1A 4NUCA 3MULA 3JVLA 4PY6A 3SVGA 5HRVA 4UIWA 4LR6A 4MENA 5FB1A 5D3PA 3Q2FA 4J3IA 4O70A 5L96A 4OGIA 4IR3A 4HXLA 4UIUA 3S92A 5IGKA 4NS5A 5ENFA 5HQ5A 5D26A 4QSQA 5DX4A 2F6NA 5DY7A 4O74A 5TCMA 5I40A 4O75A 3UVDA 4XY9A 4A9KA 5CY9A 4O7EA 5I1QA 3O34A 5ENJA 4BW4A 5CGPA 5A5QA 5CQ5A 5FFYA 5CQAA 5KTWA 5ETDA 5ENEA 4WHUA 4Z6HA 2RS9B 5LJ0A 4UYHA 5F5ZA 4YBMA 5LKXA 5DBMA 3LQIA 4LC2A 4KCXA 5FE5A 4NQNA 4NUEA 5CUDA 2YQDA 4O71A 5F63A 4IOQA 4NR7A 4XUBA 4IR4A 5AD3A 4N4GA 5F25A 5J0DA 4OUFA 5ENBA 4QSRA 5I88A 4QEWA 4UYEA 2RNXA 4MEQA 5KU3A 5A85A 5IGNA 4PCEA 5ENGA 5C4QA 5EM3A 4CFLA 1F68A 4A9EA 4CUSA 2L85A 5CS8A 4QSWA 3U5LA 5DYCA 4YYNA 4QNSA 5CTLA 4LRGA 4TZ8A 3LQJA 5EWCA 5H1VA 4GPJA 4HXOA 2I8NA 4QYDA 4YYGA 4CUQA 5CRMA 3P1DA 2YEMA 4O77A 4Q0NA 4YBTA 5DYUA 3ONIA 4PKLA 4CUPA 4A9OA 5CQ4A 2RNWA 2F6JA 5E9MA 5EICA 3P1EA 5D3JA 4YADA 2FSAA 3UV2A 4LYSA 4KV4A 4HXKA 5LVRA 4A9JA 4FLPA 5F62A 4NXJA 5L8TA 4MR5A 3O33A 5A83A 4Z93A 5CQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1C A;  3LXJ A;  4ZC9 A;  4QEV A;  4CUT A;  5C8G A;  4BW1 A;  4QSV A;  4QBM A;  5FE0 A;  5KO4 A;  4TZ2 A;  5LJ1 A;  5E74 A;  4J0S A;  4Z1S A;  5E3G A;  5D3T A;  5D3L A;  5EPB A;  4UIT A;  3HMH A;  4O7F A;  5CUE A;  4XUA A;  5A5S A;  4RVR A;  4TYL A;  5CUC A;  4UIV A;  2RFJ A;  4ALH A;  4NR5 A;  5A81 A;  5D24 A;  4YBS A;  3MXF A;  4QYL A;  4PTB A;  5BT3 A;  5I89 A;  4NYV A;  3SVH A;  1E6I A;  5FE6 A;  3QZS A;  3DAI A;  4LZR A;  5LJ2 A;  4HXS A;  5AD2 A;  5I29 A;  5CQ8 A;  4YAT A;  4QEU A;  4YYK A;  5FH6 A;  4J0R A;  4N4F A;  2OSS A;  5II1 A;  5II2 A;  4ZQL A;  1ZS5 A;  3JVK A;  5E7D A;  5D0C A;  4NYX A;  5L99 A;  5CUB A;  3MQM A;  3TLP A;  5LVQ A;  4Z1Q A;  5HRX A;  3FKM X;  2I7K A;  4MEP A;  4TT6 A;  5KHM A;  3HME A;  5C89 A;  4NR9 A;  5HLS A;  3DWY A;  5CRZ A;  5H1U A;  3RCW A;  5A5R A;  3U5N A;  5A5P A;  5FFW A;  5E9Y A;  5CUA A;  3I3J A;  5CP5 A;  1EQF A;  3UV5 A;  5D25 A;  4IR5 A;  4HXP A;  4O72 A;  4N4I A;  4NUD A;  2RNY A;  4TQN A;  5D3N A;  5ENI A;  5FH8 A;  4A9H A;  3UW9 A;  3NXB A;  5E3D A;  5G4R A;  4UIX A;  4TTE A;  2OUO A;  4NRA A;  2DVQ A;  5E0R A;  5LKT A;  4LZS A;  4UYF B;  3U5M A;  3U5O A;  5D7X A;  2YEL A;  4MR6 A;  4J1P A;  4MR3 A;  2YYN A;  5G4S A;  3MUK A;  5HJC A;  4XY8 A;  4YAX A;  5FG4 A;  4AKN A;  3P1F A;  4YYD A;  4IR6 A;  5DLZ A;  4HXM A;  4QUU A;  5FE9 A;  3JVJ A;  5CFW A;  4HBX A;  4A9L A;  4NRB A;  4A9F A;  5FG5 A;  4QUT A;  4QZS A;  4A9N A;  3U5J A;  2D9E A;  2N9G A;  5CPE A;  5FE2 A;  5HEN A;  5I80 A;  5E9I A;  4CUU A;  4YY6 A;  2R0Y A;  5ETB A;  2E3K A;  4HBY A;  5FDZ A;  5FE1 A;  5DKD A;  5EU1 A;  2NXB A;  3U5K A;  4NQM A;  5D3R A;  5CZG A;  4O7C A;  4XYA A;  2DVV A;  5HM0 A;  5K29 A;  5IBN A;  2MJV B;  3GG3 A;  5FH7 A;  5CU8 A;  1JSP B;  2DVS A;  4LDF A;  2OO1 A;  4WHW A;  5F1H A;  2RI7 A;  2G4A A;  4CFK A;  5JI8 A;  2YEK A;  5I7X A;  1WUG A;  5FE8 A;  5AMF A;  3AAD A;  2DWW A;  4QY4 A;  2GRC A;  5C7N A;  4Q0O A;  5A7C A;  5A5N A;  5E9L A;  4BJX A;  4NRC A;  5C87 A;  5EWD A;  5DW1 A;  5HFR A;  4O76 A;  4TU6 A;  4HXN A;  4YH3 A;  4HBV A;  4ALG A;  5BT5 A;  5DFC A;  4HXR A;  4C67 A;  2H60 A;  5HCL A;  5E73 A;  5H1T A;  5HEL A;  4QR3 A;  4QC3 A;  4BHW A;  4IOR A;  4X2I A;  5C85 A;  4TT2 A;  5L8U A;  3O36 A;  3MB4 A;  5F60 A;  4LYI A;  2WP1 A;  3K2J A;  4O7B A;  5HFQ A;  4NR6 A;  2R10 A;  4YYI A;  5IID A;  5DKC A;  5CQ6 A;  4TT4 A;  5EIS A;  3SVF A;  4Z6I A;  4CUR A;  5JWM A;  4NR4 A;  5F36 A;  5LKU A;  3O35 A;  5F61 A;  5E9K A;  4TU4 A;  2L84 A;  5EPR A;  5EV9 A;  3U5P A;  2DVR A;  4YH4 A;  5F3A A;  5I83 A;  4IOO A;  4YY4 A;  5LKZ A;  2WP2 A;  4PCI A;  4YYM A;  4NR8 A;  3G0J A;  4A9I A;  5CUG A;  4YYH A;  5COI A;  5F1L A;  5I7Y A;  3JVM A;  4QSS A;  5FFV A;  4UYD A;  3UVX A;  1WUM A;  4QSP A;  5KTU A;  5L97 A;  4CL9 A;  4YC9 A;  3HMF A;  1X0J A;  5D3S A;  5EWW A;  5DYA A;  4QSX A;  5ENC A;  5KTX A;  5DKH A;  5FE7 A;  5DFD A;  4QSU A;  4WIV A;  4DON A;  5FG6 A;  5FE4 A;  2E7O A;  5EGU A;  3S91 A;  4F3I A;  2RO1 A;  4Y03 A;  5I86 A;  4BW3 A;  3D7C A;  3Q2E A;  4O78 A;  4YYJ A;  5HQ7 A;  5EQ1 A;  5H85 A;  5TB6 A;  5HQ6 A;  2R0S A;  5EVA A;  4QR5 A;  5EPS A;  4E96 A;  3UVY A;  3ZYU A;  5ENH A;  4MEO A;  2DAT A;  4UIZ A;  2KTB B;  5CQT A;  2YW5 A;  5A5O A;  3P5O A;  2LSP B;  3O37 A;  5IG6 A;  3LJW A;  5D3H A;  2R0V A;  4TS8 A;  4OGJ A;  4UYF A;  5FE3 A;  3UVW A;  4MR4 A;  5EA1 A;  4LYW A;  5DW2 A;  2E7N A;  1N72 A;  5L98 A;  5HEM A;  5EK9 A;  5AME A;  2YDW A;  3QZT A;  5LUU A;  5A82 A;  2DKW A;  4A9M A;  5IGL A;  4QB3 A;  5FB0 A;  5HRW A;  4YK0 A;  3MB3 A;  4UYG A;  5DLX A;  2D82 A;  4UIY A;  4BW2 A;  4YAB A;  5CQ3 A;  5EI4 A;  4O7A A;  5DYX A;  5ACY A;  4N3W A;  4C66 A;  4LZ2 A;  5IGM A;  3QZV A;  5DFB A;  5EWH A;  5EP7 A;  5FBX A;  4ZW1 A;  3LQH A;  5BT4 A;  5F2P A;  3G0L A;  4N4H A;  3IU5 A;  1JM4 B;  3AQA A;  5E9V A;  5EWV A;  4QST A;  3UV4 A;  3IU6 A;  2L5E A;  4PS5 A;  4KV1 A;  4NYW A;  4QR4 A;  4HBW A;  4CLB A;  4QC1 A;  4NUC A;  3MUL A;  3JVL A;  4PY6 A;  3SVG A;  5HRV A;  4UIW A;  4LR6 A;  4MEN A;  5FB1 A;  5D3P A;  3Q2F A;  4J3I A;  4O70 A;  5L96 A;  4OGI A;  4IR3 A;  4HXL A;  4UIU A;  3S92 A;  5IGK A;  4NS5 A;  5ENF A;  5HQ5 A;  5D26 A;  4QSQ A;  5DX4 A;  2F6N A;  5DY7 A;  4O74 A;  5TCM A;  5I40 A;  4O75 A;  3UVD A;  4XY9 A;  4A9K A;  5CY9 A;  4O7E A;  5I1Q A;  3O34 A;  5ENJ A;  4BW4 A;  5CGP A;  5A5Q A;  5CQ5 A;  5FFY A;  5CQA A;  5KTW A;  5ETD A;  5ENE A;  4WHU A;  4Z6H A;  2RS9 B;  5LJ0 A;  4UYH A;  5F5Z A;  4YBM A;  5LKX A;  5DBM A;  3LQI A;  4LC2 A;  4KCX A;  5FE5 A;  4NQN A;  4NUE A;  5CUD A;  2YQD A;  4O71 A;  5F63 A;  4IOQ A;  4NR7 A;  4XUB A;  4IR4 A;  5AD3 A;  4N4G A;  5F25 A;  5J0D A;  4OUF A;  5ENB A;  4QSR A;  5I88 A;  4QEW A;  4UYE A;  2RNX A;  4MEQ A;  5KU3 A;  5A85 A;  5IGN A;  4PCE A;  5ENG A;  5C4Q A;  5EM3 A;  4CFL A;  1F68 A;  4A9E A;  4CUS A;  2L85 A;  5CS8 A;  4QSW A;  3U5L A;  5DYC A;  4YYN A;  4QNS A;  5CTL A;  4LRG A;  4TZ8 A;  3LQJ A;  5EWC A;  5H1V A;  4GPJ A;  4HXO A;  2I8N A;  4QYD A;  4YYG A;  4CUQ A;  5CRM A;  3P1D A;  2YEM A;  4O77 A;  4Q0N A;  4YBT A;  5DYU A;  3ONI A;  4PKL A;  4CUP A;  4A9O A;  5CQ4 A;  2RNW A;  2F6J A;  5E9M A;  5EIC A;  3P1E A;  5D3J A;  4YAD A;  2FSA A;  3UV2 A;  4LYS A;  4KV4 A;  4HXK A;  5LVR A;  4A9J A;  4FLP A;  5F62 A;  4NXJ A;  5L8T A;  4MR5 A;  3O33 A;  5A83 A;  4Z93 A;  5CQ7 A; 
#chains in the Genus database with same CATH topology
 3P1C A;  3LXJ A;  4ZC9 A;  4QEV A;  4CUT A;  5C8G A;  4BW1 A;  4QSV A;  4QBM A;  5FE0 A;  2EJN A;  5KO4 A;  4TZ2 A;  5LJ1 A;  5E74 A;  4J0S A;  4Z1S A;  5E3G A;  5D3T A;  5D3L A;  5EPB A;  4UIT A;  3HMH A;  4O7F A;  5CUE A;  4XUA A;  5A5S A;  4RVR A;  4TYL A;  5CUC A;  4UIV A;  2RFJ A;  4ALH A;  4NR5 A;  5A81 A;  5D24 A;  4YBS A;  3MXF A;  4QYL A;  4PTB A;  5BT3 A;  5I89 A;  4NYV A;  3SVH A;  1E6I A;  5FE6 A;  3QZS A;  3DAI A;  4LZR A;  5LJ2 A;  4HXS A;  5AD2 A;  5I29 A;  5CQ8 A;  4YAT A;  4QEU A;  4YYK A;  5FH6 A;  4J0R A;  4N4F A;  2OSS A;  5II1 A;  5II2 A;  4ZQL A;  1ZS5 A;  3JVK A;  5E7D A;  5D0C A;  4NYX A;  5L99 A;  5CUB A;  3ERR A;  3MQM A;  3TLP A;  5LVQ A;  4Z1Q A;  5HRX A;  3FKM X;  2I7K A;  4MEP A;  4TT6 A;  5KHM A;  3HME A;  5C89 A;  4NR9 A;  5HLS A;  3DWY A;  5CRZ A;  5H1U A;  3RCW A;  5A5R A;  3U5N A;  5A5P A;  5FFW A;  5E9Y A;  5CUA A;  3I3J A;  5CP5 A;  1EQF A;  3UV5 A;  5D25 A;  4IR5 A;  4HXP A;  4O72 A;  4N4I A;  4NUD A;  2RNY A;  4TQN A;  5D3N A;  5ENI A;  5FH8 A;  4A9H A;  3UW9 A;  3NXB A;  5E3D A;  5G4R A;  4UIX A;  4TTE A;  2OUO A;  4NRA A;  2DVQ A;  5E0R A;  5LKT A;  4LZS A;  4UYF B;  3U5M A;  3U5O A;  5D7X A;  2YEL A;  4MR6 A;  4J1P A;  4MR3 A;  2YYN A;  5G4S A;  3MUK A;  5HJC A;  4XY8 A;  4YAX A;  5FG4 A;  4AKN A;  3P1F A;  4YYD A;  4IR6 A;  5DLZ A;  4HXM A;  4QUU A;  5FE9 A;  3JVJ A;  5CFW A;  4HBX A;  4A9L A;  4NRB A;  4A9F A;  5FG5 A;  4QUT A;  4QZS A;  4A9N A;  3U5J A;  2D9E A;  2N9G A;  5CPE A;  5FE2 A;  5HEN A;  5I80 A;  5E9I A;  4CUU A;  4YY6 A;  2R0Y A;  5ETB A;  2E3K A;  4HBY A;  5FDZ A;  5FE1 A;  5DKD A;  5EU1 A;  2NXB A;  3U5K A;  4NQM A;  5D3R A;  5CZG A;  4O7C A;  4XYA A;  2DVV A;  5HM0 A;  5K29 A;  5IBN A;  2MJV B;  3GG3 A;  5FH7 A;  5CU8 A;  1JSP B;  2DVS A;  4LDF A;  2OO1 A;  4WHW A;  5F1H A;  2RI7 A;  2G4A A;  4CFK A;  5JI8 A;  2YEK A;  5I7X A;  1WUG A;  5FE8 A;  5AMF A;  3AAD A;  2DWW A;  4QY4 A;  2GRC A;  5C7N A;  4Q0O A;  5A7C A;  5A5N A;  5E9L A;  4BJX A;  4NRC A;  5C87 A;  5EWD A;  5DW1 A;  5HFR A;  4O76 A;  4TU6 A;  4HXN A;  4YH3 A;  4HBV A;  4ALG A;  5BT5 A;  5DFC A;  4HXR A;  4C67 A;  2H60 A;  5HCL A;  5E73 A;  5H1T A;  5HEL A;  4QR3 A;  4QC3 A;  4BHW A;  4IOR A;  4X2I A;  3D1D A;  4TT2 A;  5C85 A;  5L8U A;  3O36 A;  3MB4 A;  5F60 A;  4LYI A;  2WP1 A;  3K2J A;  4O7B A;  5HFQ A;  4NR6 A;  2R10 A;  4YYI A;  5IID A;  5DKC A;  5CQ6 A;  4TT4 A;  5EIS A;  3SVF A;  4Z6I A;  4CUR A;  5JWM A;  4NR4 A;  5F36 A;  5LKU A;  3O35 A;  5F61 A;  5E9K A;  4TU4 A;  2L84 A;  5EPR A;  5EV9 A;  3U5P A;  2DVR A;  4YH4 A;  5F3A A;  5I83 A;  4IOO A;  4YY4 A;  5LKZ A;  2WP2 A;  4PCI A;  4YYM A;  4NR8 A;  3G0J A;  4A9I A;  5CUG A;  4YYH A;  5COI A;  5F1L A;  5I7Y A;  3JVM A;  4QSS A;  5FFV A;  4UYD A;  3UVX A;  1WUM A;  4QSP A;  5KTU A;  5L97 A;  4CL9 A;  4YC9 A;  3HMF A;  1X0J A;  5D3S A;  5EWW A;  5DYA A;  4QSX A;  5ENC A;  5KTX A;  5DKH A;  5FE7 A;  5DFD A;  4QSU A;  4WIV A;  4DON A;  5FG6 A;  5FE4 A;  2E7O A;  5EGU A;  3S91 A;  4F3I A;  4AKI A;  2RO1 A;  4Y03 A;  5I86 A;  4BW3 A;  3D7C A;  3Q2E A;  4O78 A;  4YYJ A;  5HQ7 A;  5EQ1 A;  5H85 A;  5TB6 A;  5HQ6 A;  2R0S A;  5EVA A;  4QR5 A;  5EPS A;  3VKG A;  4E96 A;  3UVY A;  3ZYU A;  5ENH A;  4MEO A;  2DAT A;  4UIZ A;  2KTB B;  5CQT A;  2YW5 A;  5A5O A;  3P5O A;  2LSP B;  3O37 A;  5IG6 A;  3LJW A;  5D3H A;  2R0V A;  4TS8 A;  4OGJ A;  4UYF A;  5FE3 A;  3UVW A;  4MR4 A;  5EA1 A;  4LYW A;  5DW2 A;  2E7N A;  1N72 A;  5L98 A;  5HEM A;  5EK9 A;  5AME A;  2YDW A;  3QZT A;  5LUU A;  5A82 A;  2DKW A;  4A9M A;  5IGL A;  4QB3 A;  5FB0 A;  5HRW A;  4YK0 A;  3MB3 A;  4UYG A;  1PUO A;  5DLX A;  2D82 A;  4UIY A;  4BW2 A;  4YAB A;  5CQ3 A;  5EI4 A;  4O7A A;  5DYX A;  5ACY A;  4N3W A;  4C66 A;  4LZ2 A;  5IGM A;  3QZV A;  5DFB A;  5EWH A;  5EP7 A;  5FBX A;  4ZW1 A;  3LQH A;  5BT4 A;  5F2P A;  3G0L A;  4N4H A;  1ZKR A;  3IU5 A;  1JM4 B;  3AQA A;  5E9V A;  5EWV A;  4QST A;  3UV4 A;  3IU6 A;  2L5E A;  4PS5 A;  3D1B A;  4KV1 A;  4NYW A;  4QR4 A;  4HBW A;  4CLB A;  4QC1 A;  4NUC A;  3MUL A;  3JVL A;  4PY6 A;  3SVG A;  5HRV A;  4UIW A;  4LR6 A;  4MEN A;  5FB1 A;  5D3P A;  3Q2F A;  4J3I A;  4O70 A;  5L96 A;  4OGI A;  4IR3 A;  4HXL A;  4UIU A;  3S92 A;  5IGK A;  4NS5 A;  5ENF A;  5HQ5 A;  5D26 A;  4QSQ A;  5DX4 A;  2F6N A;  5DY7 A;  4O74 A;  5TCM A;  5I40 A;  4O75 A;  3UVD A;  4XY9 A;  4A9K A;  5CY9 A;  4O7E A;  5I1Q A;  3O34 A;  5ENJ A;  3VKH A;  4BW4 A;  5CGP A;  5A5Q A;  5CQ5 A;  5FFY A;  5CQA A;  5KTW A;  5ETD A;  5ENE A;  4WHU A;  4Z6H A;  2RS9 B;  5LJ0 A;  4UYH A;  5F5Z A;  4YBM A;  5LKX A;  5DBM A;  3LQI A;  4LC2 A;  4KCX A;  5FE5 A;  4NQN A;  4NUE A;  5CUD A;  2YQD A;  4O71 A;  5F63 A;  4IOQ A;  4NR7 A;  4XUB A;  4IR4 A;  5AD3 A;  4N4G A;  5F25 A;  5J0D A;  4OUF A;  5ENB A;  4QSR A;  5I88 A;  4AI6 A;  4QEW A;  4UYE A;  2RNX A;  4MEQ A;  5KU3 A;  4AKG A;  5A85 A;  5IGN A;  4PCE A;  5ENG A;  5C4Q A;  5EM3 A;  4CFL A;  1F68 A;  4A9E A;  4CUS A;  2L85 A;  5CS8 A;  4QSW A;  3U5L A;  5DYC A;  4YYN A;  4QNS A;  5CTL A;  4LRG A;  4TZ8 A;  3LQJ A;  5EWC A;  5H1V A;  4GPJ A;  4HXO A;  2I8N A;  4QYD A;  4YYG A;  4CUQ A;  4AKH A;  5CRM A;  3P1D A;  2YEM A;  4O77 A;  4Q0N A;  4YBT A;  5DYU A;  3ONI A;  4PKL A;  4CUP A;  4A9O A;  5CQ4 A;  2RNW A;  2F6J A;  5E9M A;  5EIC A;  3P1E A;  5D3J A;  4YAD A;  2FSA A;  3UV2 A;  4LYS A;  4KV4 A;  4HXK A;  5LVR A;  4A9J A;  4FLP A;  5F62 A;  4NXJ A;  5L8T A;  4MR5 A;  3O33 A;  5A83 A;  4Z93 A;  5CQ7 A; 
#chains in the Genus database with same CATH homology
 3P1C A;  3LXJ A;  4ZC9 A;  4QEV A;  4CUT A;  5C8G A;  4BW1 A;  4QSV A;  4QBM A;  5FE0 A;  5KO4 A;  4TZ2 A;  5LJ1 A;  5E74 A;  4J0S A;  4Z1S A;  5E3G A;  5D3T A;  5D3L A;  5EPB A;  4UIT A;  3HMH A;  4O7F A;  5CUE A;  4XUA A;  5A5S A;  4RVR A;  4TYL A;  5CUC A;  4UIV A;  2RFJ A;  4ALH A;  4NR5 A;  5A81 A;  5D24 A;  4YBS A;  3MXF A;  4QYL A;  4PTB A;  5BT3 A;  5I89 A;  4NYV A;  3SVH A;  1E6I A;  5FE6 A;  3QZS A;  3DAI A;  4LZR A;  5LJ2 A;  4HXS A;  5AD2 A;  5I29 A;  5CQ8 A;  4YAT A;  4QEU A;  4YYK A;  5FH6 A;  4J0R A;  4N4F A;  2OSS A;  5II1 A;  5II2 A;  4ZQL A;  1ZS5 A;  3JVK A;  5E7D A;  5D0C A;  4NYX A;  5L99 A;  5CUB A;  3MQM A;  3TLP A;  5LVQ A;  4Z1Q A;  5HRX A;  3FKM X;  2I7K A;  4MEP A;  4TT6 A;  5KHM A;  3HME A;  5C89 A;  4NR9 A;  5HLS A;  3DWY A;  5CRZ A;  5H1U A;  3RCW A;  5A5R A;  3U5N A;  5A5P A;  5FFW A;  5E9Y A;  5CUA A;  3I3J A;  5CP5 A;  1EQF A;  3UV5 A;  5D25 A;  4IR5 A;  4HXP A;  4O72 A;  4N4I A;  4NUD A;  2RNY A;  4TQN A;  5D3N A;  5ENI A;  5FH8 A;  4A9H A;  3UW9 A;  3NXB A;  5E3D A;  5G4R A;  4UIX A;  4TTE A;  2OUO A;  4NRA A;  2DVQ A;  5E0R A;  5LKT A;  4LZS A;  4UYF B;  3U5M A;  3U5O A;  5D7X A;  2YEL A;  4MR6 A;  4J1P A;  4MR3 A;  2YYN A;  5G4S A;  3MUK A;  5HJC A;  4XY8 A;  4YAX A;  5FG4 A;  4AKN A;  3P1F A;  4YYD A;  4IR6 A;  5DLZ A;  4HXM A;  4QUU A;  5FE9 A;  3JVJ A;  5CFW A;  4HBX A;  4A9L A;  4NRB A;  4A9F A;  5FG5 A;  4QUT A;  4QZS A;  4A9N A;  3U5J A;  2D9E A;  2N9G A;  5CPE A;  5FE2 A;  5HEN A;  5I80 A;  5E9I A;  4CUU A;  4YY6 A;  2R0Y A;  5ETB A;  2E3K A;  4HBY A;  5FDZ A;  5FE1 A;  5DKD A;  5EU1 A;  2NXB A;  3U5K A;  4NQM A;  5D3R A;  5CZG A;  4O7C A;  4XYA A;  2DVV A;  5HM0 A;  5K29 A;  5IBN A;  2MJV B;  3GG3 A;  5FH7 A;  5CU8 A;  1JSP B;  2DVS A;  4LDF A;  2OO1 A;  4WHW A;  5F1H A;  2RI7 A;  2G4A A;  4CFK A;  5JI8 A;  2YEK A;  5I7X A;  1WUG A;  5FE8 A;  5AMF A;  3AAD A;  2DWW A;  4QY4 A;  2GRC A;  5C7N A;  4Q0O A;  5A7C A;  5A5N A;  5E9L A;  4BJX A;  4NRC A;  5C87 A;  5EWD A;  5DW1 A;  5HFR A;  4O76 A;  4TU6 A;  4HXN A;  4YH3 A;  4HBV A;  4ALG A;  5BT5 A;  5DFC A;  4HXR A;  4C67 A;  2H60 A;  5HCL A;  5E73 A;  5H1T A;  5HEL A;  4QR3 A;  4QC3 A;  4BHW A;  4IOR A;  4X2I A;  5C85 A;  4TT2 A;  5L8U A;  3O36 A;  3MB4 A;  5F60 A;  4LYI A;  2WP1 A;  3K2J A;  4O7B A;  5HFQ A;  4NR6 A;  2R10 A;  4YYI A;  5IID A;  5DKC A;  5CQ6 A;  4TT4 A;  5EIS A;  3SVF A;  4Z6I A;  4CUR A;  5JWM A;  4NR4 A;  5F36 A;  5LKU A;  3O35 A;  5F61 A;  5E9K A;  4TU4 A;  2L84 A;  5EPR A;  5EV9 A;  3U5P A;  2DVR A;  4YH4 A;  5F3A A;  5I83 A;  4IOO A;  4YY4 A;  5LKZ A;  2WP2 A;  4PCI A;  4YYM A;  4NR8 A;  3G0J A;  4A9I A;  5CUG A;  4YYH A;  5COI A;  5F1L A;  5I7Y A;  3JVM A;  4QSS A;  5FFV A;  4UYD A;  3UVX A;  1WUM A;  4QSP A;  5KTU A;  5L97 A;  4CL9 A;  4YC9 A;  3HMF A;  1X0J A;  5D3S A;  5EWW A;  5DYA A;  4QSX A;  5ENC A;  5KTX A;  5DKH A;  5FE7 A;  5DFD A;  4QSU A;  4WIV A;  4DON A;  5FG6 A;  5FE4 A;  2E7O A;  5EGU A;  3S91 A;  4F3I A;  2RO1 A;  4Y03 A;  5I86 A;  4BW3 A;  3D7C A;  3Q2E A;  4O78 A;  4YYJ A;  5HQ7 A;  5EQ1 A;  5H85 A;  5TB6 A;  5HQ6 A;  2R0S A;  5EVA A;  4QR5 A;  5EPS A;  4E96 A;  3UVY A;  3ZYU A;  5ENH A;  4MEO A;  2DAT A;  4UIZ A;  2KTB B;  5CQT A;  2YW5 A;  5A5O A;  3P5O A;  2LSP B;  3O37 A;  5IG6 A;  3LJW A;  5D3H A;  2R0V A;  4TS8 A;  4OGJ A;  4UYF A;  5FE3 A;  3UVW A;  4MR4 A;  5EA1 A;  4LYW A;  5DW2 A;  2E7N A;  1N72 A;  5L98 A;  5HEM A;  5EK9 A;  5AME A;  2YDW A;  3QZT A;  5LUU A;  5A82 A;  2DKW A;  4A9M A;  5IGL A;  4QB3 A;  5FB0 A;  5HRW A;  4YK0 A;  3MB3 A;  4UYG A;  5DLX A;  2D82 A;  4UIY A;  4BW2 A;  4YAB A;  5CQ3 A;  5EI4 A;  4O7A A;  5DYX A;  5ACY A;  4N3W A;  4C66 A;  4LZ2 A;  5IGM A;  3QZV A;  5DFB A;  5EWH A;  5EP7 A;  5FBX A;  4ZW1 A;  3LQH A;  5BT4 A;  5F2P A;  3G0L A;  4N4H A;  3IU5 A;  1JM4 B;  3AQA A;  5E9V A;  5EWV A;  4QST A;  3UV4 A;  3IU6 A;  2L5E A;  4PS5 A;  4KV1 A;  4NYW A;  4QR4 A;  4HBW A;  4CLB A;  4QC1 A;  4NUC A;  3MUL A;  3JVL A;  4PY6 A;  3SVG A;  5HRV A;  4UIW A;  4LR6 A;  4MEN A;  5FB1 A;  5D3P A;  3Q2F A;  4J3I A;  4O70 A;  5L96 A;  4OGI A;  4IR3 A;  4HXL A;  4UIU A;  3S92 A;  5IGK A;  4NS5 A;  5ENF A;  5HQ5 A;  5D26 A;  4QSQ A;  5DX4 A;  2F6N A;  5DY7 A;  4O74 A;  5TCM A;  5I40 A;  4O75 A;  3UVD A;  4XY9 A;  4A9K A;  5CY9 A;  4O7E A;  5I1Q A;  3O34 A;  5ENJ A;  4BW4 A;  5CGP A;  5A5Q A;  5CQ5 A;  5FFY A;  5CQA A;  5KTW A;  5ETD A;  5ENE A;  4WHU A;  4Z6H A;  2RS9 B;  5LJ0 A;  4UYH A;  5F5Z A;  4YBM A;  5LKX A;  5DBM A;  3LQI A;  4LC2 A;  4KCX A;  5FE5 A;  4NQN A;  4NUE A;  5CUD A;  2YQD A;  4O71 A;  5F63 A;  4IOQ A;  4NR7 A;  4XUB A;  4IR4 A;  5AD3 A;  4N4G A;  5F25 A;  5J0D A;  4OUF A;  5ENB A;  4QSR A;  5I88 A;  4QEW A;  4UYE A;  2RNX A;  4MEQ A;  5KU3 A;  5A85 A;  5IGN A;  4PCE A;  5ENG A;  5C4Q A;  5EM3 A;  4CFL A;  1F68 A;  4A9E A;  4CUS A;  2L85 A;  5CS8 A;  4QSW A;  3U5L A;  5DYC A;  4YYN A;  4QNS A;  5CTL A;  4LRG A;  4TZ8 A;  3LQJ A;  5EWC A;  5H1V A;  4GPJ A;  4HXO A;  2I8N A;  4QYD A;  4YYG A;  4CUQ A;  5CRM A;  3P1D A;  2YEM A;  4O77 A;  4Q0N A;  4YBT A;  5DYU A;  3ONI A;  4PKL A;  4CUP A;  4A9O A;  5CQ4 A;  2RNW A;  2F6J A;  5E9M A;  5EIC A;  3P1E A;  5D3J A;  4YAD A;  2FSA A;  3UV2 A;  4LYS A;  4KV4 A;  4HXK A;  5LVR A;  4A9J A;  4FLP A;  5F62 A;  4NXJ A;  5L8T A;  4MR5 A;  3O33 A;  5A83 A;  4Z93 A;  5CQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...