3SVHA

Crystal structure of the bromdomain of human crebbp in complex with a 3,5-dimethylisoxazol ligand
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords CREB-binding protein
publication title Crystal Structure of the bromdomain of human CREBBP in complex with a 3,5-dimethylisoxazol ligand
rcsb
source organism Homo sapiens
total genus 43
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3svhA00
5DKHA 5E73A 5AD3A 5KHMA 4QC1A 3U5KA 5CQTA 5ENBA 5EWCA 5F60A 5HELA 4MR3A 4UYEA 5C89A 5HRXA 4LRGA 5DBMA 2L84A 3JVLA 4QEVA 4YK0A 4QSSA 5E9YA 5E7DA 4CL9A 5EK9A 5HEMA 5KTXA 4QB3A 3MQMA 4J0RA 4TT6A 5FE4A 4UYHA 5CUGA 3U5LA 5DYXA 2RNWA 2RNXA 3UVDA 4UIUA 5I88A 4QR3A 2RS9B 2R0VA 4NS5A 5CFWA 3G0JA 2MJVB 5HFQA 4MEQA 4NYWA 5JI8A 4UYFA 5I7XA 3ONIA 4YABA 3P1EA 4A9JA 5IG6A 4TT2A 3I3JA 5AMFA 4RVRA 2OUOA 5I40A 5CTLA 4NRBA 5CY9A 4YBMA 4YYKA 4KV1A 4QSQA 3U5MA 5HJCA 4BW4A 4LYWA 3LQIA 4YH3A 5KTWA 4NUEA 3JVMA 4QSTA 1JM4B 3QZSA 4NR9A 5DW2A 5ENEA 4IOOA 5CQ4A 3O33A 4NRAA 4CUPA 3Q2FA 3MB4A 5HQ6A 4O70A 4XUAA 5DYUA 4OGJA 5FFWA 5ACYA 5C4QA 5DYCA 5A5NA 5G4SA 4O7FA 5AD2A 2DVSA 2RFJA 4PTBA 5C7NA 4LZRA 4LYSA 4J3IA 5LJ0A 4O76A 4YH4A 5DY7A 5I86A 2RO1A 4AKNA 5D7XA 2N9GA 4O7CA 5L99A 3S91A 5ENHA 4TTEA 4WHWA 2R0SA 2DATA 5DLZA 3P1DA 3MB3A 4NQMA 4YBSA 4YYIA 2D9EA 5H1VA 4UITA 4UYFB 4TZ8A 4LR6A 4QSWA 4N3WA 4O72A 5DW1A 4CUQA 5A5OA 3UV2A 3QZVA 2F6JA 4LC2A 3UVXA 4J1PA 2YEMA 4GPJA 4NQNA 5LKUA 4QEWA 5HRWA 1JSPB 4HXPA 5H85A 5C85A 5ENGA 5FE0A 5A5RA 4KV4A 2E7NA 2DKWA 3U5PA 4MR6A 5CPEA 4Z6IA 4O71A 5A5PA 2R0YA 4QY4A 5CU8A 5F2PA 4YATA 5DX4A 1N72A 5FB0A 5I29A 3MXFA 4Q0NA 4UIYA 5ENCA 5F1HA 2OSSA 4BHWA 3U5NA 3P1FA 3DWYA 4TZ2A 5EPBA 3LJWA 5EICA 5K29A 3IU6A 4O7BA 5CRMA 4A9IA 5FG6A 3GG3A 5IGMA 4PS5A 5FE3A 4MR4A 5E0RA 4Z6HA 2OO1A 4Z1QA 5E9KA 2YW5A 2R10A 3AADA 5EWHA 4QUTA 1WUMA 4A9NA 5CQ7A 5HRVA 5FE1A 5FH6A 4BJXA 4UYGA 4LZ2A 4N4GA 4NUCA 4HBYA 5FE9A 4HXLA 3O36A 3SVHA 5I80A 5C87A 4IOQA 3LQHA 4A9HA 4QSVA 4BW3A 4Z1SA 5I1QA 5IGNA 4HBWA 5CQ5A 2E3KA 5J0DA 5LKZA 3AQAA 4HBXA 2D82A 5TCMA 5CRZA 2H60A 5CUCA 3O35A 4N4IA 5D3NA 3S92A 5HM0A 3UV4A 5DFBA 3O37A 5BT3A 5CQ3A 5DFDA 5EPSA 5BT5A 3K2JA 5ENJA 3QZTA 2KTBB 5F3AA 4NXJA 1ZS5A 3DAIA 5D3SA 5LVQA 2L85A 4HXKA 4QSUA 4A9MA 5D3RA 5FE5A 4QR5A 5CQ6A 5DLXA 3MULA 5D3JA 4CUUA 5A82A 4FLPA 4YYHA 2LSPB 4XY8A 4TU6A 4YADA 4TT4A 4MEPA 4O77A 4XUBA 4QYLA 4O7AA 4TU4A 4UIVA 5D25A 4UYDA 5D3LA 4MR5A 4YYMA 5DFCA 5A7CA 4Z93A 4UIZA 5HQ7A 5IIDA 5II1A 2WP1A 5F63A 4YYNA 2YDWA 5F5ZA 3Q2EA 5E3GA 5L8UA 5EA1A 2YQDA 4Q0OA 4CURA 2RNYA 5CUAA 4N4HA 4A9FA 1EQFA 5EPRA 4NYVA 5FFYA 3P5OA 4HXNA 5HENA 4MENA 5FDZA 4TQNA 5HCLA 5FE8A 2YYNA 2DVQA 5EWWA 4QEUA 4A9KA 5LKXA 5D26A 4QBMA 2GRCA 5DYAA 5HFRA 4YY6A 2L5EA 4CUSA 4O75A 5COIA 4NR6A 5A5QA 4ZW1A 5L8TA 5A85A 4ALGA 4OUFA 3G0LA 4C66A 4X2IA 4HXMA 4QZSA 3LQJA 3UVWA 4CFKA 4MEOA 5ENFA 4O78A 5I89A 2I7KA 4HXRA 5CUEA 4CUTA 5D24A 3SVGA 5EWDA 4TYLA 5FG5A 4LYIA 5E9MA 5EM3A 3TLPA 5LVRA 3SVFA 5HQ5A 3UW9A 5BT4A 5D3HA 4HBVA 1WUGA 4WHUA 2I8NA 2WP2A 4N4FA 4PKLA 4E96A 5LJ1A 4NR7A 5F62A 3UVYA 4PY6A 5EU1A 5I83A 3FKMX 3HMEA 4QSPA 3P1CA 4QUUA 2DWWA 5JWMA 5D3PA 5ETBA 4C67A 5FG4A 4XYAA 2YEKA 4YYGA 4A9OA 5FBXA 5EQ1A 5E9VA 4ZC9A 5LUUA 4HXSA 4O74A 5CS8A 1X0JA 4YYDA 5AMEA 4PCEA 5IGKA 4UIWA 2YELA 4PCIA 2E7OA 5F61A 4TS8A 4NYXA 5EI4A 5CGPA 4YYJA 4YC9A 4CLBA 5IBNA 5KTUA 2FSAA 3HMFA 4QSRA 4F3IA 3JVKA 4ZQLA 3UV5A 4QR4A 2DVRA 4LDFA 5H1TA 5A5SA 4A9EA 4IR4A 5CQ8A 3HMHA 4J0SA 3U5OA 4DONA 5LKTA 3NXBA 5EISA 5KU3A 5FE6A 3RCWA 5CUBA 5EP7A 3ZYUA 2G4AA 5EVAA 4BW1A 5A83A 5II2A 4NRCA 4NR5A 4QYDA 4KCXA 5CZGA 5TB6A 5D3TA 3O34A 5F25A 4HXOA 3LXJA 5EWVA 5L98A 5E74A 4QNSA 5E9LA 4Y03A 5HLSA 4O7EA 4OGIA 5E9IA 1E6IA 5DKCA 3U5JA 4IR6A 4WIVA 4XY9A 5LJ2A 3D7CA 5DKDA 4A9LA 4NR8A 4IR5A 5L96A 5C8GA 5KO4A 2DVVA 5I7YA 3IU5A 4BW2A 5CUDA 4NUDA 5E3DA 5FE7A 5ENIA 5EGUA 5A81A 4UIXA 5FH7A 4CFLA 4QC3A 5FB1A 5D0CA 5F1LA 5F36A 5G4RA 2NXBA 2RI7A 4ALHA 5ETDA 4IORA 4QSXA 2F6NA 4YAXA 5FFVA 5IGLA 5L97A 4NR4A 3JVJA 1F68A 4LZSA 5H1UA 5FH8A 4YY4A 5FE2A 5CP5A 5EV9A 5CQAA 3MUKA 4IR3A 4YBTA
chains in the Genus database with same CATH superfamily
5DKHA 5E73A 5AD3A 5KHMA 4QC1A 3U5KA 5CQTA 5ENBA 5EWCA 5F60A 5HELA 4AKGA 4MR3A 4UYEA 5C89A 5HRXA 4LRGA 5DBMA 2L84A 3JVLA 4QEVA 4YK0A 4QSSA 5E9YA 5E7DA 4CL9A 5EK9A 5HEMA 5KTXA 4QB3A 3MQMA 4J0RA 4TT6A 3VKGA 5FE4A 4UYHA 5CUGA 1ZKRA 3U5LA 5DYXA 2RNWA 2RNXA 3UVDA 4UIUA 5I88A 4QR3A 2RS9B 2R0VA 4NS5A 5CFWA 3G0JA 2MJVB 5HFQA 4MEQA 4NYWA 5JI8A 4AKIA 4UYFA 5I7XA 3ONIA 4YABA 3P1EA 4A9JA 5IG6A 4TT2A 3I3JA 5AMFA 4RVRA 2OUOA 5I40A 5CTLA 4NRBA 5CY9A 4YBMA 4YYKA 4KV1A 4QSQA 3U5MA 5HJCA 4BW4A 4LYWA 3LQIA 4YH3A 5KTWA 2EJNA 4NUEA 3JVMA 4QSTA 1JM4B 3QZSA 4NR9A 5DW2A 5ENEA 4IOOA 5CQ4A 3O33A 4NRAA 4CUPA 3Q2FA 3MB4A 5HQ6A 4O70A 4XUAA 5DYUA 4OGJA 5FFWA 5ACYA 5C4QA 5DYCA 5A5NA 5G4SA 4O7FA 5AD2A 2DVSA 2RFJA 4PTBA 5C7NA 4LZRA 4LYSA 4J3IA 5LJ0A 4O76A 4YH4A 5DY7A 5I86A 2RO1A 4AKNA 5D7XA 2N9GA 4O7CA 5L99A 3S91A 5ENHA 4TTEA 4WHWA 2R0SA 2DATA 5DLZA 3P1DA 3MB3A 4NQMA 4YBSA 4YYIA 2D9EA 5H1VA 4UITA 4UYFB 4TZ8A 4LR6A 4QSWA 4N3WA 4O72A 5DW1A 4CUQA 5A5OA 3UV2A 3QZVA 2F6JA 4LC2A 3UVXA 4J1PA 2YEMA 4GPJA 4NQNA 5LKUA 4QEWA 5HRWA 1JSPB 4HXPA 5H85A 5C85A 5ENGA 5FE0A 5A5RA 4KV4A 2E7NA 2DKWA 3U5PA 4MR6A 5CPEA 4Z6IA 4O71A 5A5PA 2R0YA 4QY4A 5CU8A 5F2PA 4YATA 5DX4A 1N72A 5FB0A 5I29A 3MXFA 4Q0NA 3ERRA 4UIYA 5ENCA 5F1HA 2OSSA 4BHWA 3U5NA 3P1FA 3DWYA 4TZ2A 5EPBA 3LJWA 5EICA 5K29A 3IU6A 4O7BA 5CRMA 4A9IA 5FG6A 3GG3A 5IGMA 4PS5A 5FE3A 4MR4A 4AKHA 5E0RA 4Z6HA 2OO1A 4Z1QA 5E9KA 2YW5A 2R10A 3AADA 5EWHA 4QUTA 1WUMA 4A9NA 5CQ7A 5HRVA 5FE1A 5FH6A 4BJXA 4UYGA 4LZ2A 4N4GA 4NUCA 4HBYA 5FE9A 4HXLA 3O36A 3SVHA 5I80A 5C87A 4IOQA 3LQHA 4A9HA 4QSVA 4BW3A 4Z1SA 5I1QA 5IGNA 4HBWA 3VKHA 5CQ5A 2E3KA 5J0DA 5LKZA 3AQAA 4HBXA 2D82A 5TCMA 5CRZA 2H60A 5CUCA 3O35A 4N4IA 5D3NA 3S92A 5HM0A 3UV4A 5DFBA 3O37A 5BT3A 5CQ3A 5DFDA 5EPSA 5BT5A 3K2JA 5ENJA 3QZTA 2KTBB 5F3AA 4NXJA 1ZS5A 3DAIA 5D3SA 5LVQA 2L85A 4HXKA 4QSUA 4A9MA 5D3RA 5FE5A 4QR5A 5CQ6A 5DLXA 3MULA 5D3JA 4CUUA 5A82A 4FLPA 4YYHA 2LSPB 4XY8A 4TU6A 4YADA 4TT4A 4MEPA 4O77A 4XUBA 4QYLA 4O7AA 4TU4A 4UIVA 5D25A 4UYDA 5D3LA 4MR5A 4YYMA 5DFCA 5A7CA 4Z93A 4UIZA 5HQ7A 5IIDA 5II1A 2WP1A 5F63A 4YYNA 2YDWA 5F5ZA 3Q2EA 5E3GA 5L8UA 5EA1A 2YQDA 4Q0OA 4CURA 2RNYA 5CUAA 4N4HA 4A9FA 1EQFA 5EPRA 4NYVA 5FFYA 3P5OA 4HXNA 5HENA 4MENA 5FDZA 4TQNA 5HCLA 5FE8A 2YYNA 2DVQA 5EWWA 4QEUA 4A9KA 5LKXA 5D26A 4QBMA 2GRCA 5DYAA 5HFRA 4YY6A 2L5EA 4CUSA 4O75A 5COIA 4NR6A 5A5QA 4ZW1A 5L8TA 5A85A 4ALGA 4OUFA 3G0LA 4C66A 4X2IA 4HXMA 4QZSA 3LQJA 3UVWA 4CFKA 4MEOA 5ENFA 4O78A 5I89A 2I7KA 4HXRA 5CUEA 4CUTA 5D24A 3SVGA 5EWDA 4TYLA 5FG5A 4LYIA 5E9MA 5EM3A 3TLPA 5LVRA 3SVFA 5HQ5A 3UW9A 5BT4A 5D3HA 4HBVA 1WUGA 4WHUA 2I8NA 2WP2A 4N4FA 4PKLA 4E96A 5LJ1A 4NR7A 5F62A 3UVYA 4PY6A 5EU1A 5I83A 3FKMX 3HMEA 4QSPA 3P1CA 4QUUA 2DWWA 5JWMA 5D3PA 5ETBA 4C67A 5FG4A 4XYAA 2YEKA 4YYGA 4A9OA 5FBXA 5EQ1A 5E9VA 4ZC9A 5LUUA 4HXSA 4O74A 5CS8A 1X0JA 4YYDA 4AI6A 5AMEA 4PCEA 5IGKA 4UIWA 2YELA 4PCIA 2E7OA 5F61A 4TS8A 4NYXA 5EI4A 5CGPA 4YYJA 4YC9A 4CLBA 5IBNA 5KTUA 2FSAA 3HMFA 4QSRA 1PUOA 4F3IA 3JVKA 4ZQLA 3D1DA 3UV5A 4QR4A 2DVRA 4LDFA 5H1TA 5A5SA 4A9EA 4IR4A 5CQ8A 3HMHA 4J0SA 3U5OA 4DONA 5LKTA 3NXBA 5EISA 5KU3A 5FE6A 3RCWA 5CUBA 5EP7A 3ZYUA 2G4AA 5EVAA 4BW1A 5A83A 5II2A 4NRCA 4NR5A 4QYDA 4KCXA 5CZGA 5TB6A 5D3TA 3O34A 5F25A 4HXOA 3LXJA 5EWVA 5L98A 5E74A 4QNSA 5E9LA 4Y03A 5HLSA 4O7EA 3D1BA 4OGIA 5E9IA 1E6IA 5DKCA 3U5JA 4IR6A 4WIVA 4XY9A 5LJ2A 3D7CA 5DKDA 4A9LA 4NR8A 4IR5A 5L96A 5C8GA 5KO4A 2DVVA 5I7YA 3IU5A 4BW2A 5CUDA 4NUDA 5E3DA 5FE7A 5ENIA 5EGUA 5A81A 4UIXA 5FH7A 4CFLA 4QC3A 5FB1A 5D0CA 5F1LA 5F36A 5G4RA 2NXBA 2RI7A 4ALHA 5ETDA 4IORA 4QSXA 2F6NA 4YAXA 5FFVA 5IGLA 5L97A 4NR4A 3JVJA 1F68A 4LZSA 5H1UA 5FH8A 4YY4A 5FE2A 5CP5A 5EV9A 5CQAA 3MUKA 4IR3A 4YBTA
chains in the Genus database with same CATH topology
5DKHA 5E73A 5AD3A 5KHMA 4QC1A 3U5KA 5CQTA 5ENBA 5EWCA 5F60A 5HELA 4MR3A 4UYEA 5C89A 5HRXA 4LRGA 5DBMA 2L84A 3JVLA 4QEVA 4YK0A 4QSSA 5E9YA 5E7DA 4CL9A 5EK9A 5HEMA 5KTXA 4QB3A 3MQMA 4J0RA 4TT6A 5FE4A 4UYHA 5CUGA 3U5LA 5DYXA 2RNWA 2RNXA 3UVDA 4UIUA 5I88A 4QR3A 2RS9B 2R0VA 4NS5A 5CFWA 3G0JA 2MJVB 5HFQA 4MEQA 4NYWA 5JI8A 4UYFA 5I7XA 3ONIA 4YABA 3P1EA 4A9JA 5IG6A 4TT2A 3I3JA 5AMFA 4RVRA 2OUOA 5I40A 5CTLA 4NRBA 5CY9A 4YBMA 4YYKA 4KV1A 4QSQA 3U5MA 5HJCA 4BW4A 4LYWA 3LQIA 4YH3A 5KTWA 4NUEA 3JVMA 4QSTA 1JM4B 3QZSA 4NR9A 5DW2A 5ENEA 4IOOA 5CQ4A 3O33A 4NRAA 4CUPA 3Q2FA 3MB4A 5HQ6A 4O70A 4XUAA 5DYUA 4OGJA 5FFWA 5ACYA 5C4QA 5DYCA 5A5NA 5G4SA 4O7FA 5AD2A 2DVSA 2RFJA 4PTBA 5C7NA 4LZRA 4LYSA 4J3IA 5LJ0A 4O76A 4YH4A 5DY7A 5I86A 2RO1A 4AKNA 5D7XA 2N9GA 4O7CA 5L99A 3S91A 5ENHA 4TTEA 4WHWA 2R0SA 2DATA 5DLZA 3P1DA 3MB3A 4NQMA 4YBSA 4YYIA 2D9EA 5H1VA 4UITA 4UYFB 4TZ8A 4LR6A 4QSWA 4N3WA 4O72A 5DW1A 4CUQA 5A5OA 3UV2A 3QZVA 2F6JA 4LC2A 3UVXA 4J1PA 2YEMA 4GPJA 4NQNA 5LKUA 4QEWA 5HRWA 1JSPB 4HXPA 5H85A 5C85A 5ENGA 5FE0A 5A5RA 4KV4A 2E7NA 2DKWA 3U5PA 4MR6A 5CPEA 4Z6IA 4O71A 5A5PA 2R0YA 4QY4A 5CU8A 5F2PA 4YATA 5DX4A 1N72A 5FB0A 5I29A 3MXFA 4Q0NA 4UIYA 5ENCA 5F1HA 2OSSA 4BHWA 3U5NA 3P1FA 3DWYA 4TZ2A 5EPBA 3LJWA 5EICA 5K29A 3IU6A 4O7BA 5CRMA 4A9IA 5FG6A 3GG3A 5IGMA 4PS5A 5FE3A 4MR4A 5E0RA 4Z6HA 2OO1A 4Z1QA 5E9KA 2YW5A 2R10A 3AADA 5EWHA 4QUTA 1WUMA 4A9NA 5CQ7A 5HRVA 5FE1A 5FH6A 4BJXA 4UYGA 4LZ2A 4N4GA 4NUCA 4HBYA 5FE9A 4HXLA 3O36A 3SVHA 5I80A 5C87A 4IOQA 3LQHA 4A9HA 4QSVA 4BW3A 4Z1SA 5I1QA 5IGNA 4HBWA 5CQ5A 2E3KA 5J0DA 5LKZA 3AQAA 4HBXA 2D82A 5TCMA 5CRZA 2H60A 5CUCA 3O35A 4N4IA 5D3NA 3S92A 5HM0A 3UV4A 5DFBA 3O37A 5BT3A 5CQ3A 5DFDA 5EPSA 5BT5A 3K2JA 5ENJA 3QZTA 2KTBB 5F3AA 4NXJA 1ZS5A 3DAIA 5D3SA 5LVQA 2L85A 4HXKA 4QSUA 4A9MA 5D3RA 5FE5A 4QR5A 5CQ6A 5DLXA 3MULA 5D3JA 4CUUA 5A82A 4FLPA 4YYHA 2LSPB 4XY8A 4TU6A 4YADA 4TT4A 4MEPA 4O77A 4XUBA 4QYLA 4O7AA 4TU4A 4UIVA 5D25A 4UYDA 5D3LA 4MR5A 4YYMA 5DFCA 5A7CA 4Z93A 4UIZA 5HQ7A 5IIDA 5II1A 2WP1A 5F63A 4YYNA 2YDWA 5F5ZA 3Q2EA 5E3GA 5L8UA 5EA1A 2YQDA 4Q0OA 4CURA 2RNYA 5CUAA 4N4HA 4A9FA 1EQFA 5EPRA 4NYVA 5FFYA 3P5OA 4HXNA 5HENA 4MENA 5FDZA 4TQNA 5HCLA 5FE8A 2YYNA 2DVQA 5EWWA 4QEUA 4A9KA 5LKXA 5D26A 4QBMA 2GRCA 5DYAA 5HFRA 4YY6A 2L5EA 4CUSA 4O75A 5COIA 4NR6A 5A5QA 4ZW1A 5L8TA 5A85A 4ALGA 4OUFA 3G0LA 4C66A 4X2IA 4HXMA 4QZSA 3LQJA 3UVWA 4CFKA 4MEOA 5ENFA 4O78A 5I89A 2I7KA 4HXRA 5CUEA 4CUTA 5D24A 3SVGA 5EWDA 4TYLA 5FG5A 4LYIA 5E9MA 5EM3A 3TLPA 5LVRA 3SVFA 5HQ5A 3UW9A 5BT4A 5D3HA 4HBVA 1WUGA 4WHUA 2I8NA 2WP2A 4N4FA 4PKLA 4E96A 5LJ1A 4NR7A 5F62A 3UVYA 4PY6A 5EU1A 5I83A 3FKMX 3HMEA 4QSPA 3P1CA 4QUUA 2DWWA 5JWMA 5D3PA 5ETBA 4C67A 5FG4A 4XYAA 2YEKA 4YYGA 4A9OA 5FBXA 5EQ1A 5E9VA 4ZC9A 5LUUA 4HXSA 4O74A 5CS8A 1X0JA 4YYDA 5AMEA 4PCEA 5IGKA 4UIWA 2YELA 4PCIA 2E7OA 5F61A 4TS8A 4NYXA 5EI4A 5CGPA 4YYJA 4YC9A 4CLBA 5IBNA 5KTUA 2FSAA 3HMFA 4QSRA 4F3IA 3JVKA 4ZQLA 3UV5A 4QR4A 2DVRA 4LDFA 5H1TA 5A5SA 4A9EA 4IR4A 5CQ8A 3HMHA 4J0SA 3U5OA 4DONA 5LKTA 3NXBA 5EISA 5KU3A 5FE6A 3RCWA 5CUBA 5EP7A 3ZYUA 2G4AA 5EVAA 4BW1A 5A83A 5II2A 4NRCA 4NR5A 4QYDA 4KCXA 5CZGA 5TB6A 5D3TA 3O34A 5F25A 4HXOA 3LXJA 5EWVA 5L98A 5E74A 4QNSA 5E9LA 4Y03A 5HLSA 4O7EA 4OGIA 5E9IA 1E6IA 5DKCA 3U5JA 4IR6A 4WIVA 4XY9A 5LJ2A 3D7CA 5DKDA 4A9LA 4NR8A 4IR5A 5L96A 5C8GA 5KO4A 2DVVA 5I7YA 3IU5A 4BW2A 5CUDA 4NUDA 5E3DA 5FE7A 5ENIA 5EGUA 5A81A 4UIXA 5FH7A 4CFLA 4QC3A 5FB1A 5D0CA 5F1LA 5F36A 5G4RA 2NXBA 2RI7A 4ALHA 5ETDA 4IORA 4QSXA 2F6NA 4YAXA 5FFVA 5IGLA 5L97A 4NR4A 3JVJA 1F68A 4LZSA 5H1UA 5FH8A 4YY4A 5FE2A 5CP5A 5EV9A 5CQAA 3MUKA 4IR3A 4YBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKH A;  5E73 A;  5AD3 A;  5KHM A;  4QC1 A;  3U5K A;  5CQT A;  5ENB A;  5EWC A;  5F60 A;  5HEL A;  4MR3 A;  4UYE A;  5C89 A;  5HRX A;  4LRG A;  5DBM A;  2L84 A;  3JVL A;  4QEV A;  4YK0 A;  4QSS A;  5E9Y A;  5E7D A;  4CL9 A;  5EK9 A;  5HEM A;  5KTX A;  4QB3 A;  3MQM A;  4J0R A;  4TT6 A;  5FE4 A;  4UYH A;  5CUG A;  3U5L A;  5DYX A;  2RNW A;  2RNX A;  3UVD A;  4UIU A;  5I88 A;  4QR3 A;  2RS9 B;  2R0V A;  4NS5 A;  5CFW A;  3G0J A;  2MJV B;  5HFQ A;  4MEQ A;  4NYW A;  5JI8 A;  4UYF A;  5I7X A;  3ONI A;  4YAB A;  3P1E A;  4A9J A;  5IG6 A;  4TT2 A;  3I3J A;  5AMF A;  4RVR A;  2OUO A;  5I40 A;  5CTL A;  4NRB A;  5CY9 A;  4YBM A;  4YYK A;  4KV1 A;  4QSQ A;  3U5M A;  5HJC A;  4BW4 A;  4LYW A;  3LQI A;  4YH3 A;  5KTW A;  4NUE A;  3JVM A;  4QST A;  1JM4 B;  3QZS A;  4NR9 A;  5DW2 A;  5ENE A;  4IOO A;  5CQ4 A;  3O33 A;  4NRA A;  4CUP A;  3Q2F A;  3MB4 A;  5HQ6 A;  4O70 A;  4XUA A;  5DYU A;  4OGJ A;  5FFW A;  5ACY A;  5C4Q A;  5DYC A;  5A5N A;  5G4S A;  4O7F A;  5AD2 A;  2DVS A;  2RFJ A;  4PTB A;  5C7N A;  4LZR A;  4LYS A;  4J3I A;  5LJ0 A;  4O76 A;  4YH4 A;  5DY7 A;  5I86 A;  2RO1 A;  4AKN A;  5D7X A;  2N9G A;  4O7C A;  5L99 A;  3S91 A;  5ENH A;  4TTE A;  4WHW A;  2R0S A;  2DAT A;  5DLZ A;  3P1D A;  3MB3 A;  4NQM A;  4YBS A;  4YYI A;  2D9E A;  5H1V A;  4UIT A;  4UYF B;  4TZ8 A;  4LR6 A;  4QSW A;  4N3W A;  4O72 A;  5DW1 A;  4CUQ A;  5A5O A;  3UV2 A;  3QZV A;  2F6J A;  4LC2 A;  3UVX A;  4J1P A;  2YEM A;  4GPJ A;  4NQN A;  5LKU A;  4QEW A;  5HRW A;  1JSP B;  4HXP A;  5H85 A;  5C85 A;  5ENG A;  5FE0 A;  5A5R A;  4KV4 A;  2E7N A;  2DKW A;  3U5P A;  4MR6 A;  5CPE A;  4Z6I A;  4O71 A;  5A5P A;  2R0Y A;  4QY4 A;  5CU8 A;  5F2P A;  4YAT A;  5DX4 A;  1N72 A;  5FB0 A;  5I29 A;  3MXF A;  4Q0N A;  4UIY A;  5ENC A;  5F1H A;  2OSS A;  4BHW A;  3U5N A;  3P1F A;  3DWY A;  4TZ2 A;  5EPB A;  3LJW A;  5EIC A;  5K29 A;  3IU6 A;  4O7B A;  5CRM A;  4A9I A;  5FG6 A;  3GG3 A;  5IGM A;  4PS5 A;  5FE3 A;  4MR4 A;  5E0R A;  4Z6H A;  2OO1 A;  4Z1Q A;  5E9K A;  2YW5 A;  2R10 A;  3AAD A;  5EWH A;  4QUT A;  1WUM A;  4A9N A;  5CQ7 A;  5HRV A;  5FE1 A;  5FH6 A;  4BJX A;  4UYG A;  4LZ2 A;  4N4G A;  4NUC A;  4HBY A;  5FE9 A;  4HXL A;  3O36 A;  3SVH A;  5I80 A;  5C87 A;  4IOQ A;  3LQH A;  4A9H A;  4QSV A;  4BW3 A;  4Z1S A;  5I1Q A;  5IGN A;  4HBW A;  5CQ5 A;  2E3K A;  5J0D A;  5LKZ A;  3AQA A;  4HBX A;  2D82 A;  5TCM A;  5CRZ A;  2H60 A;  5CUC A;  3O35 A;  4N4I A;  5D3N A;  3S92 A;  5HM0 A;  3UV4 A;  5DFB A;  3O37 A;  5BT3 A;  5CQ3 A;  5DFD A;  5EPS A;  5BT5 A;  3K2J A;  5ENJ A;  3QZT A;  2KTB B;  5F3A A;  4NXJ A;  1ZS5 A;  3DAI A;  5D3S A;  5LVQ A;  2L85 A;  4HXK A;  4QSU A;  4A9M A;  5D3R A;  5FE5 A;  4QR5 A;  5CQ6 A;  5DLX A;  3MUL A;  5D3J A;  4CUU A;  5A82 A;  4FLP A;  4YYH A;  2LSP B;  4XY8 A;  4TU6 A;  4YAD A;  4TT4 A;  4MEP A;  4O77 A;  4XUB A;  4QYL A;  4O7A A;  4TU4 A;  4UIV A;  5D25 A;  4UYD A;  5D3L A;  4MR5 A;  4YYM A;  5DFC A;  5A7C A;  4Z93 A;  4UIZ A;  5HQ7 A;  5IID A;  5II1 A;  2WP1 A;  5F63 A;  4YYN A;  2YDW A;  5F5Z A;  3Q2E A;  5E3G A;  5L8U A;  5EA1 A;  2YQD A;  4Q0O A;  4CUR A;  2RNY A;  5CUA A;  4N4H A;  4A9F A;  1EQF A;  5EPR A;  4NYV A;  5FFY A;  3P5O A;  4HXN A;  5HEN A;  4MEN A;  5FDZ A;  4TQN A;  5HCL A;  5FE8 A;  2YYN A;  2DVQ A;  5EWW A;  4QEU A;  4A9K A;  5LKX A;  5D26 A;  4QBM A;  2GRC A;  5DYA A;  5HFR A;  4YY6 A;  2L5E A;  4CUS A;  4O75 A;  5COI A;  4NR6 A;  5A5Q A;  4ZW1 A;  5L8T A;  5A85 A;  4ALG A;  4OUF A;  3G0L A;  4C66 A;  4X2I A;  4HXM A;  4QZS A;  3LQJ A;  3UVW A;  4CFK A;  4MEO A;  5ENF A;  4O78 A;  5I89 A;  2I7K A;  4HXR A;  5CUE A;  4CUT A;  5D24 A;  3SVG A;  5EWD A;  4TYL A;  5FG5 A;  4LYI A;  5E9M A;  5EM3 A;  3TLP A;  5LVR A;  3SVF A;  5HQ5 A;  3UW9 A;  5BT4 A;  5D3H A;  4HBV A;  1WUG A;  4WHU A;  2I8N A;  2WP2 A;  4N4F A;  4PKL A;  4E96 A;  5LJ1 A;  4NR7 A;  5F62 A;  3UVY A;  4PY6 A;  5EU1 A;  5I83 A;  3FKM X;  3HME A;  4QSP A;  3P1C A;  4QUU A;  2DWW A;  5JWM A;  5D3P A;  5ETB A;  4C67 A;  5FG4 A;  4XYA A;  2YEK A;  4YYG A;  4A9O A;  5FBX A;  5EQ1 A;  5E9V A;  4ZC9 A;  5LUU A;  4HXS A;  4O74 A;  5CS8 A;  1X0J A;  4YYD A;  5AME A;  4PCE A;  5IGK A;  4UIW A;  2YEL A;  4PCI A;  2E7O A;  5F61 A;  4TS8 A;  4NYX A;  5EI4 A;  5CGP A;  4YYJ A;  4YC9 A;  4CLB A;  5IBN A;  5KTU A;  2FSA A;  3HMF A;  4QSR A;  4F3I A;  3JVK A;  4ZQL A;  3UV5 A;  4QR4 A;  2DVR A;  4LDF A;  5H1T A;  5A5S A;  4A9E A;  4IR4 A;  5CQ8 A;  3HMH A;  4J0S A;  3U5O A;  4DON A;  5LKT A;  3NXB A;  5EIS A;  5KU3 A;  5FE6 A;  3RCW A;  5CUB A;  5EP7 A;  3ZYU A;  2G4A A;  5EVA A;  4BW1 A;  5A83 A;  5II2 A;  4NRC A;  4NR5 A;  4QYD A;  4KCX A;  5CZG A;  5TB6 A;  5D3T A;  3O34 A;  5F25 A;  4HXO A;  3LXJ A;  5EWV A;  5L98 A;  5E74 A;  4QNS A;  5E9L A;  4Y03 A;  5HLS A;  4O7E A;  4OGI A;  5E9I A;  1E6I A;  5DKC A;  3U5J A;  4IR6 A;  4WIV A;  4XY9 A;  5LJ2 A;  3D7C A;  5DKD A;  4A9L A;  4NR8 A;  4IR5 A;  5L96 A;  5C8G A;  5KO4 A;  2DVV A;  5I7Y A;  3IU5 A;  4BW2 A;  5CUD A;  4NUD A;  5E3D A;  5FE7 A;  5ENI A;  5EGU A;  5A81 A;  4UIX A;  5FH7 A;  4CFL A;  4QC3 A;  5FB1 A;  5D0C A;  5F1L A;  5F36 A;  5G4R A;  2NXB A;  2RI7 A;  4ALH A;  5ETD A;  4IOR A;  4QSX A;  2F6N A;  4YAX A;  5FFV A;  5IGL A;  5L97 A;  4NR4 A;  3JVJ A;  1F68 A;  4LZS A;  5H1U A;  5FH8 A;  4YY4 A;  5FE2 A;  5CP5 A;  5EV9 A;  5CQA A;  3MUK A;  4IR3 A;  4YBT A; 
#chains in the Genus database with same CATH topology
 5DKH A;  5E73 A;  5AD3 A;  5KHM A;  4QC1 A;  3U5K A;  5CQT A;  5ENB A;  5EWC A;  5F60 A;  5HEL A;  4AKG A;  4MR3 A;  4UYE A;  5C89 A;  5HRX A;  4LRG A;  5DBM A;  2L84 A;  3JVL A;  4QEV A;  4YK0 A;  4QSS A;  5E9Y A;  5E7D A;  4CL9 A;  5EK9 A;  5HEM A;  5KTX A;  4QB3 A;  3MQM A;  4J0R A;  4TT6 A;  3VKG A;  5FE4 A;  4UYH A;  5CUG A;  1ZKR A;  3U5L A;  5DYX A;  2RNW A;  2RNX A;  3UVD A;  4UIU A;  5I88 A;  4QR3 A;  2RS9 B;  2R0V A;  4NS5 A;  5CFW A;  3G0J A;  2MJV B;  5HFQ A;  4MEQ A;  4NYW A;  5JI8 A;  4AKI A;  4UYF A;  5I7X A;  3ONI A;  4YAB A;  3P1E A;  4A9J A;  5IG6 A;  4TT2 A;  3I3J A;  5AMF A;  4RVR A;  2OUO A;  5I40 A;  5CTL A;  4NRB A;  5CY9 A;  4YBM A;  4YYK A;  4KV1 A;  4QSQ A;  3U5M A;  5HJC A;  4BW4 A;  4LYW A;  3LQI A;  4YH3 A;  5KTW A;  2EJN A;  4NUE A;  3JVM A;  4QST A;  1JM4 B;  3QZS A;  4NR9 A;  5DW2 A;  5ENE A;  4IOO A;  5CQ4 A;  3O33 A;  4NRA A;  4CUP A;  3Q2F A;  3MB4 A;  5HQ6 A;  4O70 A;  4XUA A;  5DYU A;  4OGJ A;  5FFW A;  5ACY A;  5C4Q A;  5DYC A;  5A5N A;  5G4S A;  4O7F A;  5AD2 A;  2DVS A;  2RFJ A;  4PTB A;  5C7N A;  4LZR A;  4LYS A;  4J3I A;  5LJ0 A;  4O76 A;  4YH4 A;  5DY7 A;  5I86 A;  2RO1 A;  4AKN A;  5D7X A;  2N9G A;  4O7C A;  5L99 A;  3S91 A;  5ENH A;  4TTE A;  4WHW A;  2R0S A;  2DAT A;  5DLZ A;  3P1D A;  3MB3 A;  4NQM A;  4YBS A;  4YYI A;  2D9E A;  5H1V A;  4UIT A;  4UYF B;  4TZ8 A;  4LR6 A;  4QSW A;  4N3W A;  4O72 A;  5DW1 A;  4CUQ A;  5A5O A;  3UV2 A;  3QZV A;  2F6J A;  4LC2 A;  3UVX A;  4J1P A;  2YEM A;  4GPJ A;  4NQN A;  5LKU A;  4QEW A;  5HRW A;  1JSP B;  4HXP A;  5H85 A;  5C85 A;  5ENG A;  5FE0 A;  5A5R A;  4KV4 A;  2E7N A;  2DKW A;  3U5P A;  4MR6 A;  5CPE A;  4Z6I A;  4O71 A;  5A5P A;  2R0Y A;  4QY4 A;  5CU8 A;  5F2P A;  4YAT A;  5DX4 A;  1N72 A;  5FB0 A;  5I29 A;  3MXF A;  4Q0N A;  3ERR A;  4UIY A;  5ENC A;  5F1H A;  2OSS A;  4BHW A;  3U5N A;  3P1F A;  3DWY A;  4TZ2 A;  5EPB A;  3LJW A;  5EIC A;  5K29 A;  3IU6 A;  4O7B A;  5CRM A;  4A9I A;  5FG6 A;  3GG3 A;  5IGM A;  4PS5 A;  5FE3 A;  4MR4 A;  4AKH A;  5E0R A;  4Z6H A;  2OO1 A;  4Z1Q A;  5E9K A;  2YW5 A;  2R10 A;  3AAD A;  5EWH A;  4QUT A;  1WUM A;  4A9N A;  5CQ7 A;  5HRV A;  5FE1 A;  5FH6 A;  4BJX A;  4UYG A;  4LZ2 A;  4N4G A;  4NUC A;  4HBY A;  5FE9 A;  4HXL A;  3O36 A;  3SVH A;  5I80 A;  5C87 A;  4IOQ A;  3LQH A;  4A9H A;  4QSV A;  4BW3 A;  4Z1S A;  5I1Q A;  5IGN A;  4HBW A;  3VKH A;  5CQ5 A;  2E3K A;  5J0D A;  5LKZ A;  3AQA A;  4HBX A;  2D82 A;  5TCM A;  5CRZ A;  2H60 A;  5CUC A;  3O35 A;  4N4I A;  5D3N A;  3S92 A;  5HM0 A;  3UV4 A;  5DFB A;  3O37 A;  5BT3 A;  5CQ3 A;  5DFD A;  5EPS A;  5BT5 A;  3K2J A;  5ENJ A;  3QZT A;  2KTB B;  5F3A A;  4NXJ A;  1ZS5 A;  3DAI A;  5D3S A;  5LVQ A;  2L85 A;  4HXK A;  4QSU A;  4A9M A;  5D3R A;  5FE5 A;  4QR5 A;  5CQ6 A;  5DLX A;  3MUL A;  5D3J A;  4CUU A;  5A82 A;  4FLP A;  4YYH A;  2LSP B;  4XY8 A;  4TU6 A;  4YAD A;  4TT4 A;  4MEP A;  4O77 A;  4XUB A;  4QYL A;  4O7A A;  4TU4 A;  4UIV A;  5D25 A;  4UYD A;  5D3L A;  4MR5 A;  4YYM A;  5DFC A;  5A7C A;  4Z93 A;  4UIZ A;  5HQ7 A;  5IID A;  5II1 A;  2WP1 A;  5F63 A;  4YYN A;  2YDW A;  5F5Z A;  3Q2E A;  5E3G A;  5L8U A;  5EA1 A;  2YQD A;  4Q0O A;  4CUR A;  2RNY A;  5CUA A;  4N4H A;  4A9F A;  1EQF A;  5EPR A;  4NYV A;  5FFY A;  3P5O A;  4HXN A;  5HEN A;  4MEN A;  5FDZ A;  4TQN A;  5HCL A;  5FE8 A;  2YYN A;  2DVQ A;  5EWW A;  4QEU A;  4A9K A;  5LKX A;  5D26 A;  4QBM A;  2GRC A;  5DYA A;  5HFR A;  4YY6 A;  2L5E A;  4CUS A;  4O75 A;  5COI A;  4NR6 A;  5A5Q A;  4ZW1 A;  5L8T A;  5A85 A;  4ALG A;  4OUF A;  3G0L A;  4C66 A;  4X2I A;  4HXM A;  4QZS A;  3LQJ A;  3UVW A;  4CFK A;  4MEO A;  5ENF A;  4O78 A;  5I89 A;  2I7K A;  4HXR A;  5CUE A;  4CUT A;  5D24 A;  3SVG A;  5EWD A;  4TYL A;  5FG5 A;  4LYI A;  5E9M A;  5EM3 A;  3TLP A;  5LVR A;  3SVF A;  5HQ5 A;  3UW9 A;  5BT4 A;  5D3H A;  4HBV A;  1WUG A;  4WHU A;  2I8N A;  2WP2 A;  4N4F A;  4PKL A;  4E96 A;  5LJ1 A;  4NR7 A;  5F62 A;  3UVY A;  4PY6 A;  5EU1 A;  5I83 A;  3FKM X;  3HME A;  4QSP A;  3P1C A;  4QUU A;  2DWW A;  5JWM A;  5D3P A;  5ETB A;  4C67 A;  5FG4 A;  4XYA A;  2YEK A;  4YYG A;  4A9O A;  5FBX A;  5EQ1 A;  5E9V A;  4ZC9 A;  5LUU A;  4HXS A;  4O74 A;  5CS8 A;  1X0J A;  4YYD A;  4AI6 A;  5AME A;  4PCE A;  5IGK A;  4UIW A;  2YEL A;  4PCI A;  2E7O A;  5F61 A;  4TS8 A;  4NYX A;  5EI4 A;  5CGP A;  4YYJ A;  4YC9 A;  4CLB A;  5IBN A;  5KTU A;  2FSA A;  3HMF A;  4QSR A;  1PUO A;  4F3I A;  3JVK A;  4ZQL A;  3D1D A;  3UV5 A;  4QR4 A;  2DVR A;  4LDF A;  5H1T A;  5A5S A;  4A9E A;  4IR4 A;  5CQ8 A;  3HMH A;  4J0S A;  3U5O A;  4DON A;  5LKT A;  3NXB A;  5EIS A;  5KU3 A;  5FE6 A;  3RCW A;  5CUB A;  5EP7 A;  3ZYU A;  2G4A A;  5EVA A;  4BW1 A;  5A83 A;  5II2 A;  4NRC A;  4NR5 A;  4QYD A;  4KCX A;  5CZG A;  5TB6 A;  5D3T A;  3O34 A;  5F25 A;  4HXO A;  3LXJ A;  5EWV A;  5L98 A;  5E74 A;  4QNS A;  5E9L A;  4Y03 A;  5HLS A;  4O7E A;  3D1B A;  4OGI A;  5E9I A;  1E6I A;  5DKC A;  3U5J A;  4IR6 A;  4WIV A;  4XY9 A;  5LJ2 A;  3D7C A;  5DKD A;  4A9L A;  4NR8 A;  4IR5 A;  5L96 A;  5C8G A;  5KO4 A;  2DVV A;  5I7Y A;  3IU5 A;  4BW2 A;  5CUD A;  4NUD A;  5E3D A;  5FE7 A;  5ENI A;  5EGU A;  5A81 A;  4UIX A;  5FH7 A;  4CFL A;  4QC3 A;  5FB1 A;  5D0C A;  5F1L A;  5F36 A;  5G4R A;  2NXB A;  2RI7 A;  4ALH A;  5ETD A;  4IOR A;  4QSX A;  2F6N A;  4YAX A;  5FFV A;  5IGL A;  5L97 A;  4NR4 A;  3JVJ A;  1F68 A;  4LZS A;  5H1U A;  5FH8 A;  4YY4 A;  5FE2 A;  5CP5 A;  5EV9 A;  5CQA A;  3MUK A;  4IR3 A;  4YBT A; 
#chains in the Genus database with same CATH homology
 5DKH A;  5E73 A;  5AD3 A;  5KHM A;  4QC1 A;  3U5K A;  5CQT A;  5ENB A;  5EWC A;  5F60 A;  5HEL A;  4MR3 A;  4UYE A;  5C89 A;  5HRX A;  4LRG A;  5DBM A;  2L84 A;  3JVL A;  4QEV A;  4YK0 A;  4QSS A;  5E9Y A;  5E7D A;  4CL9 A;  5EK9 A;  5HEM A;  5KTX A;  4QB3 A;  3MQM A;  4J0R A;  4TT6 A;  5FE4 A;  4UYH A;  5CUG A;  3U5L A;  5DYX A;  2RNW A;  2RNX A;  3UVD A;  4UIU A;  5I88 A;  4QR3 A;  2RS9 B;  2R0V A;  4NS5 A;  5CFW A;  3G0J A;  2MJV B;  5HFQ A;  4MEQ A;  4NYW A;  5JI8 A;  4UYF A;  5I7X A;  3ONI A;  4YAB A;  3P1E A;  4A9J A;  5IG6 A;  4TT2 A;  3I3J A;  5AMF A;  4RVR A;  2OUO A;  5I40 A;  5CTL A;  4NRB A;  5CY9 A;  4YBM A;  4YYK A;  4KV1 A;  4QSQ A;  3U5M A;  5HJC A;  4BW4 A;  4LYW A;  3LQI A;  4YH3 A;  5KTW A;  4NUE A;  3JVM A;  4QST A;  1JM4 B;  3QZS A;  4NR9 A;  5DW2 A;  5ENE A;  4IOO A;  5CQ4 A;  3O33 A;  4NRA A;  4CUP A;  3Q2F A;  3MB4 A;  5HQ6 A;  4O70 A;  4XUA A;  5DYU A;  4OGJ A;  5FFW A;  5ACY A;  5C4Q A;  5DYC A;  5A5N A;  5G4S A;  4O7F A;  5AD2 A;  2DVS A;  2RFJ A;  4PTB A;  5C7N A;  4LZR A;  4LYS A;  4J3I A;  5LJ0 A;  4O76 A;  4YH4 A;  5DY7 A;  5I86 A;  2RO1 A;  4AKN A;  5D7X A;  2N9G A;  4O7C A;  5L99 A;  3S91 A;  5ENH A;  4TTE A;  4WHW A;  2R0S A;  2DAT A;  5DLZ A;  3P1D A;  3MB3 A;  4NQM A;  4YBS A;  4YYI A;  2D9E A;  5H1V A;  4UIT A;  4UYF B;  4TZ8 A;  4LR6 A;  4QSW A;  4N3W A;  4O72 A;  5DW1 A;  4CUQ A;  5A5O A;  3UV2 A;  3QZV A;  2F6J A;  4LC2 A;  3UVX A;  4J1P A;  2YEM A;  4GPJ A;  4NQN A;  5LKU A;  4QEW A;  5HRW A;  1JSP B;  4HXP A;  5H85 A;  5C85 A;  5ENG A;  5FE0 A;  5A5R A;  4KV4 A;  2E7N A;  2DKW A;  3U5P A;  4MR6 A;  5CPE A;  4Z6I A;  4O71 A;  5A5P A;  2R0Y A;  4QY4 A;  5CU8 A;  5F2P A;  4YAT A;  5DX4 A;  1N72 A;  5FB0 A;  5I29 A;  3MXF A;  4Q0N A;  4UIY A;  5ENC A;  5F1H A;  2OSS A;  4BHW A;  3U5N A;  3P1F A;  3DWY A;  4TZ2 A;  5EPB A;  3LJW A;  5EIC A;  5K29 A;  3IU6 A;  4O7B A;  5CRM A;  4A9I A;  5FG6 A;  3GG3 A;  5IGM A;  4PS5 A;  5FE3 A;  4MR4 A;  5E0R A;  4Z6H A;  2OO1 A;  4Z1Q A;  5E9K A;  2YW5 A;  2R10 A;  3AAD A;  5EWH A;  4QUT A;  1WUM A;  4A9N A;  5CQ7 A;  5HRV A;  5FE1 A;  5FH6 A;  4BJX A;  4UYG A;  4LZ2 A;  4N4G A;  4NUC A;  4HBY A;  5FE9 A;  4HXL A;  3O36 A;  3SVH A;  5I80 A;  5C87 A;  4IOQ A;  3LQH A;  4A9H A;  4QSV A;  4BW3 A;  4Z1S A;  5I1Q A;  5IGN A;  4HBW A;  5CQ5 A;  2E3K A;  5J0D A;  5LKZ A;  3AQA A;  4HBX A;  2D82 A;  5TCM A;  5CRZ A;  2H60 A;  5CUC A;  3O35 A;  4N4I A;  5D3N A;  3S92 A;  5HM0 A;  3UV4 A;  5DFB A;  3O37 A;  5BT3 A;  5CQ3 A;  5DFD A;  5EPS A;  5BT5 A;  3K2J A;  5ENJ A;  3QZT A;  2KTB B;  5F3A A;  4NXJ A;  1ZS5 A;  3DAI A;  5D3S A;  5LVQ A;  2L85 A;  4HXK A;  4QSU A;  4A9M A;  5D3R A;  5FE5 A;  4QR5 A;  5CQ6 A;  5DLX A;  3MUL A;  5D3J A;  4CUU A;  5A82 A;  4FLP A;  4YYH A;  2LSP B;  4XY8 A;  4TU6 A;  4YAD A;  4TT4 A;  4MEP A;  4O77 A;  4XUB A;  4QYL A;  4O7A A;  4TU4 A;  4UIV A;  5D25 A;  4UYD A;  5D3L A;  4MR5 A;  4YYM A;  5DFC A;  5A7C A;  4Z93 A;  4UIZ A;  5HQ7 A;  5IID A;  5II1 A;  2WP1 A;  5F63 A;  4YYN A;  2YDW A;  5F5Z A;  3Q2E A;  5E3G A;  5L8U A;  5EA1 A;  2YQD A;  4Q0O A;  4CUR A;  2RNY A;  5CUA A;  4N4H A;  4A9F A;  1EQF A;  5EPR A;  4NYV A;  5FFY A;  3P5O A;  4HXN A;  5HEN A;  4MEN A;  5FDZ A;  4TQN A;  5HCL A;  5FE8 A;  2YYN A;  2DVQ A;  5EWW A;  4QEU A;  4A9K A;  5LKX A;  5D26 A;  4QBM A;  2GRC A;  5DYA A;  5HFR A;  4YY6 A;  2L5E A;  4CUS A;  4O75 A;  5COI A;  4NR6 A;  5A5Q A;  4ZW1 A;  5L8T A;  5A85 A;  4ALG A;  4OUF A;  3G0L A;  4C66 A;  4X2I A;  4HXM A;  4QZS A;  3LQJ A;  3UVW A;  4CFK A;  4MEO A;  5ENF A;  4O78 A;  5I89 A;  2I7K A;  4HXR A;  5CUE A;  4CUT A;  5D24 A;  3SVG A;  5EWD A;  4TYL A;  5FG5 A;  4LYI A;  5E9M A;  5EM3 A;  3TLP A;  5LVR A;  3SVF A;  5HQ5 A;  3UW9 A;  5BT4 A;  5D3H A;  4HBV A;  1WUG A;  4WHU A;  2I8N A;  2WP2 A;  4N4F A;  4PKL A;  4E96 A;  5LJ1 A;  4NR7 A;  5F62 A;  3UVY A;  4PY6 A;  5EU1 A;  5I83 A;  3FKM X;  3HME A;  4QSP A;  3P1C A;  4QUU A;  2DWW A;  5JWM A;  5D3P A;  5ETB A;  4C67 A;  5FG4 A;  4XYA A;  2YEK A;  4YYG A;  4A9O A;  5FBX A;  5EQ1 A;  5E9V A;  4ZC9 A;  5LUU A;  4HXS A;  4O74 A;  5CS8 A;  1X0J A;  4YYD A;  5AME A;  4PCE A;  5IGK A;  4UIW A;  2YEL A;  4PCI A;  2E7O A;  5F61 A;  4TS8 A;  4NYX A;  5EI4 A;  5CGP A;  4YYJ A;  4YC9 A;  4CLB A;  5IBN A;  5KTU A;  2FSA A;  3HMF A;  4QSR A;  4F3I A;  3JVK A;  4ZQL A;  3UV5 A;  4QR4 A;  2DVR A;  4LDF A;  5H1T A;  5A5S A;  4A9E A;  4IR4 A;  5CQ8 A;  3HMH A;  4J0S A;  3U5O A;  4DON A;  5LKT A;  3NXB A;  5EIS A;  5KU3 A;  5FE6 A;  3RCW A;  5CUB A;  5EP7 A;  3ZYU A;  2G4A A;  5EVA A;  4BW1 A;  5A83 A;  5II2 A;  4NRC A;  4NR5 A;  4QYD A;  4KCX A;  5CZG A;  5TB6 A;  5D3T A;  3O34 A;  5F25 A;  4HXO A;  3LXJ A;  5EWV A;  5L98 A;  5E74 A;  4QNS A;  5E9L A;  4Y03 A;  5HLS A;  4O7E A;  4OGI A;  5E9I A;  1E6I A;  5DKC A;  3U5J A;  4IR6 A;  4WIV A;  4XY9 A;  5LJ2 A;  3D7C A;  5DKD A;  4A9L A;  4NR8 A;  4IR5 A;  5L96 A;  5C8G A;  5KO4 A;  2DVV A;  5I7Y A;  3IU5 A;  4BW2 A;  5CUD A;  4NUD A;  5E3D A;  5FE7 A;  5ENI A;  5EGU A;  5A81 A;  4UIX A;  5FH7 A;  4CFL A;  4QC3 A;  5FB1 A;  5D0C A;  5F1L A;  5F36 A;  5G4R A;  2NXB A;  2RI7 A;  4ALH A;  5ETD A;  4IOR A;  4QSX A;  2F6N A;  4YAX A;  5FFV A;  5IGL A;  5L97 A;  4NR4 A;  3JVJ A;  1F68 A;  4LZS A;  5H1U A;  5FH8 A;  4YY4 A;  5FE2 A;  5CP5 A;  5EV9 A;  5CQA A;  3MUK A;  4IR3 A;  4YBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...