4YY4A

Crystal structure of brd9 bromodomain bound to dmso
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
101
structure length
101
Chain Sequence
TPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 9
molecule tags Protein binding
source organism Homo sapiens
total genus 36
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yy4A00
5A5RA 4YYNA 3S92A 5F62A 4NR9A 5DKDA 4WIVA 5CQ4A 4YATA 5HRXA 5COIA 5J0DA 4NR8A 5D26A 5FE4A 4LZSA 5BT5A 4TQNA 5ETDA 4CUSA 5JWMA 1JSPB 5HFRA 5L8UA 2L85A 4IR3A 3I3JA 4XUAA 4BW2A 5H1TA 5H1UA 3Q2EA 4XY8A 1JM4B 4QEWA 5C89A 3DWYA 5CGPA 5DFCA 3O37A 3JVJA 4J1PA 5FDZA 2R0SA 4NYVA 4Y03A 3O33A 5F3AA 5FE9A 5KU3A 1EQFA 5E74A 4YY6A 4FLPA 3NXBA 4YBTA 4YAXA 5II1A 4YYDA 3AQAA 4N4IA 5E7DA 5F60A 3MULA 4QSQA 4N4GA 4NUCA 5F25A 5HENA 5HEMA 4RVRA 5EVAA 5DW2A 4YYIA 4YABA 4NYXA 4O7AA 5CP5A 4TYLA 4WHWA 5CRMA 4OGJA 5C85A 5E0RA 4O7BA 4CUUA 4LYSA 1ZS5A 3QZSA 4NUEA 5EISA 2YDWA 5EU1A 4QEUA 5KHMA 4UIXA 5EWCA 5C87A 5K29A 5HJCA 3HMFA 5EI4A 2RO1A 5EM3A 5D3TA 4QC1A 4XUBA 5FE2A 5LKZA 3G0LA 5IIDA 4F3IA 5L97A 4BHWA 5HM0A 3RCWA 5HCLA 2E3KA 2D82A 4HXMA 2OO1A 5FB0A 4TU4A 3ONIA 4CURA 2F6JA 3GG3A 5D3NA 2H60A 4ALHA 4E96A 4Z1SA 4A9HA 4OGIA 5EWWA 3U5NA 5LVRA 5CZGA 5CQ6A 4O76A 4QR4A 1N72A 4NQMA 5EWDA 5FG5A 4A9IA 2DVVA 5FFWA 5D25A 5F2PA 4ZC9A 4QZSA 4O75A 4QUTA 4YBMA 5HQ5A 4LYIA 4Q0OA 2I7KA 5DLZA 4QYLA 4YYHA 4HXKA 5KO4A 2RS9B 4QYDA 4NR5A 3SVHA 4N4FA 4OUFA 1E6IA 5CFWA 5DFDA 5F5ZA 3TLPA 4YH4A 5EP7A 3MXFA 4HXNA 5FE1A 4A9FA 2N9GA 5E73A 5KTXA 4TT4A 5I1QA 4HBXA 5A5PA 3UVWA 5TB6A 4HBYA 4QSXA 5I40A 4UYHA 3AADA 5HRWA 2L5EA 5IBNA 3QZVA 5AD2A 5C4QA 4C67A 4YC9A 4UYDA 2YEKA 4Z93A 5E9IA 4A9KA 3O34A 2YYNA 5I80A 2DVRA 5DBMA 3LQJA 4A9EA 2DWWA 5C8GA 4O7CA 3LXJA 5F63A 4BJXA 4QSPA 4QUUA 3S91A 4HXSA 3U5KA 4MENA 5HLSA 5D3LA 3DAIA 5EQ1A 3UVXA 5EPBA 4QB3A 2E7NA 3P1DA 4PY6A 4DONA 5ENJA 4YK0A 5ETBA 4A9NA 4PTBA 4LR6A 4MR4A 5EK9A 5DYCA 5I7XA 4TS8A 5DY7A 5I7YA 4QNSA 4YH3A 4TZ2A 3ZYUA 4NYWA 5E9MA 4N4HA 4Q0NA 4O71A 3MQMA 5HELA 5FFYA 5H1VA 5FE8A 5DYAA 3P5OA 4TT2A 5I83A 2R0YA 4QBMA 5E3DA 5FG4A 3UVDA 4A9MA 4PCEA 4BW1A 4NR4A 5A5QA 5D0CA 4CUQA 4TU6A 5EICA 3FKMX 4KV1A 4CUPA 5D3RA 5FE0A 4YBSA 4QSUA 4LDFA 3U5OA 5HRVA 4UIVA 4UIYA 5FFVA 5KTWA 5IGLA 5A5OA 4Z6HA 2OSSA 5EPSA 5F61A 3QZTA 4C66A 4O70A 4QSWA 5CQ5A 5CUGA 4MR6A 5DLXA 5L96A 5A85A 5LUUA 4UIZA 2YEMA 4O7EA 5DX4A 4HXOA 2FSAA 5D7XA 4UYFB 3JVKA 4O7FA 5D3SA 2E7OA 3MB4A 4QR3A 5CRZA 5CUEA 3U5PA 4YADA 5HFQA 5IGMA 2RNXA 4BW3A 4YYMA 3UV5A 4CL9A 4HBVA 4TT6A 5F1LA 4X2IA 4CFKA 4CUTA 2KTBB 4Z6IA 4A9OA 2RNWA 5CUCA 1X0JA 4A9JA 5A5SA 4QEVA 4ZW1A 4BW4A 5CPEA 5CUAA 5CQ8A 4IORA 5CY9A 5LJ1A 5ENCA 3MUKA 5D3HA 3O36A 4XY9A 5II2A 4NQNA 4QSTA 5F1HA 4UIWA 2YQDA 5E9VA 4QSRA 3LQIA 5HQ6A 4HXLA 4MR5A 5A81A 5FE5A 4LZ2A 5ACYA 1F68A 5IGKA 3IU5A 5F36A 3U5MA 5E9YA 5AMEA 5FH7A 4CFLA 4NUDA 3SVGA 5FE3A 4CLBA 4NR7A 2G4AA 3JVMA 2F6NA 4J0SA 4Z1QA 4YYJA 5ENEA 3P1EA 4LYWA 5DKCA 4O74A 3U5JA 2OUOA 3D7CA 5I29A 3P1CA 3K2JA 5JI8A 3HMEA 5FH6A 2L84A 5LKXA 4QSVA 5EWHA 2WP2A 4O78A 5LKTA 4O77A 4UYFA 1WUGA 5CS8A 5EWVA 3SVFA 5A5NA 4QC3A 3UV4A 5FG6A 5L98A 5FE6A 4HXPA 5HQ7A 4NRAA 5CUBA 5FE7A 3LQHA 4QR5A 5FB1A 5AMFA 5BT3A 4NRBA 5I88A 2DKWA 3P1FA 5DYXA 2YW5A 4LZRA 5CU8A 4YY4A 4UITA 4UYEA 3U5LA 5BT4A 5ENHA 4NS5A 5ENFA 3UW9A 3HMHA 5A7CA 5EV9A 2D9EA 4WHUA 4MEPA 5G4SA 4PKLA 4MR3A 5FH8A 5DW1A 5ENGA 5H85A 4ZQLA 2RFJA 4PS5A 5ENBA 3G0JA 5CQAA 4NR6A 5I86A 4QSSA 4MEOA 5L8TA 4UIUA 3JVLA 4N3WA 4J0RA 2DATA 5E3GA 4LC2A 3UVYA 4A9LA 5AD3A 5I89A 5D3PA 2R0VA 4HXRA 2DVQA 4NRCA 4GPJA 1WUMA 4QY4A 5CTLA 4IOOA 2WP1A 4IR4A 4AKNA 5FBXA 5ENIA 4LRGA 5DKHA 4ALGA 3UV2A 5CQ7A 5KTUA 5A83A 5LVQA 5IG6A 5CQ3A 4UYGA 4YYKA 5L99A 5CQTA 5G4RA 5IGNA 2R10A 3IU6A 4TZ8A 4XYAA 5D24A 5A82A 5LJ2A 4IOQA 5EA1A 4IR5A 4KCXA 4MEQA 2LSPB 2MJVB 5DYUA 4PCIA 5EPRA 4KV4A 3O35A 5CUDA 4NXJA 5LKUA 4YYGA 4J3IA 5E9KA 5DFBA 2RI7A 5D3JA 5C7NA 2I8NA 2NXBA 2YELA 4HBWA 2DVSA 4O72A 4TTEA 3Q2FA 4IR6A 5LJ0A 2RNYA 3LJWA 5TCMA 2GRCA 5EGUA 3MB3A 5E9LA
chains in the Genus database with same CATH superfamily
5A5RA 4YYNA 3S92A 5F62A 4NR9A 5DKDA 4WIVA 5CQ4A 4YATA 5HRXA 5COIA 5J0DA 4NR8A 5D26A 5FE4A 4LZSA 5BT5A 4TQNA 5ETDA 4CUSA 5JWMA 1JSPB 5HFRA 5L8UA 2L85A 4IR3A 3I3JA 4XUAA 4BW2A 5H1TA 5H1UA 3Q2EA 4XY8A 1JM4B 3VKGA 4QEWA 5C89A 3DWYA 5CGPA 5DFCA 3O37A 3JVJA 4J1PA 5FDZA 2R0SA 4NYVA 4Y03A 3O33A 5F3AA 5FE9A 5KU3A 1EQFA 5E74A 4YY6A 4FLPA 3NXBA 4YBTA 4YAXA 5II1A 4YYDA 3AQAA 4N4IA 5E7DA 5F60A 3MULA 4QSQA 4N4GA 4NUCA 5F25A 5HENA 5HEMA 4RVRA 5EVAA 5DW2A 4YYIA 4YABA 4NYXA 4O7AA 5CP5A 4TYLA 4WHWA 5CRMA 4OGJA 5C85A 5E0RA 4O7BA 4CUUA 4LYSA 1ZS5A 3QZSA 4NUEA 5EISA 2YDWA 5EU1A 4QEUA 5KHMA 4UIXA 5EWCA 5C87A 5K29A 5HJCA 3HMFA 5EI4A 2RO1A 5EM3A 5D3TA 4QC1A 4XUBA 5FE2A 5LKZA 3G0LA 5IIDA 4F3IA 5L97A 4BHWA 5HM0A 3RCWA 5HCLA 2E3KA 3VKHA 2D82A 4HXMA 2OO1A 5FB0A 4TU4A 3ONIA 4CURA 2F6JA 3GG3A 5D3NA 2H60A 4ALHA 4E96A 4Z1SA 4A9HA 4OGIA 5EWWA 3U5NA 5LVRA 5CZGA 5CQ6A 4O76A 4QR4A 1N72A 4NQMA 5EWDA 5FG5A 4A9IA 2DVVA 5FFWA 5D25A 5F2PA 4ZC9A 4QZSA 4O75A 4QUTA 4YBMA 5HQ5A 4LYIA 4Q0OA 3ERRA 2I7KA 5DLZA 4QYLA 4YYHA 4HXKA 5KO4A 2RS9B 4QYDA 4NR5A 3SVHA 4N4FA 4OUFA 1E6IA 5CFWA 5DFDA 5F5ZA 3TLPA 4YH4A 5EP7A 3MXFA 4HXNA 5FE1A 4A9FA 2N9GA 5E73A 5KTXA 4TT4A 5I1QA 4HBXA 5A5PA 3UVWA 5TB6A 4HBYA 4QSXA 5I40A 4UYHA 3AADA 5HRWA 2L5EA 5IBNA 3QZVA 5AD2A 5C4QA 4C67A 4YC9A 4UYDA 2YEKA 4Z93A 5E9IA 4A9KA 3O34A 2YYNA 5I80A 2DVRA 5DBMA 3LQJA 4A9EA 4AKIA 2DWWA 5C8GA 4O7CA 3LXJA 5F63A 4BJXA 4QSPA 4QUUA 3S91A 4HXSA 3U5KA 4MENA 5HLSA 5D3LA 3DAIA 5EQ1A 3UVXA 4AKGA 5EPBA 4QB3A 2E7NA 3P1DA 4PY6A 4DONA 5ENJA 4YK0A 5ETBA 4A9NA 4PTBA 4LR6A 4MR4A 5EK9A 5DYCA 5I7XA 4TS8A 5DY7A 5I7YA 4QNSA 4YH3A 4TZ2A 3ZYUA 4NYWA 5E9MA 4N4HA 4Q0NA 4O71A 3MQMA 5HELA 5FFYA 5H1VA 5FE8A 5DYAA 3P5OA 4TT2A 5I83A 2R0YA 4QBMA 5E3DA 5FG4A 3UVDA 4A9MA 4PCEA 4BW1A 4NR4A 5A5QA 5D0CA 4CUQA 4TU6A 2EJNA 5EICA 3FKMX 4KV1A 4CUPA 5D3RA 5FE0A 4YBSA 4QSUA 4LDFA 3U5OA 5HRVA 4UIVA 4UIYA 5FFVA 5KTWA 5IGLA 5A5OA 4Z6HA 2OSSA 5EPSA 5F61A 3QZTA 4C66A 4O70A 4QSWA 5CQ5A 5CUGA 4MR6A 5DLXA 5L96A 5A85A 5LUUA 4UIZA 2YEMA 4O7EA 5DX4A 4HXOA 2FSAA 5D7XA 4UYFB 3JVKA 4O7FA 5D3SA 2E7OA 3MB4A 4QR3A 5CRZA 5CUEA 3U5PA 4YADA 5HFQA 3D1BA 5IGMA 2RNXA 4BW3A 4YYMA 3UV5A 4CL9A 4HBVA 4TT6A 5F1LA 4X2IA 4CFKA 4CUTA 2KTBB 4Z6IA 1ZKRA 4A9OA 2RNWA 5CUCA 1X0JA 4A9JA 5A5SA 4QEVA 4ZW1A 4BW4A 5CPEA 5CUAA 5CQ8A 4IORA 1PUOA 5CY9A 5LJ1A 5ENCA 3MUKA 5D3HA 3O36A 4XY9A 5II2A 4NQNA 4QSTA 5F1HA 4UIWA 2YQDA 5E9VA 4QSRA 3LQIA 5HQ6A 4HXLA 4MR5A 5A81A 5FE5A 4LZ2A 5ACYA 1F68A 5IGKA 3IU5A 3D1DA 5F36A 3U5MA 5E9YA 5AMEA 5FH7A 4CFLA 4NUDA 3SVGA 5FE3A 4CLBA 4NR7A 2G4AA 3JVMA 2F6NA 4J0SA 4Z1QA 4YYJA 5ENEA 3P1EA 4LYWA 5DKCA 4O74A 3U5JA 2OUOA 3D7CA 5I29A 3P1CA 3K2JA 5JI8A 3HMEA 5FH6A 2L84A 5LKXA 4QSVA 5EWHA 2WP2A 4O78A 5LKTA 4O77A 4UYFA 1WUGA 5CS8A 5EWVA 3SVFA 5A5NA 4QC3A 3UV4A 5FG6A 5L98A 5FE6A 4HXPA 5HQ7A 4NRAA 5CUBA 5FE7A 3LQHA 4QR5A 5FB1A 5AMFA 5BT3A 4NRBA 5I88A 2DKWA 3P1FA 5DYXA 2YW5A 4LZRA 5CU8A 4YY4A 4AKHA 4UITA 4UYEA 3U5LA 5BT4A 5ENHA 4NS5A 5ENFA 3UW9A 3HMHA 5A7CA 5EV9A 2D9EA 4WHUA 4MEPA 5G4SA 4PKLA 4MR3A 5FH8A 5DW1A 5ENGA 5H85A 4ZQLA 2RFJA 4PS5A 5ENBA 3G0JA 5CQAA 4NR6A 5I86A 4QSSA 4MEOA 5L8TA 4UIUA 3JVLA 4N3WA 4J0RA 2DATA 5E3GA 4LC2A 3UVYA 4A9LA 5AD3A 5I89A 5D3PA 2R0VA 4HXRA 2DVQA 4NRCA 4GPJA 1WUMA 4QY4A 5CTLA 4IOOA 2WP1A 4IR4A 4AKNA 5FBXA 5ENIA 4LRGA 5DKHA 4ALGA 4AI6A 3UV2A 5CQ7A 5KTUA 5A83A 5LVQA 5IG6A 5CQ3A 4UYGA 4YYKA 5L99A 5CQTA 5G4RA 5IGNA 2R10A 3IU6A 4TZ8A 4XYAA 5D24A 5A82A 5LJ2A 4IOQA 5EA1A 4IR5A 4KCXA 4MEQA 2LSPB 2MJVB 5DYUA 4PCIA 5EPRA 4KV4A 3O35A 5CUDA 4NXJA 5LKUA 4YYGA 4J3IA 5E9KA 5DFBA 2RI7A 5D3JA 5C7NA 2I8NA 2NXBA 2YELA 4HBWA 2DVSA 4O72A 4TTEA 3Q2FA 4IR6A 5LJ0A 2RNYA 3LJWA 5TCMA 2GRCA 5EGUA 3MB3A 5E9LA
chains in the Genus database with same CATH topology
5A5RA 4YYNA 3S92A 5F62A 4NR9A 5DKDA 4WIVA 5CQ4A 4YATA 5HRXA 5COIA 5J0DA 4NR8A 5D26A 5FE4A 4LZSA 5BT5A 4TQNA 5ETDA 4CUSA 5JWMA 1JSPB 5HFRA 5L8UA 2L85A 4IR3A 3I3JA 4XUAA 4BW2A 5H1TA 5H1UA 3Q2EA 4XY8A 1JM4B 4QEWA 5C89A 3DWYA 5CGPA 5DFCA 3O37A 3JVJA 4J1PA 5FDZA 2R0SA 4NYVA 4Y03A 3O33A 5F3AA 5FE9A 5KU3A 1EQFA 5E74A 4YY6A 4FLPA 3NXBA 4YBTA 4YAXA 5II1A 4YYDA 3AQAA 4N4IA 5E7DA 5F60A 3MULA 4QSQA 4N4GA 4NUCA 5F25A 5HENA 5HEMA 4RVRA 5EVAA 5DW2A 4YYIA 4YABA 4NYXA 4O7AA 5CP5A 4TYLA 4WHWA 5CRMA 4OGJA 5C85A 5E0RA 4O7BA 4CUUA 4LYSA 1ZS5A 3QZSA 4NUEA 5EISA 2YDWA 5EU1A 4QEUA 5KHMA 4UIXA 5EWCA 5C87A 5K29A 5HJCA 3HMFA 5EI4A 2RO1A 5EM3A 5D3TA 4QC1A 4XUBA 5FE2A 5LKZA 3G0LA 5IIDA 4F3IA 5L97A 4BHWA 5HM0A 3RCWA 5HCLA 2E3KA 2D82A 4HXMA 2OO1A 5FB0A 4TU4A 3ONIA 4CURA 2F6JA 3GG3A 5D3NA 2H60A 4ALHA 4E96A 4Z1SA 4A9HA 4OGIA 5EWWA 3U5NA 5LVRA 5CZGA 5CQ6A 4O76A 4QR4A 1N72A 4NQMA 5EWDA 5FG5A 4A9IA 2DVVA 5FFWA 5D25A 5F2PA 4ZC9A 4QZSA 4O75A 4QUTA 4YBMA 5HQ5A 4LYIA 4Q0OA 2I7KA 5DLZA 4QYLA 4YYHA 4HXKA 5KO4A 2RS9B 4QYDA 4NR5A 3SVHA 4N4FA 4OUFA 1E6IA 5CFWA 5DFDA 5F5ZA 3TLPA 4YH4A 5EP7A 3MXFA 4HXNA 5FE1A 4A9FA 2N9GA 5E73A 5KTXA 4TT4A 5I1QA 4HBXA 5A5PA 3UVWA 5TB6A 4HBYA 4QSXA 5I40A 4UYHA 3AADA 5HRWA 2L5EA 5IBNA 3QZVA 5AD2A 5C4QA 4C67A 4YC9A 4UYDA 2YEKA 4Z93A 5E9IA 4A9KA 3O34A 2YYNA 5I80A 2DVRA 5DBMA 3LQJA 4A9EA 2DWWA 5C8GA 4O7CA 3LXJA 5F63A 4BJXA 4QSPA 4QUUA 3S91A 4HXSA 3U5KA 4MENA 5HLSA 5D3LA 3DAIA 5EQ1A 3UVXA 5EPBA 4QB3A 2E7NA 3P1DA 4PY6A 4DONA 5ENJA 4YK0A 5ETBA 4A9NA 4PTBA 4LR6A 4MR4A 5EK9A 5DYCA 5I7XA 4TS8A 5DY7A 5I7YA 4QNSA 4YH3A 4TZ2A 3ZYUA 4NYWA 5E9MA 4N4HA 4Q0NA 4O71A 3MQMA 5HELA 5FFYA 5H1VA 5FE8A 5DYAA 3P5OA 4TT2A 5I83A 2R0YA 4QBMA 5E3DA 5FG4A 3UVDA 4A9MA 4PCEA 4BW1A 4NR4A 5A5QA 5D0CA 4CUQA 4TU6A 5EICA 3FKMX 4KV1A 4CUPA 5D3RA 5FE0A 4YBSA 4QSUA 4LDFA 3U5OA 5HRVA 4UIVA 4UIYA 5FFVA 5KTWA 5IGLA 5A5OA 4Z6HA 2OSSA 5EPSA 5F61A 3QZTA 4C66A 4O70A 4QSWA 5CQ5A 5CUGA 4MR6A 5DLXA 5L96A 5A85A 5LUUA 4UIZA 2YEMA 4O7EA 5DX4A 4HXOA 2FSAA 5D7XA 4UYFB 3JVKA 4O7FA 5D3SA 2E7OA 3MB4A 4QR3A 5CRZA 5CUEA 3U5PA 4YADA 5HFQA 5IGMA 2RNXA 4BW3A 4YYMA 3UV5A 4CL9A 4HBVA 4TT6A 5F1LA 4X2IA 4CFKA 4CUTA 2KTBB 4Z6IA 4A9OA 2RNWA 5CUCA 1X0JA 4A9JA 5A5SA 4QEVA 4ZW1A 4BW4A 5CPEA 5CUAA 5CQ8A 4IORA 5CY9A 5LJ1A 5ENCA 3MUKA 5D3HA 3O36A 4XY9A 5II2A 4NQNA 4QSTA 5F1HA 4UIWA 2YQDA 5E9VA 4QSRA 3LQIA 5HQ6A 4HXLA 4MR5A 5A81A 5FE5A 4LZ2A 5ACYA 1F68A 5IGKA 3IU5A 5F36A 3U5MA 5E9YA 5AMEA 5FH7A 4CFLA 4NUDA 3SVGA 5FE3A 4CLBA 4NR7A 2G4AA 3JVMA 2F6NA 4J0SA 4Z1QA 4YYJA 5ENEA 3P1EA 4LYWA 5DKCA 4O74A 3U5JA 2OUOA 3D7CA 5I29A 3P1CA 3K2JA 5JI8A 3HMEA 5FH6A 2L84A 5LKXA 4QSVA 5EWHA 2WP2A 4O78A 5LKTA 4O77A 4UYFA 1WUGA 5CS8A 5EWVA 3SVFA 5A5NA 4QC3A 3UV4A 5FG6A 5L98A 5FE6A 4HXPA 5HQ7A 4NRAA 5CUBA 5FE7A 3LQHA 4QR5A 5FB1A 5AMFA 5BT3A 4NRBA 5I88A 2DKWA 3P1FA 5DYXA 2YW5A 4LZRA 5CU8A 4YY4A 4UITA 4UYEA 3U5LA 5BT4A 5ENHA 4NS5A 5ENFA 3UW9A 3HMHA 5A7CA 5EV9A 2D9EA 4WHUA 4MEPA 5G4SA 4PKLA 4MR3A 5FH8A 5DW1A 5ENGA 5H85A 4ZQLA 2RFJA 4PS5A 5ENBA 3G0JA 5CQAA 4NR6A 5I86A 4QSSA 4MEOA 5L8TA 4UIUA 3JVLA 4N3WA 4J0RA 2DATA 5E3GA 4LC2A 3UVYA 4A9LA 5AD3A 5I89A 5D3PA 2R0VA 4HXRA 2DVQA 4NRCA 4GPJA 1WUMA 4QY4A 5CTLA 4IOOA 2WP1A 4IR4A 4AKNA 5FBXA 5ENIA 4LRGA 5DKHA 4ALGA 3UV2A 5CQ7A 5KTUA 5A83A 5LVQA 5IG6A 5CQ3A 4UYGA 4YYKA 5L99A 5CQTA 5G4RA 5IGNA 2R10A 3IU6A 4TZ8A 4XYAA 5D24A 5A82A 5LJ2A 4IOQA 5EA1A 4IR5A 4KCXA 4MEQA 2LSPB 2MJVB 5DYUA 4PCIA 5EPRA 4KV4A 3O35A 5CUDA 4NXJA 5LKUA 4YYGA 4J3IA 5E9KA 5DFBA 2RI7A 5D3JA 5C7NA 2I8NA 2NXBA 2YELA 4HBWA 2DVSA 4O72A 4TTEA 3Q2FA 4IR6A 5LJ0A 2RNYA 3LJWA 5TCMA 2GRCA 5EGUA 3MB3A 5E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5R A;  4YYN A;  3S92 A;  5F62 A;  4NR9 A;  5DKD A;  4WIV A;  5CQ4 A;  4YAT A;  5HRX A;  5COI A;  5J0D A;  4NR8 A;  5D26 A;  5FE4 A;  4LZS A;  5BT5 A;  4TQN A;  5ETD A;  4CUS A;  5JWM A;  1JSP B;  5HFR A;  5L8U A;  2L85 A;  4IR3 A;  3I3J A;  4XUA A;  4BW2 A;  5H1T A;  5H1U A;  3Q2E A;  4XY8 A;  1JM4 B;  4QEW A;  5C89 A;  3DWY A;  5CGP A;  5DFC A;  3O37 A;  3JVJ A;  4J1P A;  5FDZ A;  2R0S A;  4NYV A;  4Y03 A;  3O33 A;  5F3A A;  5FE9 A;  5KU3 A;  1EQF A;  5E74 A;  4YY6 A;  4FLP A;  3NXB A;  4YBT A;  4YAX A;  5II1 A;  4YYD A;  3AQA A;  4N4I A;  5E7D A;  5F60 A;  3MUL A;  4QSQ A;  4N4G A;  4NUC A;  5F25 A;  5HEN A;  5HEM A;  4RVR A;  5EVA A;  5DW2 A;  4YYI A;  4YAB A;  4NYX A;  4O7A A;  5CP5 A;  4TYL A;  4WHW A;  5CRM A;  4OGJ A;  5C85 A;  5E0R A;  4O7B A;  4CUU A;  4LYS A;  1ZS5 A;  3QZS A;  4NUE A;  5EIS A;  2YDW A;  5EU1 A;  4QEU A;  5KHM A;  4UIX A;  5EWC A;  5C87 A;  5K29 A;  5HJC A;  3HMF A;  5EI4 A;  2RO1 A;  5EM3 A;  5D3T A;  4QC1 A;  4XUB A;  5FE2 A;  5LKZ A;  3G0L A;  5IID A;  4F3I A;  5L97 A;  4BHW A;  5HM0 A;  3RCW A;  5HCL A;  2E3K A;  2D82 A;  4HXM A;  2OO1 A;  5FB0 A;  4TU4 A;  3ONI A;  4CUR A;  2F6J A;  3GG3 A;  5D3N A;  2H60 A;  4ALH A;  4E96 A;  4Z1S A;  4A9H A;  4OGI A;  5EWW A;  3U5N A;  5LVR A;  5CZG A;  5CQ6 A;  4O76 A;  4QR4 A;  1N72 A;  4NQM A;  5EWD A;  5FG5 A;  4A9I A;  2DVV A;  5FFW A;  5D25 A;  5F2P A;  4ZC9 A;  4QZS A;  4O75 A;  4QUT A;  4YBM A;  5HQ5 A;  4LYI A;  4Q0O A;  2I7K A;  5DLZ A;  4QYL A;  4YYH A;  4HXK A;  5KO4 A;  2RS9 B;  4QYD A;  4NR5 A;  3SVH A;  4N4F A;  4OUF A;  1E6I A;  5CFW A;  5DFD A;  5F5Z A;  3TLP A;  4YH4 A;  5EP7 A;  3MXF A;  4HXN A;  5FE1 A;  4A9F A;  2N9G A;  5E73 A;  5KTX A;  4TT4 A;  5I1Q A;  4HBX A;  5A5P A;  3UVW A;  5TB6 A;  4HBY A;  4QSX A;  5I40 A;  4UYH A;  3AAD A;  5HRW A;  2L5E A;  5IBN A;  3QZV A;  5AD2 A;  5C4Q A;  4C67 A;  4YC9 A;  4UYD A;  2YEK A;  4Z93 A;  5E9I A;  4A9K A;  3O34 A;  2YYN A;  5I80 A;  2DVR A;  5DBM A;  3LQJ A;  4A9E A;  2DWW A;  5C8G A;  4O7C A;  3LXJ A;  5F63 A;  4BJX A;  4QSP A;  4QUU A;  3S91 A;  4HXS A;  3U5K A;  4MEN A;  5HLS A;  5D3L A;  3DAI A;  5EQ1 A;  3UVX A;  5EPB A;  4QB3 A;  2E7N A;  3P1D A;  4PY6 A;  4DON A;  5ENJ A;  4YK0 A;  5ETB A;  4A9N A;  4PTB A;  4LR6 A;  4MR4 A;  5EK9 A;  5DYC A;  5I7X A;  4TS8 A;  5DY7 A;  5I7Y A;  4QNS A;  4YH3 A;  4TZ2 A;  3ZYU A;  4NYW A;  5E9M A;  4N4H A;  4Q0N A;  4O71 A;  3MQM A;  5HEL A;  5FFY A;  5H1V A;  5FE8 A;  5DYA A;  3P5O A;  4TT2 A;  5I83 A;  2R0Y A;  4QBM A;  5E3D A;  5FG4 A;  3UVD A;  4A9M A;  4PCE A;  4BW1 A;  4NR4 A;  5A5Q A;  5D0C A;  4CUQ A;  4TU6 A;  5EIC A;  3FKM X;  4KV1 A;  4CUP A;  5D3R A;  5FE0 A;  4YBS A;  4QSU A;  4LDF A;  3U5O A;  5HRV A;  4UIV A;  4UIY A;  5FFV A;  5KTW A;  5IGL A;  5A5O A;  4Z6H A;  2OSS A;  5EPS A;  5F61 A;  3QZT A;  4C66 A;  4O70 A;  4QSW A;  5CQ5 A;  5CUG A;  4MR6 A;  5DLX A;  5L96 A;  5A85 A;  5LUU A;  4UIZ A;  2YEM A;  4O7E A;  5DX4 A;  4HXO A;  2FSA A;  5D7X A;  4UYF B;  3JVK A;  4O7F A;  5D3S A;  2E7O A;  3MB4 A;  4QR3 A;  5CRZ A;  5CUE A;  3U5P A;  4YAD A;  5HFQ A;  5IGM A;  2RNX A;  4BW3 A;  4YYM A;  3UV5 A;  4CL9 A;  4HBV A;  4TT6 A;  5F1L A;  4X2I A;  4CFK A;  4CUT A;  2KTB B;  4Z6I A;  4A9O A;  2RNW A;  5CUC A;  1X0J A;  4A9J A;  5A5S A;  4QEV A;  4ZW1 A;  4BW4 A;  5CPE A;  5CUA A;  5CQ8 A;  4IOR A;  5CY9 A;  5LJ1 A;  5ENC A;  3MUK A;  5D3H A;  3O36 A;  4XY9 A;  5II2 A;  4NQN A;  4QST A;  5F1H A;  4UIW A;  2YQD A;  5E9V A;  4QSR A;  3LQI A;  5HQ6 A;  4HXL A;  4MR5 A;  5A81 A;  5FE5 A;  4LZ2 A;  5ACY A;  1F68 A;  5IGK A;  3IU5 A;  5F36 A;  3U5M A;  5E9Y A;  5AME A;  5FH7 A;  4CFL A;  4NUD A;  3SVG A;  5FE3 A;  4CLB A;  4NR7 A;  2G4A A;  3JVM A;  2F6N A;  4J0S A;  4Z1Q A;  4YYJ A;  5ENE A;  3P1E A;  4LYW A;  5DKC A;  4O74 A;  3U5J A;  2OUO A;  3D7C A;  5I29 A;  3P1C A;  3K2J A;  5JI8 A;  3HME A;  5FH6 A;  2L84 A;  5LKX A;  4QSV A;  5EWH A;  2WP2 A;  4O78 A;  5LKT A;  4O77 A;  4UYF A;  1WUG A;  5CS8 A;  5EWV A;  3SVF A;  5A5N A;  4QC3 A;  3UV4 A;  5FG6 A;  5L98 A;  5FE6 A;  4HXP A;  5HQ7 A;  4NRA A;  5CUB A;  5FE7 A;  3LQH A;  4QR5 A;  5FB1 A;  5AMF A;  5BT3 A;  4NRB A;  5I88 A;  2DKW A;  3P1F A;  5DYX A;  2YW5 A;  4LZR A;  5CU8 A;  4YY4 A;  4UIT A;  4UYE A;  3U5L A;  5BT4 A;  5ENH A;  4NS5 A;  5ENF A;  3UW9 A;  3HMH A;  5A7C A;  5EV9 A;  2D9E A;  4WHU A;  4MEP A;  5G4S A;  4PKL A;  4MR3 A;  5FH8 A;  5DW1 A;  5ENG A;  5H85 A;  4ZQL A;  2RFJ A;  4PS5 A;  5ENB A;  3G0J A;  5CQA A;  4NR6 A;  5I86 A;  4QSS A;  4MEO A;  5L8T A;  4UIU A;  3JVL A;  4N3W A;  4J0R A;  2DAT A;  5E3G A;  4LC2 A;  3UVY A;  4A9L A;  5AD3 A;  5I89 A;  5D3P A;  2R0V A;  4HXR A;  2DVQ A;  4NRC A;  4GPJ A;  1WUM A;  4QY4 A;  5CTL A;  4IOO A;  2WP1 A;  4IR4 A;  4AKN A;  5FBX A;  5ENI A;  4LRG A;  5DKH A;  4ALG A;  3UV2 A;  5CQ7 A;  5KTU A;  5A83 A;  5LVQ A;  5IG6 A;  5CQ3 A;  4UYG A;  4YYK A;  5L99 A;  5CQT A;  5G4R A;  5IGN A;  2R10 A;  3IU6 A;  4TZ8 A;  4XYA A;  5D24 A;  5A82 A;  5LJ2 A;  4IOQ A;  5EA1 A;  4IR5 A;  4KCX A;  4MEQ A;  2LSP B;  2MJV B;  5DYU A;  4PCI A;  5EPR A;  4KV4 A;  3O35 A;  5CUD A;  4NXJ A;  5LKU A;  4YYG A;  4J3I A;  5E9K A;  5DFB A;  2RI7 A;  5D3J A;  5C7N A;  2I8N A;  2NXB A;  2YEL A;  4HBW A;  2DVS A;  4O72 A;  4TTE A;  3Q2F A;  4IR6 A;  5LJ0 A;  2RNY A;  3LJW A;  5TCM A;  2GRC A;  5EGU A;  3MB3 A;  5E9L A; 
#chains in the Genus database with same CATH topology
 5A5R A;  4YYN A;  3S92 A;  5F62 A;  4NR9 A;  5DKD A;  4WIV A;  5CQ4 A;  4YAT A;  5HRX A;  5COI A;  5J0D A;  4NR8 A;  5D26 A;  5FE4 A;  4LZS A;  5BT5 A;  4TQN A;  5ETD A;  4CUS A;  5JWM A;  1JSP B;  5HFR A;  5L8U A;  2L85 A;  4IR3 A;  3I3J A;  4XUA A;  4BW2 A;  5H1T A;  5H1U A;  3Q2E A;  4XY8 A;  1JM4 B;  3VKG A;  4QEW A;  5C89 A;  3DWY A;  5CGP A;  5DFC A;  3O37 A;  3JVJ A;  4J1P A;  5FDZ A;  2R0S A;  4NYV A;  4Y03 A;  3O33 A;  5F3A A;  5FE9 A;  5KU3 A;  1EQF A;  5E74 A;  4YY6 A;  4FLP A;  3NXB A;  4YBT A;  4YAX A;  5II1 A;  4YYD A;  3AQA A;  4N4I A;  5E7D A;  5F60 A;  3MUL A;  4QSQ A;  4N4G A;  4NUC A;  5F25 A;  5HEN A;  5HEM A;  4RVR A;  5EVA A;  5DW2 A;  4YYI A;  4YAB A;  4NYX A;  4O7A A;  5CP5 A;  4TYL A;  4WHW A;  5CRM A;  4OGJ A;  5C85 A;  5E0R A;  4O7B A;  4CUU A;  4LYS A;  1ZS5 A;  3QZS A;  4NUE A;  5EIS A;  2YDW A;  5EU1 A;  4QEU A;  5KHM A;  4UIX A;  5EWC A;  5C87 A;  5K29 A;  5HJC A;  3HMF A;  5EI4 A;  2RO1 A;  5EM3 A;  5D3T A;  4QC1 A;  4XUB A;  5FE2 A;  5LKZ A;  3G0L A;  5IID A;  4F3I A;  5L97 A;  4BHW A;  5HM0 A;  3RCW A;  5HCL A;  2E3K A;  3VKH A;  2D82 A;  4HXM A;  2OO1 A;  5FB0 A;  4TU4 A;  3ONI A;  4CUR A;  2F6J A;  3GG3 A;  5D3N A;  2H60 A;  4ALH A;  4E96 A;  4Z1S A;  4A9H A;  4OGI A;  5EWW A;  3U5N A;  5LVR A;  5CZG A;  5CQ6 A;  4O76 A;  4QR4 A;  1N72 A;  4NQM A;  5EWD A;  5FG5 A;  4A9I A;  2DVV A;  5FFW A;  5D25 A;  5F2P A;  4ZC9 A;  4QZS A;  4O75 A;  4QUT A;  4YBM A;  5HQ5 A;  4LYI A;  4Q0O A;  3ERR A;  2I7K A;  5DLZ A;  4QYL A;  4YYH A;  4HXK A;  5KO4 A;  2RS9 B;  4QYD A;  4NR5 A;  3SVH A;  4N4F A;  4OUF A;  1E6I A;  5CFW A;  5DFD A;  5F5Z A;  3TLP A;  4YH4 A;  5EP7 A;  3MXF A;  4HXN A;  5FE1 A;  4A9F A;  2N9G A;  5E73 A;  5KTX A;  4TT4 A;  5I1Q A;  4HBX A;  5A5P A;  3UVW A;  5TB6 A;  4HBY A;  4QSX A;  5I40 A;  4UYH A;  3AAD A;  5HRW A;  2L5E A;  5IBN A;  3QZV A;  5AD2 A;  5C4Q A;  4C67 A;  4YC9 A;  4UYD A;  2YEK A;  4Z93 A;  5E9I A;  4A9K A;  3O34 A;  2YYN A;  5I80 A;  2DVR A;  5DBM A;  3LQJ A;  4A9E A;  4AKI A;  2DWW A;  5C8G A;  4O7C A;  3LXJ A;  5F63 A;  4BJX A;  4QSP A;  4QUU A;  3S91 A;  4HXS A;  3U5K A;  4MEN A;  5HLS A;  5D3L A;  3DAI A;  5EQ1 A;  3UVX A;  4AKG A;  5EPB A;  4QB3 A;  2E7N A;  3P1D A;  4PY6 A;  4DON A;  5ENJ A;  4YK0 A;  5ETB A;  4A9N A;  4PTB A;  4LR6 A;  4MR4 A;  5EK9 A;  5DYC A;  5I7X A;  4TS8 A;  5DY7 A;  5I7Y A;  4QNS A;  4YH3 A;  4TZ2 A;  3ZYU A;  4NYW A;  5E9M A;  4N4H A;  4Q0N A;  4O71 A;  3MQM A;  5HEL A;  5FFY A;  5H1V A;  5FE8 A;  5DYA A;  3P5O A;  4TT2 A;  5I83 A;  2R0Y A;  4QBM A;  5E3D A;  5FG4 A;  3UVD A;  4A9M A;  4PCE A;  4BW1 A;  4NR4 A;  5A5Q A;  5D0C A;  4CUQ A;  4TU6 A;  2EJN A;  5EIC A;  3FKM X;  4KV1 A;  4CUP A;  5D3R A;  5FE0 A;  4YBS A;  4QSU A;  4LDF A;  3U5O A;  5HRV A;  4UIV A;  4UIY A;  5FFV A;  5KTW A;  5IGL A;  5A5O A;  4Z6H A;  2OSS A;  5EPS A;  5F61 A;  3QZT A;  4C66 A;  4O70 A;  4QSW A;  5CQ5 A;  5CUG A;  4MR6 A;  5DLX A;  5L96 A;  5A85 A;  5LUU A;  4UIZ A;  2YEM A;  4O7E A;  5DX4 A;  4HXO A;  2FSA A;  5D7X A;  4UYF B;  3JVK A;  4O7F A;  5D3S A;  2E7O A;  3MB4 A;  4QR3 A;  5CRZ A;  5CUE A;  3U5P A;  4YAD A;  5HFQ A;  3D1B A;  5IGM A;  2RNX A;  4BW3 A;  4YYM A;  3UV5 A;  4CL9 A;  4HBV A;  4TT6 A;  5F1L A;  4X2I A;  4CFK A;  4CUT A;  2KTB B;  4Z6I A;  1ZKR A;  4A9O A;  2RNW A;  5CUC A;  1X0J A;  4A9J A;  5A5S A;  4QEV A;  4ZW1 A;  4BW4 A;  5CPE A;  5CUA A;  5CQ8 A;  4IOR A;  1PUO A;  5CY9 A;  5LJ1 A;  5ENC A;  3MUK A;  5D3H A;  3O36 A;  4XY9 A;  5II2 A;  4NQN A;  4QST A;  5F1H A;  4UIW A;  2YQD A;  5E9V A;  4QSR A;  3LQI A;  5HQ6 A;  4HXL A;  4MR5 A;  5A81 A;  5FE5 A;  4LZ2 A;  5ACY A;  1F68 A;  5IGK A;  3IU5 A;  3D1D A;  5F36 A;  3U5M A;  5E9Y A;  5AME A;  5FH7 A;  4CFL A;  4NUD A;  3SVG A;  5FE3 A;  4CLB A;  4NR7 A;  2G4A A;  3JVM A;  2F6N A;  4J0S A;  4Z1Q A;  4YYJ A;  5ENE A;  3P1E A;  4LYW A;  5DKC A;  4O74 A;  3U5J A;  2OUO A;  3D7C A;  5I29 A;  3P1C A;  3K2J A;  5JI8 A;  3HME A;  5FH6 A;  2L84 A;  5LKX A;  4QSV A;  5EWH A;  2WP2 A;  4O78 A;  5LKT A;  4O77 A;  4UYF A;  1WUG A;  5CS8 A;  5EWV A;  3SVF A;  5A5N A;  4QC3 A;  3UV4 A;  5FG6 A;  5L98 A;  5FE6 A;  4HXP A;  5HQ7 A;  4NRA A;  5CUB A;  5FE7 A;  3LQH A;  4QR5 A;  5FB1 A;  5AMF A;  5BT3 A;  4NRB A;  5I88 A;  2DKW A;  3P1F A;  5DYX A;  2YW5 A;  4LZR A;  5CU8 A;  4YY4 A;  4AKH A;  4UIT A;  4UYE A;  3U5L A;  5BT4 A;  5ENH A;  4NS5 A;  5ENF A;  3UW9 A;  3HMH A;  5A7C A;  5EV9 A;  2D9E A;  4WHU A;  4MEP A;  5G4S A;  4PKL A;  4MR3 A;  5FH8 A;  5DW1 A;  5ENG A;  5H85 A;  4ZQL A;  2RFJ A;  4PS5 A;  5ENB A;  3G0J A;  5CQA A;  4NR6 A;  5I86 A;  4QSS A;  4MEO A;  5L8T A;  4UIU A;  3JVL A;  4N3W A;  4J0R A;  2DAT A;  5E3G A;  4LC2 A;  3UVY A;  4A9L A;  5AD3 A;  5I89 A;  5D3P A;  2R0V A;  4HXR A;  2DVQ A;  4NRC A;  4GPJ A;  1WUM A;  4QY4 A;  5CTL A;  4IOO A;  2WP1 A;  4IR4 A;  4AKN A;  5FBX A;  5ENI A;  4LRG A;  5DKH A;  4ALG A;  4AI6 A;  3UV2 A;  5CQ7 A;  5KTU A;  5A83 A;  5LVQ A;  5IG6 A;  5CQ3 A;  4UYG A;  4YYK A;  5L99 A;  5CQT A;  5G4R A;  5IGN A;  2R10 A;  3IU6 A;  4TZ8 A;  4XYA A;  5D24 A;  5A82 A;  5LJ2 A;  4IOQ A;  5EA1 A;  4IR5 A;  4KCX A;  4MEQ A;  2LSP B;  2MJV B;  5DYU A;  4PCI A;  5EPR A;  4KV4 A;  3O35 A;  5CUD A;  4NXJ A;  5LKU A;  4YYG A;  4J3I A;  5E9K A;  5DFB A;  2RI7 A;  5D3J A;  5C7N A;  2I8N A;  2NXB A;  2YEL A;  4HBW A;  2DVS A;  4O72 A;  4TTE A;  3Q2F A;  4IR6 A;  5LJ0 A;  2RNY A;  3LJW A;  5TCM A;  2GRC A;  5EGU A;  3MB3 A;  5E9L A; 
#chains in the Genus database with same CATH homology
 5A5R A;  4YYN A;  3S92 A;  5F62 A;  4NR9 A;  5DKD A;  4WIV A;  5CQ4 A;  4YAT A;  5HRX A;  5COI A;  5J0D A;  4NR8 A;  5D26 A;  5FE4 A;  4LZS A;  5BT5 A;  4TQN A;  5ETD A;  4CUS A;  5JWM A;  1JSP B;  5HFR A;  5L8U A;  2L85 A;  4IR3 A;  3I3J A;  4XUA A;  4BW2 A;  5H1T A;  5H1U A;  3Q2E A;  4XY8 A;  1JM4 B;  4QEW A;  5C89 A;  3DWY A;  5CGP A;  5DFC A;  3O37 A;  3JVJ A;  4J1P A;  5FDZ A;  2R0S A;  4NYV A;  4Y03 A;  3O33 A;  5F3A A;  5FE9 A;  5KU3 A;  1EQF A;  5E74 A;  4YY6 A;  4FLP A;  3NXB A;  4YBT A;  4YAX A;  5II1 A;  4YYD A;  3AQA A;  4N4I A;  5E7D A;  5F60 A;  3MUL A;  4QSQ A;  4N4G A;  4NUC A;  5F25 A;  5HEN A;  5HEM A;  4RVR A;  5EVA A;  5DW2 A;  4YYI A;  4YAB A;  4NYX A;  4O7A A;  5CP5 A;  4TYL A;  4WHW A;  5CRM A;  4OGJ A;  5C85 A;  5E0R A;  4O7B A;  4CUU A;  4LYS A;  1ZS5 A;  3QZS A;  4NUE A;  5EIS A;  2YDW A;  5EU1 A;  4QEU A;  5KHM A;  4UIX A;  5EWC A;  5C87 A;  5K29 A;  5HJC A;  3HMF A;  5EI4 A;  2RO1 A;  5EM3 A;  5D3T A;  4QC1 A;  4XUB A;  5FE2 A;  5LKZ A;  3G0L A;  5IID A;  4F3I A;  5L97 A;  4BHW A;  5HM0 A;  3RCW A;  5HCL A;  2E3K A;  2D82 A;  4HXM A;  2OO1 A;  5FB0 A;  4TU4 A;  3ONI A;  4CUR A;  2F6J A;  3GG3 A;  5D3N A;  2H60 A;  4ALH A;  4E96 A;  4Z1S A;  4A9H A;  4OGI A;  5EWW A;  3U5N A;  5LVR A;  5CZG A;  5CQ6 A;  4O76 A;  4QR4 A;  1N72 A;  4NQM A;  5EWD A;  5FG5 A;  4A9I A;  2DVV A;  5FFW A;  5D25 A;  5F2P A;  4ZC9 A;  4QZS A;  4O75 A;  4QUT A;  4YBM A;  5HQ5 A;  4LYI A;  4Q0O A;  2I7K A;  5DLZ A;  4QYL A;  4YYH A;  4HXK A;  5KO4 A;  2RS9 B;  4QYD A;  4NR5 A;  3SVH A;  4N4F A;  4OUF A;  1E6I A;  5CFW A;  5DFD A;  5F5Z A;  3TLP A;  4YH4 A;  5EP7 A;  3MXF A;  4HXN A;  5FE1 A;  4A9F A;  2N9G A;  5E73 A;  5KTX A;  4TT4 A;  5I1Q A;  4HBX A;  5A5P A;  3UVW A;  5TB6 A;  4HBY A;  4QSX A;  5I40 A;  4UYH A;  3AAD A;  5HRW A;  2L5E A;  5IBN A;  3QZV A;  5AD2 A;  5C4Q A;  4C67 A;  4YC9 A;  4UYD A;  2YEK A;  4Z93 A;  5E9I A;  4A9K A;  3O34 A;  2YYN A;  5I80 A;  2DVR A;  5DBM A;  3LQJ A;  4A9E A;  2DWW A;  5C8G A;  4O7C A;  3LXJ A;  5F63 A;  4BJX A;  4QSP A;  4QUU A;  3S91 A;  4HXS A;  3U5K A;  4MEN A;  5HLS A;  5D3L A;  3DAI A;  5EQ1 A;  3UVX A;  5EPB A;  4QB3 A;  2E7N A;  3P1D A;  4PY6 A;  4DON A;  5ENJ A;  4YK0 A;  5ETB A;  4A9N A;  4PTB A;  4LR6 A;  4MR4 A;  5EK9 A;  5DYC A;  5I7X A;  4TS8 A;  5DY7 A;  5I7Y A;  4QNS A;  4YH3 A;  4TZ2 A;  3ZYU A;  4NYW A;  5E9M A;  4N4H A;  4Q0N A;  4O71 A;  3MQM A;  5HEL A;  5FFY A;  5H1V A;  5FE8 A;  5DYA A;  3P5O A;  4TT2 A;  5I83 A;  2R0Y A;  4QBM A;  5E3D A;  5FG4 A;  3UVD A;  4A9M A;  4PCE A;  4BW1 A;  4NR4 A;  5A5Q A;  5D0C A;  4CUQ A;  4TU6 A;  5EIC A;  3FKM X;  4KV1 A;  4CUP A;  5D3R A;  5FE0 A;  4YBS A;  4QSU A;  4LDF A;  3U5O A;  5HRV A;  4UIV A;  4UIY A;  5FFV A;  5KTW A;  5IGL A;  5A5O A;  4Z6H A;  2OSS A;  5EPS A;  5F61 A;  3QZT A;  4C66 A;  4O70 A;  4QSW A;  5CQ5 A;  5CUG A;  4MR6 A;  5DLX A;  5L96 A;  5A85 A;  5LUU A;  4UIZ A;  2YEM A;  4O7E A;  5DX4 A;  4HXO A;  2FSA A;  5D7X A;  4UYF B;  3JVK A;  4O7F A;  5D3S A;  2E7O A;  3MB4 A;  4QR3 A;  5CRZ A;  5CUE A;  3U5P A;  4YAD A;  5HFQ A;  5IGM A;  2RNX A;  4BW3 A;  4YYM A;  3UV5 A;  4CL9 A;  4HBV A;  4TT6 A;  5F1L A;  4X2I A;  4CFK A;  4CUT A;  2KTB B;  4Z6I A;  4A9O A;  2RNW A;  5CUC A;  1X0J A;  4A9J A;  5A5S A;  4QEV A;  4ZW1 A;  4BW4 A;  5CPE A;  5CUA A;  5CQ8 A;  4IOR A;  5CY9 A;  5LJ1 A;  5ENC A;  3MUK A;  5D3H A;  3O36 A;  4XY9 A;  5II2 A;  4NQN A;  4QST A;  5F1H A;  4UIW A;  2YQD A;  5E9V A;  4QSR A;  3LQI A;  5HQ6 A;  4HXL A;  4MR5 A;  5A81 A;  5FE5 A;  4LZ2 A;  5ACY A;  1F68 A;  5IGK A;  3IU5 A;  5F36 A;  3U5M A;  5E9Y A;  5AME A;  5FH7 A;  4CFL A;  4NUD A;  3SVG A;  5FE3 A;  4CLB A;  4NR7 A;  2G4A A;  3JVM A;  2F6N A;  4J0S A;  4Z1Q A;  4YYJ A;  5ENE A;  3P1E A;  4LYW A;  5DKC A;  4O74 A;  3U5J A;  2OUO A;  3D7C A;  5I29 A;  3P1C A;  3K2J A;  5JI8 A;  3HME A;  5FH6 A;  2L84 A;  5LKX A;  4QSV A;  5EWH A;  2WP2 A;  4O78 A;  5LKT A;  4O77 A;  4UYF A;  1WUG A;  5CS8 A;  5EWV A;  3SVF A;  5A5N A;  4QC3 A;  3UV4 A;  5FG6 A;  5L98 A;  5FE6 A;  4HXP A;  5HQ7 A;  4NRA A;  5CUB A;  5FE7 A;  3LQH A;  4QR5 A;  5FB1 A;  5AMF A;  5BT3 A;  4NRB A;  5I88 A;  2DKW A;  3P1F A;  5DYX A;  2YW5 A;  4LZR A;  5CU8 A;  4YY4 A;  4UIT A;  4UYE A;  3U5L A;  5BT4 A;  5ENH A;  4NS5 A;  5ENF A;  3UW9 A;  3HMH A;  5A7C A;  5EV9 A;  2D9E A;  4WHU A;  4MEP A;  5G4S A;  4PKL A;  4MR3 A;  5FH8 A;  5DW1 A;  5ENG A;  5H85 A;  4ZQL A;  2RFJ A;  4PS5 A;  5ENB A;  3G0J A;  5CQA A;  4NR6 A;  5I86 A;  4QSS A;  4MEO A;  5L8T A;  4UIU A;  3JVL A;  4N3W A;  4J0R A;  2DAT A;  5E3G A;  4LC2 A;  3UVY A;  4A9L A;  5AD3 A;  5I89 A;  5D3P A;  2R0V A;  4HXR A;  2DVQ A;  4NRC A;  4GPJ A;  1WUM A;  4QY4 A;  5CTL A;  4IOO A;  2WP1 A;  4IR4 A;  4AKN A;  5FBX A;  5ENI A;  4LRG A;  5DKH A;  4ALG A;  3UV2 A;  5CQ7 A;  5KTU A;  5A83 A;  5LVQ A;  5IG6 A;  5CQ3 A;  4UYG A;  4YYK A;  5L99 A;  5CQT A;  5G4R A;  5IGN A;  2R10 A;  3IU6 A;  4TZ8 A;  4XYA A;  5D24 A;  5A82 A;  5LJ2 A;  4IOQ A;  5EA1 A;  4IR5 A;  4KCX A;  4MEQ A;  2LSP B;  2MJV B;  5DYU A;  4PCI A;  5EPR A;  4KV4 A;  3O35 A;  5CUD A;  4NXJ A;  5LKU A;  4YYG A;  4J3I A;  5E9K A;  5DFB A;  2RI7 A;  5D3J A;  5C7N A;  2I8N A;  2NXB A;  2YEL A;  4HBW A;  2DVS A;  4O72 A;  4TTE A;  3Q2F A;  4IR6 A;  5LJ0 A;  2RNY A;  3LJW A;  5TCM A;  2GRC A;  5EGU A;  3MB3 A;  5E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...