1JM4B

Nmr structure of p/caf bromodomain in complex with hiv-1 tat peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
b'GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 Tat Peptide
publication title Structural basis of lysine-acetylated HIV-1 Tat recognition by PCAF bromodomain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 28
structure length 118
sequence length 118
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1jm4B00
2RS9B 2F6NA 4OGJA 3U5OA 5JI8A 4A9OA 5L99A 4YYKA 4QSTA 4BJXA 5H1TA 5FE6A 5EWVA 4QNSA 5CQ5A 5CPEA 5ENFA 4O7EA 4TT4A 5LKXA 3UV5A 3JVKA 4WHWA 5H1VA 4CLBA 5F1LA 5EICA 5CQTA 4YC9A 3O34A 4ZQLA 3LQJA 5LVQA 2YEKA 5D3LA 5HRXA 4A9LA 4CFKA 4HXNA 5D7XA 5D3HA 5II2A 3O33A 5FH8A 5I1QA 4KV1A 4HXMA 5CY9A 5BT5A 2E7NA 4QSVA 5E74A 5EWCA 5D3SA 4J0RA 3S91A 2F6JA 5A83A 3LQHA 2YQDA 4NR7A 2D82A 4ZW1A 4NR4A 4YYNA 4XUAA 5I7XA 3MUKA 3UV2A 4TT2A 5EPRA 5F62A 2YEMA 5D25A 4A9KA 2E7OA 5CRMA 5CU8A 4GPJA 4TT6A 3GG3A 4NRBA 2DVVA 5ENEA 4QSUA 4CUTA 5JWMA 5AD2A 4O77A 5I83A 5DKHA 5A5QA 5HM0A 5DLXA 5ETBA 5F61A 5IGKA 4HBYA 5FH6A 3G0JA 4N4FA 3UVYA 4ALHA 4MENA 5KTXA 5HFRA 5FE7A 5CUEA 4QEVA 4YK0A 5HCLA 4XUBA 4YYMA 2FSAA 3DWYA 3U5JA 3K2JA 2H60A 4MR4A 2RI7A 4QYDA 5CQ4A 5I40A 4NYXA 4PKLA 5E9KA 4TZ8A 2I8NA 4UIVA 4CUPA 4O7BA 5HEMA 4O72A 5A5SA 4Z1QA 3QZVA 4UYGA 3O36A 5FE1A 5FG4A 4OUFA 5IBNA 5EP7A 4UITA 5DYXA 3SVFA 4O7AA 4HXKA 5KTUA 3MXFA 3P1CA 4N3WA 3AADA 4YY6A 5DW1A 5HRWA 2RFJA 5A82A 4A9FA 4ALGA 2L5EA 5DYAA 5DBMA 5EV9A 4WIVA 5IG6A 5C87A 4O74A 5HJCA 4UYDA 5DFCA 5CUGA 4TQNA 5D3JA 4UYFB 4QC3A 4Q0NA 1ZS5A 2R10A 5HQ5A 4QSQA 3UVDA 4Z6HA 2DVRA 5E9IA 2RNWA 5J0DA 5EK9A 4A9MA 4A9IA 2DVSA 4N4IA 4Q0OA 4MEOA 3DAIA 1JSPB 5FB0A 1X0JA 4HXOA 5CFWA 5CUCA 5D0CA 4WHUA 5H85A 4LZ2A 4YH4A 5HENA 5AMFA 2NXBA 2DATA 4QEWA 4F3IA 3JVMA 3UW9A 4QSPA 4TU4A 4TYLA 5LKTA 4BW3A 4QBMA 5E3DA 4LRGA 5CQ7A 5F5ZA 4O71A 3JVLA 4HXSA 5KO4A 3HMHA 5ENHA 4YATA 5A7CA 3U5PA 3U5LA 3HMEA 2L84A 4XY9A 4NYVA 5LKZA 4QUUA 4YH3A 5L8TA 5EISA 5DKCA 5G4SA 1JM4B 4NQMA 4QR4A 5H1UA 5E9VA 4ZC9A 3P1EA 5LUUA 4YAXA 4O76A 2R0YA 3P1DA 5D3RA 4IR6A 4OGIA 2KTBB 3FKMX 4HXRA 3UVXA 5EA1A 2G4AA 4YYJA 3ONIA 5LJ2A 5I29A 2GRCA 5ETDA 5E3GA 5C4QA 4IOQA 5CUBA 5DYCA 4QSSA 4UIUA 5E9LA 1WUGA 4UYEA 5CUAA 5LJ1A 5COIA 4PY6A 4LR6A 5ENJA 5A5NA 4QY4A 5HRVA 4IR4A 4BW1A 5L8UA 5D26A 4N4HA 5EGUA 4HXPA 4A9EA 3ZYUA 3RCWA 5CQ8A 4NUDA 4NXJA 5FE0A 5HLSA 4QEUA 3SVGA 4HBWA 4C66A 3O37A 4HBVA 4HBXA 4PCEA 4CURA 4DONA 5ENIA 5HELA 4QZSA 5F63A 5K29A 3U5NA 4MEPA 4MR3A 4Y03A 5EM3A 4RVRA 2YELA 4NR8A 4YYIA 5KHMA 5EWDA 4IR3A 4LZRA 4QB3A 4A9HA 2OSSA 5AMEA 2DWWA 4Z6IA 4UIXA 2R0VA 4CUQA 4NUEA 5F1HA 3IU5A 4YBMA 5TB6A 4LYIA 2OUOA 3P5OA 5D3PA 3LXJA 4YADA 5I89A 3LQIA 4LDFA 5II1A 4NRAA 2RNYA 4N4GA 5EQ1A 2WP2A 4CFLA 4HXLA 5BT4A 5KTWA 4YBSA 5DY7A 4CUUA 5FFYA 5FB1A 4MR5A 2YYNA 5EPBA 5TCMA 4YY4A 3LJWA 4NR5A 5CZGA 4YBTA 4UIWA 5DW2A 3HMFA 5ENGA 5FE3A 4YYGA 4NRCA 3UVWA 2I7KA 4LZSA 3Q2EA 5FDZA 4BHWA 5F2PA 5LKUA 3MQMA 5ENBA 5FE2A 5IIDA 2DKWA 5ENCA 5D3NA 5FG5A 5I88A 4J0SA 4Z1SA 5BT3A 4NUCA 4LYSA 5ACYA 4QUTA 3S92A 1E6IA 4J3IA 4CL9A 4O75A 5DKDA 4IR5A 4TTEA 4QR5A 4NQNA 5DFBA 5CQ6A 3D7CA 5FH7A 5F25A 5EPSA 2DVQA 3G0LA 5DLZA 5EI4A 4LC2A 5KU3A 4O70A 4UYHA 4AKNA 4O7FA 3I3JA 5CQ3A 5A85A 4QC1A 4LYWA 4BW2A 5FE8A 3Q2FA 4TS8A 4QSRA 4NR6A 5D24A 5F3AA 2YDWA 4TU6A 5IGNA 4MR6A 4QR3A 5FG6A 1EQFA 4X2IA 4YYHA 5IGMA 2MJVB 4QSXA 3JVJA 5E0RA 5E73A 2E3KA 5EU1A 5I7YA 4NYWA 5CUDA 5C7NA 5FE5A 5F36A 5F60A 2D9EA 5FFVA 5CP5A 5EWHA 3AQAA 5FE9A 5FBXA 5DFDA 4IOOA 4E96A 2OO1A 5L98A 5C89A 4MEQA 4KCXA 5DX4A 5E7DA 5G4RA 1WUMA 4O78A 5CQAA 4UIYA 3O35A 5L97A 5HFQA 5EVAA 2N9GA 4A9JA 4KV4A 5I80A 5LJ0A 4NS5A 5A5OA 5DYUA 2RNXA 3QZTA 3TLPA 2L85A 3QZSA 4NR9A 5LVRA 5C8GA 3IU6A 5CGPA 2WP1A 4YABA 4FLPA 2LSPB 4QYLA 4O7CA 3U5KA 1N72A 5FE4A 3MB3A 4YYDA 2YW5A 3UV4A 4C67A 3MB4A 5HQ6A 4XY8A 5EWWA 4QSWA 5A5RA 5IGLA 5L96A 4A9NA 2R0SA 4PCIA 4IORA 3SVHA 5A5PA 5C85A 2RO1A 5HQ7A 3NXBA 4Z93A 3P1FA 5E9MA 5A81A 4BW4A 5CTLA 5CS8A 5CRZA 4J1PA 3U5MA 5FFWA 4XYAA 4PTBA 4TZ2A 3MULA 4UYFA 5D3TA 4PS5A 5E9YA 4CUSA 5AD3A 4UIZA 1F68A 5I86A
chains in the Genus database with same CATH superfamily
2RS9B 2F6NA 4OGJA 3U5OA 5JI8A 4A9OA 5L99A 4YYKA 4QSTA 4BJXA 5H1TA 5FE6A 5EWVA 4QNSA 5CQ5A 5CPEA 5ENFA 4O7EA 4TT4A 5LKXA 3UV5A 3JVKA 4WHWA 5H1VA 4CLBA 5F1LA 5EICA 5CQTA 4YC9A 3O34A 4ZQLA 3LQJA 5LVQA 2YEKA 5D3LA 5HRXA 4A9LA 4CFKA 4HXNA 5D7XA 5D3HA 5II2A 3O33A 5FH8A 5I1QA 4KV1A 4HXMA 5CY9A 5BT5A 2E7NA 4QSVA 5E74A 5EWCA 5D3SA 4J0RA 3S91A 2F6JA 5A83A 3LQHA 2YQDA 4NR7A 2D82A 4ZW1A 4NR4A 4YYNA 4XUAA 5I7XA 3MUKA 3UV2A 4TT2A 5EPRA 5F62A 2YEMA 5D25A 4A9KA 2E7OA 5CRMA 5CU8A 4GPJA 4TT6A 3GG3A 4NRBA 2DVVA 5ENEA 4QSUA 4CUTA 5JWMA 5AD2A 4O77A 5I83A 5DKHA 5A5QA 5HM0A 5DLXA 5ETBA 5F61A 5IGKA 4HBYA 5FH6A 3G0JA 4N4FA 3UVYA 4ALHA 4MENA 5KTXA 5HFRA 5FE7A 5CUEA 4QEVA 4YK0A 5HCLA 4XUBA 4YYMA 2FSAA 3DWYA 3U5JA 3K2JA 2H60A 4MR4A 2RI7A 4QYDA 5CQ4A 5I40A 4NYXA 4PKLA 5E9KA 4TZ8A 2I8NA 4UIVA 4CUPA 4O7BA 5HEMA 4O72A 5A5SA 4Z1QA 3QZVA 4UYGA 3O36A 5FE1A 5FG4A 4OUFA 5IBNA 5EP7A 4UITA 5DYXA 3SVFA 4O7AA 4HXKA 5KTUA 3MXFA 3P1CA 4N3WA 3AADA 4YY6A 5DW1A 5HRWA 2RFJA 5A82A 4A9FA 4ALGA 2L5EA 5DYAA 5DBMA 5EV9A 4WIVA 5IG6A 5C87A 4O74A 5HJCA 4UYDA 5DFCA 5CUGA 4TQNA 5D3JA 4UYFB 4QC3A 4AI6A 4Q0NA 1ZS5A 2R10A 5HQ5A 4QSQA 3UVDA 4Z6HA 2DVRA 5E9IA 2RNWA 5J0DA 5EK9A 4A9MA 4A9IA 2DVSA 4N4IA 4Q0OA 4MEOA 3DAIA 1JSPB 5FB0A 1X0JA 4HXOA 5CFWA 5CUCA 5D0CA 4WHUA 5H85A 4LZ2A 4YH4A 5HENA 5AMFA 2NXBA 2DATA 4QEWA 4F3IA 3JVMA 3UW9A 4QSPA 4TU4A 4TYLA 5LKTA 4BW3A 4QBMA 5E3DA 4LRGA 5CQ7A 5F5ZA 4O71A 3JVLA 4HXSA 5KO4A 3VKGA 3HMHA 5ENHA 4YATA 5A7CA 3U5PA 3U5LA 3HMEA 2L84A 4XY9A 4NYVA 5LKZA 4QUUA 4YH3A 5L8TA 5EISA 5DKCA 5G4SA 1JM4B 4NQMA 4QR4A 5H1UA 5E9VA 4ZC9A 3P1EA 5LUUA 4YAXA 4O76A 2R0YA 3P1DA 5D3RA 4IR6A 4OGIA 2KTBB 3FKMX 4HXRA 3UVXA 3D1DA 2G4AA 5EA1A 3ONIA 4YYJA 5LJ2A 5I29A 2GRCA 5ETDA 5E3GA 5C4QA 3D1BA 4IOQA 5CUBA 5DYCA 4QSSA 4UIUA 5E9LA 1WUGA 1PUOA 4UYEA 5CUAA 5LJ1A 5COIA 4PY6A 4LR6A 5ENJA 5A5NA 4QY4A 5HRVA 4IR4A 4BW1A 5L8UA 5D26A 4N4HA 5EGUA 4HXPA 4A9EA 3ZYUA 3RCWA 5CQ8A 4NUDA 4NXJA 5FE0A 5HLSA 4QEUA 3SVGA 4HBWA 4C66A 3O37A 4HBVA 4HBXA 4PCEA 4CURA 4DONA 5ENIA 5HELA 4QZSA 5F63A 5K29A 3U5NA 4MEPA 4MR3A 4Y03A 2EJNA 5EM3A 4RVRA 2YELA 4NR8A 4YYIA 5KHMA 5EWDA 4IR3A 4LZRA 4QB3A 4A9HA 2OSSA 5AMEA 2DWWA 4Z6IA 4UIXA 2R0VA 4CUQA 4NUEA 5F1HA 3IU5A 4YBMA 5TB6A 4LYIA 2OUOA 3P5OA 5D3PA 3LXJA 4YADA 5I89A 3LQIA 4LDFA 5II1A 4NRAA 2RNYA 4N4GA 5EQ1A 2WP2A 4CFLA 4HXLA 5BT4A 5KTWA 4YBSA 5DY7A 4CUUA 5FFYA 5FB1A 4MR5A 2YYNA 5EPBA 5TCMA 4YY4A 3LJWA 4NR5A 4AKGA 5CZGA 4YBTA 4UIWA 5DW2A 3HMFA 5ENGA 5FE3A 4YYGA 4NRCA 4AKIA 3UVWA 3VKHA 2I7KA 4LZSA 3Q2EA 5FDZA 4BHWA 5F2PA 5LKUA 3MQMA 5ENBA 5FE2A 5IIDA 2DKWA 5ENCA 5D3NA 5FG5A 5I88A 4J0SA 4Z1SA 5BT3A 4NUCA 4LYSA 5ACYA 4QUTA 3S92A 1E6IA 4J3IA 4CL9A 4O75A 5DKDA 4IR5A 4TTEA 4QR5A 4NQNA 5DFBA 5CQ6A 3D7CA 5FH7A 5F25A 5EPSA 2DVQA 3G0LA 5DLZA 5EI4A 4LC2A 5KU3A 4O70A 4UYHA 4AKNA 4O7FA 3I3JA 5CQ3A 5A85A 4QC1A 4LYWA 4BW2A 5FE8A 3Q2FA 4TS8A 4QSRA 4NR6A 5D24A 5F3AA 2YDWA 4TU6A 5IGNA 4MR6A 4QR3A 5FG6A 1EQFA 4X2IA 4YYHA 5IGMA 2MJVB 4QSXA 3JVJA 5E0RA 5E73A 2E3KA 5EU1A 5I7YA 4NYWA 5CUDA 5C7NA 5FE5A 5F36A 5F60A 2D9EA 5FFVA 5CP5A 5EWHA 3AQAA 5FE9A 5FBXA 5DFDA 4IOOA 4E96A 2OO1A 5L98A 5C89A 3ERRA 4MEQA 4KCXA 5DX4A 5E7DA 5G4RA 1WUMA 4O78A 5CQAA 4UIYA 3O35A 5L97A 5HFQA 5EVAA 2N9GA 4A9JA 4KV4A 5I80A 5LJ0A 4NS5A 5A5OA 5DYUA 2RNXA 3QZTA 3TLPA 2L85A 3QZSA 4NR9A 5LVRA 4AKHA 5C8GA 3IU6A 5CGPA 2WP1A 4YABA 4FLPA 2LSPB 4QYLA 4O7CA 3U5KA 1N72A 5FE4A 3MB3A 4YYDA 2YW5A 3UV4A 4C67A 3MB4A 5HQ6A 4XY8A 5EWWA 4QSWA 5A5RA 5IGLA 5L96A 4A9NA 2R0SA 4PCIA 4IORA 3SVHA 5A5PA 5C85A 2RO1A 5HQ7A 3NXBA 4Z93A 3P1FA 5E9MA 5A81A 4BW4A 5CTLA 5CS8A 5CRZA 4J1PA 3U5MA 5FFWA 4XYAA 4PTBA 4TZ2A 3MULA 4UYFA 5D3TA 4PS5A 5E9YA 4CUSA 5AD3A 4UIZA 1F68A 5I86A 1ZKRA
chains in the Genus database with same CATH topology
2RS9B 2F6NA 4OGJA 3U5OA 5JI8A 4A9OA 5L99A 4YYKA 4QSTA 4BJXA 5H1TA 5FE6A 5EWVA 4QNSA 5CQ5A 5CPEA 5ENFA 4O7EA 4TT4A 5LKXA 3UV5A 3JVKA 4WHWA 5H1VA 4CLBA 5F1LA 5EICA 5CQTA 4YC9A 3O34A 4ZQLA 3LQJA 5LVQA 2YEKA 5D3LA 5HRXA 4A9LA 4CFKA 4HXNA 5D7XA 5D3HA 5II2A 3O33A 5FH8A 5I1QA 4KV1A 4HXMA 5CY9A 5BT5A 2E7NA 4QSVA 5E74A 5EWCA 5D3SA 4J0RA 3S91A 2F6JA 5A83A 3LQHA 2YQDA 4NR7A 2D82A 4ZW1A 4NR4A 4YYNA 4XUAA 5I7XA 3MUKA 3UV2A 4TT2A 5EPRA 5F62A 2YEMA 5D25A 4A9KA 2E7OA 5CRMA 5CU8A 4GPJA 4TT6A 3GG3A 4NRBA 2DVVA 5ENEA 4QSUA 4CUTA 5JWMA 5AD2A 4O77A 5I83A 5DKHA 5A5QA 5HM0A 5DLXA 5ETBA 5F61A 5IGKA 4HBYA 5FH6A 3G0JA 4N4FA 3UVYA 4ALHA 4MENA 5KTXA 5HFRA 5FE7A 5CUEA 4QEVA 4YK0A 5HCLA 4XUBA 4YYMA 2FSAA 3DWYA 3U5JA 3K2JA 2H60A 4MR4A 2RI7A 4QYDA 5CQ4A 5I40A 4NYXA 4PKLA 5E9KA 4TZ8A 2I8NA 4UIVA 4CUPA 4O7BA 5HEMA 4O72A 5A5SA 4Z1QA 3QZVA 4UYGA 3O36A 5FE1A 5FG4A 4OUFA 5IBNA 5EP7A 4UITA 5DYXA 3SVFA 4O7AA 4HXKA 5KTUA 3MXFA 3P1CA 4N3WA 3AADA 4YY6A 5DW1A 5HRWA 2RFJA 5A82A 4A9FA 4ALGA 2L5EA 5DYAA 5DBMA 5EV9A 4WIVA 5IG6A 5C87A 4O74A 5HJCA 4UYDA 5DFCA 5CUGA 4TQNA 5D3JA 4UYFB 4QC3A 4Q0NA 1ZS5A 2R10A 5HQ5A 4QSQA 3UVDA 4Z6HA 2DVRA 5E9IA 2RNWA 5J0DA 5EK9A 4A9MA 4A9IA 2DVSA 4N4IA 4Q0OA 4MEOA 3DAIA 1JSPB 5FB0A 1X0JA 4HXOA 5CFWA 5CUCA 5D0CA 4WHUA 5H85A 4LZ2A 4YH4A 5HENA 5AMFA 2NXBA 2DATA 4QEWA 4F3IA 3JVMA 3UW9A 4QSPA 4TU4A 4TYLA 5LKTA 4BW3A 4QBMA 5E3DA 4LRGA 5CQ7A 5F5ZA 4O71A 3JVLA 4HXSA 5KO4A 3HMHA 5ENHA 4YATA 5A7CA 3U5PA 3U5LA 3HMEA 2L84A 4XY9A 4NYVA 5LKZA 4QUUA 4YH3A 5L8TA 5EISA 5DKCA 5G4SA 1JM4B 4NQMA 4QR4A 5H1UA 5E9VA 4ZC9A 3P1EA 5LUUA 4YAXA 4O76A 2R0YA 3P1DA 5D3RA 4IR6A 4OGIA 2KTBB 3FKMX 4HXRA 3UVXA 5EA1A 2G4AA 4YYJA 3ONIA 5LJ2A 5I29A 2GRCA 5ETDA 5E3GA 5C4QA 4IOQA 5CUBA 5DYCA 4QSSA 4UIUA 5E9LA 1WUGA 4UYEA 5CUAA 5LJ1A 5COIA 4PY6A 4LR6A 5ENJA 5A5NA 4QY4A 5HRVA 4IR4A 4BW1A 5L8UA 5D26A 4N4HA 5EGUA 4HXPA 4A9EA 3ZYUA 3RCWA 5CQ8A 4NUDA 4NXJA 5FE0A 5HLSA 4QEUA 3SVGA 4HBWA 4C66A 3O37A 4HBVA 4HBXA 4PCEA 4CURA 4DONA 5ENIA 5HELA 4QZSA 5F63A 5K29A 3U5NA 4MEPA 4MR3A 4Y03A 5EM3A 4RVRA 2YELA 4NR8A 4YYIA 5KHMA 5EWDA 4IR3A 4LZRA 4QB3A 4A9HA 2OSSA 5AMEA 2DWWA 4Z6IA 4UIXA 2R0VA 4CUQA 4NUEA 5F1HA 3IU5A 4YBMA 5TB6A 4LYIA 2OUOA 3P5OA 5D3PA 3LXJA 4YADA 5I89A 3LQIA 4LDFA 5II1A 4NRAA 2RNYA 4N4GA 5EQ1A 2WP2A 4CFLA 4HXLA 5BT4A 5KTWA 4YBSA 5DY7A 4CUUA 5FFYA 5FB1A 4MR5A 2YYNA 5EPBA 5TCMA 4YY4A 3LJWA 4NR5A 5CZGA 4YBTA 4UIWA 5DW2A 3HMFA 5ENGA 5FE3A 4YYGA 4NRCA 3UVWA 2I7KA 4LZSA 3Q2EA 5FDZA 4BHWA 5F2PA 5LKUA 3MQMA 5ENBA 5FE2A 5IIDA 2DKWA 5ENCA 5D3NA 5FG5A 5I88A 4J0SA 4Z1SA 5BT3A 4NUCA 4LYSA 5ACYA 4QUTA 3S92A 1E6IA 4J3IA 4CL9A 4O75A 5DKDA 4IR5A 4TTEA 4QR5A 4NQNA 5DFBA 5CQ6A 3D7CA 5FH7A 5F25A 5EPSA 2DVQA 3G0LA 5DLZA 5EI4A 4LC2A 5KU3A 4O70A 4UYHA 4AKNA 4O7FA 3I3JA 5CQ3A 5A85A 4QC1A 4LYWA 4BW2A 5FE8A 3Q2FA 4TS8A 4QSRA 4NR6A 5D24A 5F3AA 2YDWA 4TU6A 5IGNA 4MR6A 4QR3A 5FG6A 1EQFA 4X2IA 4YYHA 5IGMA 2MJVB 4QSXA 3JVJA 5E0RA 5E73A 2E3KA 5EU1A 5I7YA 4NYWA 5CUDA 5C7NA 5FE5A 5F36A 5F60A 2D9EA 5FFVA 5CP5A 5EWHA 3AQAA 5FE9A 5FBXA 5DFDA 4IOOA 4E96A 2OO1A 5L98A 5C89A 4MEQA 4KCXA 5DX4A 5E7DA 5G4RA 1WUMA 4O78A 5CQAA 4UIYA 3O35A 5L97A 5HFQA 5EVAA 2N9GA 4A9JA 4KV4A 5I80A 5LJ0A 4NS5A 5A5OA 5DYUA 2RNXA 3QZTA 3TLPA 2L85A 3QZSA 4NR9A 5LVRA 5C8GA 3IU6A 5CGPA 2WP1A 4YABA 4FLPA 2LSPB 4QYLA 4O7CA 3U5KA 1N72A 5FE4A 3MB3A 4YYDA 2YW5A 3UV4A 4C67A 3MB4A 5HQ6A 4XY8A 5EWWA 4QSWA 5A5RA 5IGLA 5L96A 4A9NA 2R0SA 4PCIA 4IORA 3SVHA 5A5PA 5C85A 2RO1A 5HQ7A 3NXBA 4Z93A 3P1FA 5E9MA 5A81A 4BW4A 5CTLA 5CS8A 5CRZA 4J1PA 3U5MA 5FFWA 4XYAA 4PTBA 4TZ2A 3MULA 4UYFA 5D3TA 4PS5A 5E9YA 4CUSA 5AD3A 4UIZA 1F68A 5I86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS9 B;  2F6N A;  4OGJ A;  3U5O A;  5JI8 A;  4A9O A;  5L99 A;  4YYK A;  4QST A;  4BJX A;  5H1T A;  5FE6 A;  5EWV A;  4QNS A;  5CQ5 A;  5CPE A;  5ENF A;  4O7E A;  4TT4 A;  5LKX A;  3UV5 A;  3JVK A;  4WHW A;  5H1V A;  4CLB A;  5F1L A;  5EIC A;  5CQT A;  4YC9 A;  3O34 A;  4ZQL A;  3LQJ A;  5LVQ A;  2YEK A;  5D3L A;  5HRX A;  4A9L A;  4CFK A;  4HXN A;  5D7X A;  5D3H A;  5II2 A;  3O33 A;  5FH8 A;  5I1Q A;  4KV1 A;  4HXM A;  5CY9 A;  5BT5 A;  2E7N A;  4QSV A;  5E74 A;  5EWC A;  5D3S A;  4J0R A;  3S91 A;  2F6J A;  5A83 A;  3LQH A;  2YQD A;  4NR7 A;  2D82 A;  4ZW1 A;  4NR4 A;  4YYN A;  4XUA A;  5I7X A;  3MUK A;  3UV2 A;  4TT2 A;  5EPR A;  5F62 A;  2YEM A;  5D25 A;  4A9K A;  2E7O A;  5CRM A;  5CU8 A;  4GPJ A;  4TT6 A;  3GG3 A;  4NRB A;  2DVV A;  5ENE A;  4QSU A;  4CUT A;  5JWM A;  5AD2 A;  4O77 A;  5I83 A;  5DKH A;  5A5Q A;  5HM0 A;  5DLX A;  5ETB A;  5F61 A;  5IGK A;  4HBY A;  5FH6 A;  3G0J A;  4N4F A;  3UVY A;  4ALH A;  4MEN A;  5KTX A;  5HFR A;  5FE7 A;  5CUE A;  4QEV A;  4YK0 A;  5HCL A;  4XUB A;  4YYM A;  2FSA A;  3DWY A;  3U5J A;  3K2J A;  2H60 A;  4MR4 A;  2RI7 A;  4QYD A;  5CQ4 A;  5I40 A;  4NYX A;  4PKL A;  5E9K A;  4TZ8 A;  2I8N A;  4UIV A;  4CUP A;  4O7B A;  5HEM A;  4O72 A;  5A5S A;  4Z1Q A;  3QZV A;  4UYG A;  3O36 A;  5FE1 A;  5FG4 A;  4OUF A;  5IBN A;  5EP7 A;  4UIT A;  5DYX A;  3SVF A;  4O7A A;  4HXK A;  5KTU A;  3MXF A;  3P1C A;  4N3W A;  3AAD A;  4YY6 A;  5DW1 A;  5HRW A;  2RFJ A;  5A82 A;  4A9F A;  4ALG A;  2L5E A;  5DYA A;  5DBM A;  5EV9 A;  4WIV A;  5IG6 A;  5C87 A;  4O74 A;  5HJC A;  4UYD A;  5DFC A;  5CUG A;  4TQN A;  5D3J A;  4UYF B;  4QC3 A;  4Q0N A;  1ZS5 A;  2R10 A;  5HQ5 A;  4QSQ A;  3UVD A;  4Z6H A;  2DVR A;  5E9I A;  2RNW A;  5J0D A;  5EK9 A;  4A9M A;  4A9I A;  2DVS A;  4N4I A;  4Q0O A;  4MEO A;  3DAI A;  1JSP B;  5FB0 A;  1X0J A;  4HXO A;  5CFW A;  5CUC A;  5D0C A;  4WHU A;  5H85 A;  4LZ2 A;  4YH4 A;  5HEN A;  5AMF A;  2NXB A;  2DAT A;  4QEW A;  4F3I A;  3JVM A;  3UW9 A;  4QSP A;  4TU4 A;  4TYL A;  5LKT A;  4BW3 A;  4QBM A;  5E3D A;  4LRG A;  5CQ7 A;  5F5Z A;  4O71 A;  3JVL A;  4HXS A;  5KO4 A;  3HMH A;  5ENH A;  4YAT A;  5A7C A;  3U5P A;  3U5L A;  3HME A;  2L84 A;  4XY9 A;  4NYV A;  5LKZ A;  4QUU A;  4YH3 A;  5L8T A;  5EIS A;  5DKC A;  5G4S A;  1JM4 B;  4NQM A;  4QR4 A;  5H1U A;  5E9V A;  4ZC9 A;  3P1E A;  5LUU A;  4YAX A;  4O76 A;  2R0Y A;  3P1D A;  5D3R A;  4IR6 A;  4OGI A;  2KTB B;  3FKM X;  4HXR A;  3UVX A;  5EA1 A;  2G4A A;  4YYJ A;  3ONI A;  5LJ2 A;  5I29 A;  2GRC A;  5ETD A;  5E3G A;  5C4Q A;  4IOQ A;  5CUB A;  5DYC A;  4QSS A;  4UIU A;  5E9L A;  1WUG A;  4UYE A;  5CUA A;  5LJ1 A;  5COI A;  4PY6 A;  4LR6 A;  5ENJ A;  5A5N A;  4QY4 A;  5HRV A;  4IR4 A;  4BW1 A;  5L8U A;  5D26 A;  4N4H A;  5EGU A;  4HXP A;  4A9E A;  3ZYU A;  3RCW A;  5CQ8 A;  4NUD A;  4NXJ A;  5FE0 A;  5HLS A;  4QEU A;  3SVG A;  4HBW A;  4C66 A;  3O37 A;  4HBV A;  4HBX A;  4PCE A;  4CUR A;  4DON A;  5ENI A;  5HEL A;  4QZS A;  5F63 A;  5K29 A;  3U5N A;  4MEP A;  4MR3 A;  4Y03 A;  5EM3 A;  4RVR A;  2YEL A;  4NR8 A;  4YYI A;  5KHM A;  5EWD A;  4IR3 A;  4LZR A;  4QB3 A;  4A9H A;  2OSS A;  5AME A;  2DWW A;  4Z6I A;  4UIX A;  2R0V A;  4CUQ A;  4NUE A;  5F1H A;  3IU5 A;  4YBM A;  5TB6 A;  4LYI A;  2OUO A;  3P5O A;  5D3P A;  3LXJ A;  4YAD A;  5I89 A;  3LQI A;  4LDF A;  5II1 A;  4NRA A;  2RNY A;  4N4G A;  5EQ1 A;  2WP2 A;  4CFL A;  4HXL A;  5BT4 A;  5KTW A;  4YBS A;  5DY7 A;  4CUU A;  5FFY A;  5FB1 A;  4MR5 A;  2YYN A;  5EPB A;  5TCM A;  4YY4 A;  3LJW A;  4NR5 A;  5CZG A;  4YBT A;  4UIW A;  5DW2 A;  3HMF A;  5ENG A;  5FE3 A;  4YYG A;  4NRC A;  3UVW A;  2I7K A;  4LZS A;  3Q2E A;  5FDZ A;  4BHW A;  5F2P A;  5LKU A;  3MQM A;  5ENB A;  5FE2 A;  5IID A;  2DKW A;  5ENC A;  5D3N A;  5FG5 A;  5I88 A;  4J0S A;  4Z1S A;  5BT3 A;  4NUC A;  4LYS A;  5ACY A;  4QUT A;  3S92 A;  1E6I A;  4J3I A;  4CL9 A;  4O75 A;  5DKD A;  4IR5 A;  4TTE A;  4QR5 A;  4NQN A;  5DFB A;  5CQ6 A;  3D7C A;  5FH7 A;  5F25 A;  5EPS A;  2DVQ A;  3G0L A;  5DLZ A;  5EI4 A;  4LC2 A;  5KU3 A;  4O70 A;  4UYH A;  4AKN A;  4O7F A;  3I3J A;  5CQ3 A;  5A85 A;  4QC1 A;  4LYW A;  4BW2 A;  5FE8 A;  3Q2F A;  4TS8 A;  4QSR A;  4NR6 A;  5D24 A;  5F3A A;  2YDW A;  4TU6 A;  5IGN A;  4MR6 A;  4QR3 A;  5FG6 A;  1EQF A;  4X2I A;  4YYH A;  5IGM A;  2MJV B;  4QSX A;  3JVJ A;  5E0R A;  5E73 A;  2E3K A;  5EU1 A;  5I7Y A;  4NYW A;  5CUD A;  5C7N A;  5FE5 A;  5F36 A;  5F60 A;  2D9E A;  5FFV A;  5CP5 A;  5EWH A;  3AQA A;  5FE9 A;  5FBX A;  5DFD A;  4IOO A;  4E96 A;  2OO1 A;  5L98 A;  5C89 A;  4MEQ A;  4KCX A;  5DX4 A;  5E7D A;  5G4R A;  1WUM A;  4O78 A;  5CQA A;  4UIY A;  3O35 A;  5L97 A;  5HFQ A;  5EVA A;  2N9G A;  4A9J A;  4KV4 A;  5I80 A;  5LJ0 A;  4NS5 A;  5A5O A;  5DYU A;  2RNX A;  3QZT A;  3TLP A;  2L85 A;  3QZS A;  4NR9 A;  5LVR A;  5C8G A;  3IU6 A;  5CGP A;  2WP1 A;  4YAB A;  4FLP A;  2LSP B;  4QYL A;  4O7C A;  3U5K A;  1N72 A;  5FE4 A;  3MB3 A;  4YYD A;  2YW5 A;  3UV4 A;  4C67 A;  3MB4 A;  5HQ6 A;  4XY8 A;  5EWW A;  4QSW A;  5A5R A;  5IGL A;  5L96 A;  4A9N A;  2R0S A;  4PCI A;  4IOR A;  3SVH A;  5A5P A;  5C85 A;  2RO1 A;  5HQ7 A;  3NXB A;  4Z93 A;  3P1F A;  5E9M A;  5A81 A;  4BW4 A;  5CTL A;  5CS8 A;  5CRZ A;  4J1P A;  3U5M A;  5FFW A;  4XYA A;  4PTB A;  4TZ2 A;  3MUL A;  4UYF A;  5D3T A;  4PS5 A;  5E9Y A;  4CUS A;  5AD3 A;  4UIZ A;  1F68 A;  5I86 A; 
#chains in the Genus database with same CATH topology
 2RS9 B;  2F6N A;  4OGJ A;  3U5O A;  5JI8 A;  4A9O A;  5L99 A;  4YYK A;  4QST A;  4BJX A;  5H1T A;  5FE6 A;  5EWV A;  4QNS A;  5CQ5 A;  5CPE A;  5ENF A;  4O7E A;  4TT4 A;  5LKX A;  3UV5 A;  3JVK A;  4WHW A;  5H1V A;  4CLB A;  5F1L A;  5EIC A;  5CQT A;  4YC9 A;  3O34 A;  4ZQL A;  3LQJ A;  5LVQ A;  2YEK A;  5D3L A;  5HRX A;  4A9L A;  4CFK A;  4HXN A;  5D7X A;  5D3H A;  5II2 A;  3O33 A;  5FH8 A;  5I1Q A;  4KV1 A;  4HXM A;  5CY9 A;  5BT5 A;  2E7N A;  4QSV A;  5E74 A;  5EWC A;  5D3S A;  4J0R A;  3S91 A;  2F6J A;  5A83 A;  3LQH A;  2YQD A;  4NR7 A;  2D82 A;  4ZW1 A;  4NR4 A;  4YYN A;  4XUA A;  5I7X A;  3MUK A;  3UV2 A;  4TT2 A;  5EPR A;  5F62 A;  2YEM A;  5D25 A;  4A9K A;  2E7O A;  5CRM A;  5CU8 A;  4GPJ A;  4TT6 A;  3GG3 A;  4NRB A;  2DVV A;  5ENE A;  4QSU A;  4CUT A;  5JWM A;  5AD2 A;  4O77 A;  5I83 A;  5DKH A;  5A5Q A;  5HM0 A;  5DLX A;  5ETB A;  5F61 A;  5IGK A;  4HBY A;  5FH6 A;  3G0J A;  4N4F A;  3UVY A;  4ALH A;  4MEN A;  5KTX A;  5HFR A;  5FE7 A;  5CUE A;  4QEV A;  4YK0 A;  5HCL A;  4XUB A;  4YYM A;  2FSA A;  3DWY A;  3U5J A;  3K2J A;  2H60 A;  4MR4 A;  2RI7 A;  4QYD A;  5CQ4 A;  5I40 A;  4NYX A;  4PKL A;  5E9K A;  4TZ8 A;  2I8N A;  4UIV A;  4CUP A;  4O7B A;  5HEM A;  4O72 A;  5A5S A;  4Z1Q A;  3QZV A;  4UYG A;  3O36 A;  5FE1 A;  5FG4 A;  4OUF A;  5IBN A;  5EP7 A;  4UIT A;  5DYX A;  3SVF A;  4O7A A;  4HXK A;  5KTU A;  3MXF A;  3P1C A;  4N3W A;  3AAD A;  4YY6 A;  5DW1 A;  5HRW A;  2RFJ A;  5A82 A;  4A9F A;  4ALG A;  2L5E A;  5DYA A;  5DBM A;  5EV9 A;  4WIV A;  5IG6 A;  5C87 A;  4O74 A;  5HJC A;  4UYD A;  5DFC A;  5CUG A;  4TQN A;  5D3J A;  4UYF B;  4QC3 A;  4AI6 A;  4Q0N A;  1ZS5 A;  2R10 A;  5HQ5 A;  4QSQ A;  3UVD A;  4Z6H A;  2DVR A;  5E9I A;  2RNW A;  5J0D A;  5EK9 A;  4A9M A;  4A9I A;  2DVS A;  4N4I A;  4Q0O A;  4MEO A;  3DAI A;  1JSP B;  5FB0 A;  1X0J A;  4HXO A;  5CFW A;  5CUC A;  5D0C A;  4WHU A;  5H85 A;  4LZ2 A;  4YH4 A;  5HEN A;  5AMF A;  2NXB A;  2DAT A;  4QEW A;  4F3I A;  3JVM A;  3UW9 A;  4QSP A;  4TU4 A;  4TYL A;  5LKT A;  4BW3 A;  4QBM A;  5E3D A;  4LRG A;  5CQ7 A;  5F5Z A;  4O71 A;  3JVL A;  4HXS A;  5KO4 A;  3VKG A;  3HMH A;  5ENH A;  4YAT A;  5A7C A;  3U5P A;  3U5L A;  3HME A;  2L84 A;  4XY9 A;  4NYV A;  5LKZ A;  4QUU A;  4YH3 A;  5L8T A;  5EIS A;  5DKC A;  5G4S A;  1JM4 B;  4NQM A;  4QR4 A;  5H1U A;  5E9V A;  4ZC9 A;  3P1E A;  5LUU A;  4YAX A;  4O76 A;  2R0Y A;  3P1D A;  5D3R A;  4IR6 A;  4OGI A;  2KTB B;  3FKM X;  4HXR A;  3UVX A;  3D1D A;  2G4A A;  5EA1 A;  3ONI A;  4YYJ A;  5LJ2 A;  5I29 A;  2GRC A;  5ETD A;  5E3G A;  5C4Q A;  3D1B A;  4IOQ A;  5CUB A;  5DYC A;  4QSS A;  4UIU A;  5E9L A;  1WUG A;  1PUO A;  4UYE A;  5CUA A;  5LJ1 A;  5COI A;  4PY6 A;  4LR6 A;  5ENJ A;  5A5N A;  4QY4 A;  5HRV A;  4IR4 A;  4BW1 A;  5L8U A;  5D26 A;  4N4H A;  5EGU A;  4HXP A;  4A9E A;  3ZYU A;  3RCW A;  5CQ8 A;  4NUD A;  4NXJ A;  5FE0 A;  5HLS A;  4QEU A;  3SVG A;  4HBW A;  4C66 A;  3O37 A;  4HBV A;  4HBX A;  4PCE A;  4CUR A;  4DON A;  5ENI A;  5HEL A;  4QZS A;  5F63 A;  5K29 A;  3U5N A;  4MEP A;  4MR3 A;  4Y03 A;  2EJN A;  5EM3 A;  4RVR A;  2YEL A;  4NR8 A;  4YYI A;  5KHM A;  5EWD A;  4IR3 A;  4LZR A;  4QB3 A;  4A9H A;  2OSS A;  5AME A;  2DWW A;  4Z6I A;  4UIX A;  2R0V A;  4CUQ A;  4NUE A;  5F1H A;  3IU5 A;  4YBM A;  5TB6 A;  4LYI A;  2OUO A;  3P5O A;  5D3P A;  3LXJ A;  4YAD A;  5I89 A;  3LQI A;  4LDF A;  5II1 A;  4NRA A;  2RNY A;  4N4G A;  5EQ1 A;  2WP2 A;  4CFL A;  4HXL A;  5BT4 A;  5KTW A;  4YBS A;  5DY7 A;  4CUU A;  5FFY A;  5FB1 A;  4MR5 A;  2YYN A;  5EPB A;  5TCM A;  4YY4 A;  3LJW A;  4NR5 A;  4AKG A;  5CZG A;  4YBT A;  4UIW A;  5DW2 A;  3HMF A;  5ENG A;  5FE3 A;  4YYG A;  4NRC A;  4AKI A;  3UVW A;  3VKH A;  2I7K A;  4LZS A;  3Q2E A;  5FDZ A;  4BHW A;  5F2P A;  5LKU A;  3MQM A;  5ENB A;  5FE2 A;  5IID A;  2DKW A;  5ENC A;  5D3N A;  5FG5 A;  5I88 A;  4J0S A;  4Z1S A;  5BT3 A;  4NUC A;  4LYS A;  5ACY A;  4QUT A;  3S92 A;  1E6I A;  4J3I A;  4CL9 A;  4O75 A;  5DKD A;  4IR5 A;  4TTE A;  4QR5 A;  4NQN A;  5DFB A;  5CQ6 A;  3D7C A;  5FH7 A;  5F25 A;  5EPS A;  2DVQ A;  3G0L A;  5DLZ A;  5EI4 A;  4LC2 A;  5KU3 A;  4O70 A;  4UYH A;  4AKN A;  4O7F A;  3I3J A;  5CQ3 A;  5A85 A;  4QC1 A;  4LYW A;  4BW2 A;  5FE8 A;  3Q2F A;  4TS8 A;  4QSR A;  4NR6 A;  5D24 A;  5F3A A;  2YDW A;  4TU6 A;  5IGN A;  4MR6 A;  4QR3 A;  5FG6 A;  1EQF A;  4X2I A;  4YYH A;  5IGM A;  2MJV B;  4QSX A;  3JVJ A;  5E0R A;  5E73 A;  2E3K A;  5EU1 A;  5I7Y A;  4NYW A;  5CUD A;  5C7N A;  5FE5 A;  5F36 A;  5F60 A;  2D9E A;  5FFV A;  5CP5 A;  5EWH A;  3AQA A;  5FE9 A;  5FBX A;  5DFD A;  4IOO A;  4E96 A;  2OO1 A;  5L98 A;  5C89 A;  3ERR A;  4MEQ A;  4KCX A;  5DX4 A;  5E7D A;  5G4R A;  1WUM A;  4O78 A;  5CQA A;  4UIY A;  3O35 A;  5L97 A;  5HFQ A;  5EVA A;  2N9G A;  4A9J A;  4KV4 A;  5I80 A;  5LJ0 A;  4NS5 A;  5A5O A;  5DYU A;  2RNX A;  3QZT A;  3TLP A;  2L85 A;  3QZS A;  4NR9 A;  5LVR A;  4AKH A;  5C8G A;  3IU6 A;  5CGP A;  2WP1 A;  4YAB A;  4FLP A;  2LSP B;  4QYL A;  4O7C A;  3U5K A;  1N72 A;  5FE4 A;  3MB3 A;  4YYD A;  2YW5 A;  3UV4 A;  4C67 A;  3MB4 A;  5HQ6 A;  4XY8 A;  5EWW A;  4QSW A;  5A5R A;  5IGL A;  5L96 A;  4A9N A;  2R0S A;  4PCI A;  4IOR A;  3SVH A;  5A5P A;  5C85 A;  2RO1 A;  5HQ7 A;  3NXB A;  4Z93 A;  3P1F A;  5E9M A;  5A81 A;  4BW4 A;  5CTL A;  5CS8 A;  5CRZ A;  4J1P A;  3U5M A;  5FFW A;  4XYA A;  4PTB A;  4TZ2 A;  3MUL A;  4UYF A;  5D3T A;  4PS5 A;  5E9Y A;  4CUS A;  5AD3 A;  4UIZ A;  1F68 A;  5I86 A;  1ZKR A; 
#chains in the Genus database with same CATH homology
 2RS9 B;  2F6N A;  4OGJ A;  3U5O A;  5JI8 A;  4A9O A;  5L99 A;  4YYK A;  4QST A;  4BJX A;  5H1T A;  5FE6 A;  5EWV A;  4QNS A;  5CQ5 A;  5CPE A;  5ENF A;  4O7E A;  4TT4 A;  5LKX A;  3UV5 A;  3JVK A;  4WHW A;  5H1V A;  4CLB A;  5F1L A;  5EIC A;  5CQT A;  4YC9 A;  3O34 A;  4ZQL A;  3LQJ A;  5LVQ A;  2YEK A;  5D3L A;  5HRX A;  4A9L A;  4CFK A;  4HXN A;  5D7X A;  5D3H A;  5II2 A;  3O33 A;  5FH8 A;  5I1Q A;  4KV1 A;  4HXM A;  5CY9 A;  5BT5 A;  2E7N A;  4QSV A;  5E74 A;  5EWC A;  5D3S A;  4J0R A;  3S91 A;  2F6J A;  5A83 A;  3LQH A;  2YQD A;  4NR7 A;  2D82 A;  4ZW1 A;  4NR4 A;  4YYN A;  4XUA A;  5I7X A;  3MUK A;  3UV2 A;  4TT2 A;  5EPR A;  5F62 A;  2YEM A;  5D25 A;  4A9K A;  2E7O A;  5CRM A;  5CU8 A;  4GPJ A;  4TT6 A;  3GG3 A;  4NRB A;  2DVV A;  5ENE A;  4QSU A;  4CUT A;  5JWM A;  5AD2 A;  4O77 A;  5I83 A;  5DKH A;  5A5Q A;  5HM0 A;  5DLX A;  5ETB A;  5F61 A;  5IGK A;  4HBY A;  5FH6 A;  3G0J A;  4N4F A;  3UVY A;  4ALH A;  4MEN A;  5KTX A;  5HFR A;  5FE7 A;  5CUE A;  4QEV A;  4YK0 A;  5HCL A;  4XUB A;  4YYM A;  2FSA A;  3DWY A;  3U5J A;  3K2J A;  2H60 A;  4MR4 A;  2RI7 A;  4QYD A;  5CQ4 A;  5I40 A;  4NYX A;  4PKL A;  5E9K A;  4TZ8 A;  2I8N A;  4UIV A;  4CUP A;  4O7B A;  5HEM A;  4O72 A;  5A5S A;  4Z1Q A;  3QZV A;  4UYG A;  3O36 A;  5FE1 A;  5FG4 A;  4OUF A;  5IBN A;  5EP7 A;  4UIT A;  5DYX A;  3SVF A;  4O7A A;  4HXK A;  5KTU A;  3MXF A;  3P1C A;  4N3W A;  3AAD A;  4YY6 A;  5DW1 A;  5HRW A;  2RFJ A;  5A82 A;  4A9F A;  4ALG A;  2L5E A;  5DYA A;  5DBM A;  5EV9 A;  4WIV A;  5IG6 A;  5C87 A;  4O74 A;  5HJC A;  4UYD A;  5DFC A;  5CUG A;  4TQN A;  5D3J A;  4UYF B;  4QC3 A;  4Q0N A;  1ZS5 A;  2R10 A;  5HQ5 A;  4QSQ A;  3UVD A;  4Z6H A;  2DVR A;  5E9I A;  2RNW A;  5J0D A;  5EK9 A;  4A9M A;  4A9I A;  2DVS A;  4N4I A;  4Q0O A;  4MEO A;  3DAI A;  1JSP B;  5FB0 A;  1X0J A;  4HXO A;  5CFW A;  5CUC A;  5D0C A;  4WHU A;  5H85 A;  4LZ2 A;  4YH4 A;  5HEN A;  5AMF A;  2NXB A;  2DAT A;  4QEW A;  4F3I A;  3JVM A;  3UW9 A;  4QSP A;  4TU4 A;  4TYL A;  5LKT A;  4BW3 A;  4QBM A;  5E3D A;  4LRG A;  5CQ7 A;  5F5Z A;  4O71 A;  3JVL A;  4HXS A;  5KO4 A;  3HMH A;  5ENH A;  4YAT A;  5A7C A;  3U5P A;  3U5L A;  3HME A;  2L84 A;  4XY9 A;  4NYV A;  5LKZ A;  4QUU A;  4YH3 A;  5L8T A;  5EIS A;  5DKC A;  5G4S A;  1JM4 B;  4NQM A;  4QR4 A;  5H1U A;  5E9V A;  4ZC9 A;  3P1E A;  5LUU A;  4YAX A;  4O76 A;  2R0Y A;  3P1D A;  5D3R A;  4IR6 A;  4OGI A;  2KTB B;  3FKM X;  4HXR A;  3UVX A;  5EA1 A;  2G4A A;  4YYJ A;  3ONI A;  5LJ2 A;  5I29 A;  2GRC A;  5ETD A;  5E3G A;  5C4Q A;  4IOQ A;  5CUB A;  5DYC A;  4QSS A;  4UIU A;  5E9L A;  1WUG A;  4UYE A;  5CUA A;  5LJ1 A;  5COI A;  4PY6 A;  4LR6 A;  5ENJ A;  5A5N A;  4QY4 A;  5HRV A;  4IR4 A;  4BW1 A;  5L8U A;  5D26 A;  4N4H A;  5EGU A;  4HXP A;  4A9E A;  3ZYU A;  3RCW A;  5CQ8 A;  4NUD A;  4NXJ A;  5FE0 A;  5HLS A;  4QEU A;  3SVG A;  4HBW A;  4C66 A;  3O37 A;  4HBV A;  4HBX A;  4PCE A;  4CUR A;  4DON A;  5ENI A;  5HEL A;  4QZS A;  5F63 A;  5K29 A;  3U5N A;  4MEP A;  4MR3 A;  4Y03 A;  5EM3 A;  4RVR A;  2YEL A;  4NR8 A;  4YYI A;  5KHM A;  5EWD A;  4IR3 A;  4LZR A;  4QB3 A;  4A9H A;  2OSS A;  5AME A;  2DWW A;  4Z6I A;  4UIX A;  2R0V A;  4CUQ A;  4NUE A;  5F1H A;  3IU5 A;  4YBM A;  5TB6 A;  4LYI A;  2OUO A;  3P5O A;  5D3P A;  3LXJ A;  4YAD A;  5I89 A;  3LQI A;  4LDF A;  5II1 A;  4NRA A;  2RNY A;  4N4G A;  5EQ1 A;  2WP2 A;  4CFL A;  4HXL A;  5BT4 A;  5KTW A;  4YBS A;  5DY7 A;  4CUU A;  5FFY A;  5FB1 A;  4MR5 A;  2YYN A;  5EPB A;  5TCM A;  4YY4 A;  3LJW A;  4NR5 A;  5CZG A;  4YBT A;  4UIW A;  5DW2 A;  3HMF A;  5ENG A;  5FE3 A;  4YYG A;  4NRC A;  3UVW A;  2I7K A;  4LZS A;  3Q2E A;  5FDZ A;  4BHW A;  5F2P A;  5LKU A;  3MQM A;  5ENB A;  5FE2 A;  5IID A;  2DKW A;  5ENC A;  5D3N A;  5FG5 A;  5I88 A;  4J0S A;  4Z1S A;  5BT3 A;  4NUC A;  4LYS A;  5ACY A;  4QUT A;  3S92 A;  1E6I A;  4J3I A;  4CL9 A;  4O75 A;  5DKD A;  4IR5 A;  4TTE A;  4QR5 A;  4NQN A;  5DFB A;  5CQ6 A;  3D7C A;  5FH7 A;  5F25 A;  5EPS A;  2DVQ A;  3G0L A;  5DLZ A;  5EI4 A;  4LC2 A;  5KU3 A;  4O70 A;  4UYH A;  4AKN A;  4O7F A;  3I3J A;  5CQ3 A;  5A85 A;  4QC1 A;  4LYW A;  4BW2 A;  5FE8 A;  3Q2F A;  4TS8 A;  4QSR A;  4NR6 A;  5D24 A;  5F3A A;  2YDW A;  4TU6 A;  5IGN A;  4MR6 A;  4QR3 A;  5FG6 A;  1EQF A;  4X2I A;  4YYH A;  5IGM A;  2MJV B;  4QSX A;  3JVJ A;  5E0R A;  5E73 A;  2E3K A;  5EU1 A;  5I7Y A;  4NYW A;  5CUD A;  5C7N A;  5FE5 A;  5F36 A;  5F60 A;  2D9E A;  5FFV A;  5CP5 A;  5EWH A;  3AQA A;  5FE9 A;  5FBX A;  5DFD A;  4IOO A;  4E96 A;  2OO1 A;  5L98 A;  5C89 A;  4MEQ A;  4KCX A;  5DX4 A;  5E7D A;  5G4R A;  1WUM A;  4O78 A;  5CQA A;  4UIY A;  3O35 A;  5L97 A;  5HFQ A;  5EVA A;  2N9G A;  4A9J A;  4KV4 A;  5I80 A;  5LJ0 A;  4NS5 A;  5A5O A;  5DYU A;  2RNX A;  3QZT A;  3TLP A;  2L85 A;  3QZS A;  4NR9 A;  5LVR A;  5C8G A;  3IU6 A;  5CGP A;  2WP1 A;  4YAB A;  4FLP A;  2LSP B;  4QYL A;  4O7C A;  3U5K A;  1N72 A;  5FE4 A;  3MB3 A;  4YYD A;  2YW5 A;  3UV4 A;  4C67 A;  3MB4 A;  5HQ6 A;  4XY8 A;  5EWW A;  4QSW A;  5A5R A;  5IGL A;  5L96 A;  4A9N A;  2R0S A;  4PCI A;  4IOR A;  3SVH A;  5A5P A;  5C85 A;  2RO1 A;  5HQ7 A;  3NXB A;  4Z93 A;  3P1F A;  5E9M A;  5A81 A;  4BW4 A;  5CTL A;  5CS8 A;  5CRZ A;  4J1P A;  3U5M A;  5FFW A;  4XYA A;  4PTB A;  4TZ2 A;  3MUL A;  4UYF A;  5D3T A;  4PS5 A;  5E9Y A;  4CUS A;  5AD3 A;  4UIZ A;  1F68 A;  5I86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...