4YYDA

Crystal structure of brd9 bromodomain bound to a crotonyllysine peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
TPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 9
molecule tags Protein binding
source organism Homo sapiens
total genus 35
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yydA00
5LKUA 4NYVA 4CUPA 4NRBA 4RVRA 5HJCA 5HRWA 2E7OA 3U5LA 2RFJA 5CP5A 4YYHA 4LYWA 5EICA 4TZ8A 4ZW1A 5HQ5A 5D3SA 4QSWA 4YYMA 5KHMA 4NQNA 5DY7A 5JI8A 4BW2A 4N4GA 4C66A 5LKTA 2H60A 5L99A 4QSQA 2DVQA 5A82A 5I7XA 4IR4A 4O78A 5JWMA 3HMHA 3GG3A 2YQDA 4YYNA 4CUUA 4MR3A 4QBMA 5CQ7A 4Q0NA 5FE4A 4PCEA 5E3GA 5CGPA 4QSXA 4N4FA 5FH7A 3LJWA 3DWYA 2RI7A 2DVVA 5EU1A 5A5RA 5CQ8A 4QUTA 5D3PA 4UYDA 5EPRA 4YH4A 4O70A 5EWDA 4YY6A 3Q2FA 4IR6A 4PY6A 4NUEA 5C4QA 5ENBA 4WHWA 3MB4A 5EISA 5CUCA 5CQ5A 2LSPB 5D26A 5FE2A 4UYFA 5CQ6A 4J0RA 5HRXA 4IR3A 5IIDA 4XY9A 4YK0A 5CUEA 4TTEA 4HXRA 4NYXA 2DVSA 5LKXA 5A81A 3UV2A 5DW2A 4QY4A 5K29A 4QSUA 2F6JA 2OUOA 5L8UA 4QYDA 5C85A 5ENCA 5ETBA 5F3AA 5E9MA 5I1QA 5BT3A 5FE6A 5H1TA 4MENA 4MEQA 5L98A 4UITA 5DKDA 5EV9A 4YYJA 2L5EA 4IORA 5A85A 4PKLA 4CUSA 5CUDA 4HXOA 4O75A 3NXBA 3UVWA 4F3IA 5DFBA 2KTBB 4NR5A 5LVQA 4CFLA 4CL9A 5LUUA 1X0JA 4LZRA 4O76A 5DLXA 4TZ2A 5FE0A 5ENEA 4OGJA 5IGKA 4PCIA 5FG5A 2RO1A 4LC2A 4A9NA 4HBXA 2R0VA 5I88A 4BHWA 3SVGA 3HMFA 4Z93A 4XYAA 4NS5A 5IG6A 3K2JA 5C87A 3MUKA 3RCWA 4QSTA 4A9EA 4QR3A 5FFWA 4HXKA 5I83A 2E7NA 2YDWA 2WP1A 5A5PA 5EQ1A 5DBMA 3O33A 4YY4A 4GPJA 4NR8A 4DONA 5E3DA 4WIVA 5D3JA 1EQFA 1F68A 4IR5A 5F2PA 3S91A 5D3NA 2RNWA 2D9EA 5F1HA 5E9IA 4BW4A 4A9MA 3AADA 5TCMA 5AMEA 5KU3A 5CTLA 5CS8A 2I7KA 2I8NA 4NUDA 5H85A 4FLPA 5CU8A 4A9HA 4J0SA 5FE5A 4E96A 5EP7A 3S92A 3DAIA 4NXJA 5CQ3A 3LXJA 5FH6A 4OUFA 1N72A 4UYGA 5F25A 5IGLA 5A5SA 3MQMA 5EWVA 4YBTA 4NR7A 5KTUA 5TB6A 4CUTA 5ENIA 4QC3A 5EWHA 5HM0A 4YABA 5DFCA 5H1VA 4Z6HA 2DATA 4BW1A 5AMFA 5FB0A 4QR5A 3TLPA 4A9KA 4CLBA 4NYWA 2DKWA 4HXNA 4HBVA 4A9JA 5HCLA 5IGNA 4NUCA 5FFVA 4ALHA 4KV4A 5C7NA 4UYEA 3JVLA 3U5MA 4BW3A 2YELA 4YAXA 3G0LA 3MXFA 4TU6A 4LDFA 2N9GA 5F60A 2L85A 4YC9A 5D3RA 5CFWA 2YEMA 5EM3A 4O7AA 4UIWA 5F1LA 5EGUA 5IGMA 4A9OA 5FE1A 4XUAA 4HBWA 4PS5A 5DYAA 5FH8A 4BJXA 5EPSA 5D3HA 4CURA 5E7DA 5FB1A 5HQ6A 5CRZA 5KO4A 4O7BA 5ENHA 4YATA 5I7YA 5KTXA 4QEUA 4HXMA 4YYKA 4A9IA 5I89A 5DFDA 2R10A 4UIUA 4CUQA 5LJ1A 5BT5A 4QB3A 5DKHA 4O74A 3P1DA 4Z6IA 5D3TA 4NR4A 4QSRA 3P1FA 4YH3A 4QSVA 4O72A 4UIYA 5HELA 3QZVA 5E9KA 2RNXA 1WUMA 2GRCA 4HXSA 3U5KA 4LR6A 4O7CA 5FE7A 5FE3A 4NQMA 3SVFA 5LJ2A 3D7CA 4N3WA 4CFKA 5F36A 3HMEA 5E74A 4Z1SA 3O36A 5A5QA 5C89A 5F62A 2MJVB 5EWCA 5DLZA 2RS9B 5F61A 5CQAA 3I3JA 3O35A 2G4AA 5F63A 2R0YA 2DWWA 4A9LA 5L8TA 3FKMX 4XUBA 5H1UA 3LQIA 5C8GA 2L84A 5DYUA 3P5OA 3SVHA 3QZTA 4QEVA 5I86A 5HFRA 1JSPB 2NXBA 5ENGA 3IU5A 4ZQLA 4KCXA 3JVMA 5DYXA 1WUGA 3MULA 5HFQA 4YADA 4QSSA 5FE8A 5EK9A 5G4SA 4QYLA 5KTWA 2WP2A 4N4HA 1JM4B 2YW5A 5EPBA 4MEOA 5BT4A 2RNYA 3O37A 5CUGA 5E9LA 5D3LA 5ENJA 5II1A 4LYSA 5F5ZA 4C67A 4XY8A 5A5NA 5LKZA 5HLSA 4TT6A 5COIA 3AQAA 4QNSA 5A83A 2YYNA 4O7FA 3ZYUA 5D24A 4LZSA 5A5OA 4NR6A 5FE9A 4O71A 5EWWA 5FG4A 3LQHA 3UVYA 3U5OA 3UW9A 4IOQA 3UV5A 5AD2A 5CRMA 4QZSA 5FDZA 2YEKA 3G0JA 4TT4A 4UIZA 4UIXA 4N4IA 5CQ4A 4MR6A 4OGIA 3UVDA 5EA1A 4TS8A 3U5JA 5DW1A 4QC1A 5FBXA 3P1EA 4NR9A 3UV4A 4TQNA 5AD3A 4LYIA 5J0DA 5ENFA 4IOOA 5CY9A 4A9FA 5I29A 4HBYA 4MR4A 4QUUA 5CZGA 5IBNA 1ZS5A 5CUAA 5EVAA 4TT2A 4QR4A 3P1CA 3MB3A 3JVKA 4J1PA 3U5NA 2DVRA 4UIVA 4KV1A 4O7EA 2FSAA 5FG6A 5HQ7A 5CPEA 5LJ0A 5DKCA 5E9YA 2R0SA 4MR5A 4Q0OA 4YBMA 4Y03A 5I80A 5CUBA 4X2IA 4AKNA 5ETDA 4MEPA 4HXLA 5A7CA 5D7XA 2F6NA 4ZC9A 5FFYA 3IU6A 4UYFB 4PTBA 5HENA 5L96A 2OSSA 3JVJA 3LQJA 5EI4A 4ALGA 3QZSA 4HXPA 3ONIA 4TYLA 5G4RA 4YBSA 3Q2EA 4O77A 5LVRA 2OO1A 5D25A 4NRAA 4J3IA 5E0RA 4QSPA 4QEWA 3UVXA 2E3KA 5HEMA 4UYHA 3O34A 4YYDA 5ACYA 5E73A 4TU4A 4WHUA 3U5PA 5DYCA 1E6IA 5HRVA 4LRGA 5CQTA 5L97A 4YYIA 4NRCA 5E9VA 5II2A 4YYGA 5D0CA 2D82A 5DX4A 5I40A 4Z1QA 4LZ2A
chains in the Genus database with same CATH superfamily
5LKUA 4NYVA 4CUPA 4NRBA 4RVRA 5HJCA 5HRWA 2E7OA 3U5LA 2RFJA 5CP5A 4YYHA 4LYWA 5EICA 4TZ8A 4ZW1A 5HQ5A 5D3SA 4QSWA 4YYMA 5KHMA 4NQNA 5DY7A 5JI8A 4BW2A 4N4GA 4C66A 5LKTA 2H60A 5L99A 4QSQA 2DVQA 5A82A 5I7XA 4IR4A 4O78A 5JWMA 3HMHA 3GG3A 2YQDA 4YYNA 4CUUA 4MR3A 4QBMA 5CQ7A 3VKGA 4Q0NA 5FE4A 4PCEA 5E3GA 5CGPA 4QSXA 4N4FA 5FH7A 3LJWA 3DWYA 2RI7A 2DVVA 5EU1A 1ZKRA 5CQ8A 4QUTA 5A5RA 5D3PA 4UYDA 5EPRA 4YH4A 4O70A 5EWDA 4YY6A 3Q2FA 4IR6A 4PY6A 4NUEA 5C4QA 5ENBA 4WHWA 3MB4A 5EISA 5CUCA 5CQ5A 2LSPB 5D26A 5FE2A 4UYFA 5CQ6A 4J0RA 5HRXA 4IR3A 5IIDA 4XY9A 4YK0A 5CUEA 4TTEA 4HXRA 4NYXA 2DVSA 5LKXA 5A81A 3UV2A 5DW2A 4AKIA 4QY4A 5K29A 4QSUA 2F6JA 2OUOA 5L8UA 4QYDA 5C85A 5ENCA 5ETBA 5F3AA 5E9MA 5I1QA 5BT3A 5FE6A 5H1TA 4MENA 4MEQA 5L98A 4UITA 5DKDA 5EV9A 4YYJA 2L5EA 4IORA 5A85A 4PKLA 4CUSA 5CUDA 4HXOA 4O75A 3NXBA 3UVWA 4F3IA 5DFBA 2KTBB 4NR5A 5LVQA 4CFLA 4CL9A 5LUUA 1X0JA 4LZRA 4O76A 5DLXA 4TZ2A 5FE0A 5ENEA 4OGJA 5IGKA 4PCIA 5FG5A 2RO1A 4LC2A 4A9NA 4HBXA 2R0VA 5I88A 4BHWA 3SVGA 3HMFA 4Z93A 4XYAA 4NS5A 5IG6A 3K2JA 5C87A 3MUKA 3RCWA 4QSTA 4A9EA 4QR3A 5FFWA 4HXKA 5I83A 2E7NA 2YDWA 2WP1A 5A5PA 5EQ1A 5DBMA 3O33A 4YY4A 4GPJA 4NR8A 4DONA 5E3DA 4WIVA 5D3JA 1EQFA 1F68A 4IR5A 5F2PA 3S91A 5D3NA 2RNWA 2D9EA 5F1HA 5E9IA 4BW4A 4A9MA 3AADA 5TCMA 5AMEA 5KU3A 5CTLA 5CS8A 2I7KA 2I8NA 4NUDA 5H85A 4FLPA 5CU8A 4A9HA 4J0SA 5FE5A 4E96A 5EP7A 3S92A 3DAIA 4NXJA 5CQ3A 3LXJA 5FH6A 4OUFA 1N72A 4UYGA 5F25A 5IGLA 5A5SA 3MQMA 5EWVA 4YBTA 4NR7A 5KTUA 5TB6A 4CUTA 5ENIA 4QC3A 5EWHA 5HM0A 4YABA 5DFCA 5H1VA 4Z6HA 2DATA 4BW1A 5AMFA 5FB0A 4QR5A 3TLPA 4A9KA 4CLBA 4NYWA 2DKWA 4HXNA 4HBVA 4A9JA 5HCLA 5IGNA 4NUCA 5FFVA 4ALHA 4KV4A 5C7NA 4UYEA 3JVLA 3U5MA 4BW3A 2YELA 4YAXA 3G0LA 3MXFA 4TU6A 4LDFA 4AKGA 2N9GA 5F60A 2L85A 4YC9A 5D3RA 5CFWA 2YEMA 3D1BA 5EM3A 4O7AA 4UIWA 5F1LA 5EGUA 5IGMA 4A9OA 1PUOA 5FE1A 4XUAA 4HBWA 4PS5A 5DYAA 5FH8A 4BJXA 5EPSA 5D3HA 4CURA 5E7DA 5FB1A 5HQ6A 5CRZA 5KO4A 4O7BA 5ENHA 4YATA 5I7YA 5KTXA 4QEUA 4HXMA 4YYKA 4A9IA 5I89A 5DFDA 2R10A 4UIUA 3VKHA 4CUQA 5LJ1A 5BT5A 4QB3A 5DKHA 4AKHA 4AI6A 4O74A 3P1DA 4Z6IA 5D3TA 4NR4A 4QSRA 3P1FA 4YH3A 4QSVA 4O72A 4UIYA 5HELA 3QZVA 5E9KA 2RNXA 1WUMA 2GRCA 4HXSA 3U5KA 4LR6A 4O7CA 5FE7A 5FE3A 4NQMA 3SVFA 5LJ2A 3D7CA 4N3WA 4CFKA 5F36A 3HMEA 5E74A 4Z1SA 3O36A 5A5QA 5C89A 5F62A 2MJVB 5EWCA 5DLZA 2RS9B 5F61A 5CQAA 3I3JA 3O35A 2G4AA 5F63A 2R0YA 2DWWA 4A9LA 5L8TA 3FKMX 4XUBA 5H1UA 3LQIA 5C8GA 2L84A 5DYUA 3P5OA 3SVHA 3QZTA 4QEVA 5I86A 5HFRA 1JSPB 2NXBA 5ENGA 3IU5A 4ZQLA 4KCXA 3JVMA 5DYXA 1WUGA 3MULA 5HFQA 4YADA 4QSSA 5FE8A 5EK9A 5G4SA 4QYLA 5KTWA 2WP2A 4N4HA 1JM4B 2YW5A 5EPBA 4MEOA 5BT4A 2RNYA 3O37A 5CUGA 5E9LA 5D3LA 5ENJA 5II1A 4LYSA 5F5ZA 4C67A 4XY8A 5A5NA 5LKZA 5HLSA 4TT6A 5COIA 3AQAA 4QNSA 5A83A 2YYNA 4O7FA 3ZYUA 5D24A 4LZSA 5A5OA 4NR6A 5FE9A 4O71A 5EWWA 5FG4A 3LQHA 3UVYA 3U5OA 3UW9A 4IOQA 3UV5A 5AD2A 5CRMA 4QZSA 5FDZA 2YEKA 3G0JA 3D1DA 4TT4A 4UIZA 4UIXA 4N4IA 5CQ4A 4MR6A 4OGIA 3UVDA 5EA1A 4TS8A 3U5JA 3ERRA 4QC1A 5DW1A 3P1EA 4NR9A 5FBXA 4TQNA 3UV4A 5AD3A 4LYIA 5J0DA 5ENFA 4IOOA 5CY9A 2EJNA 4A9FA 5I29A 4HBYA 4MR4A 4QUUA 5CZGA 5IBNA 1ZS5A 5CUAA 5EVAA 4TT2A 4QR4A 3P1CA 3MB3A 3JVKA 4J1PA 3U5NA 2DVRA 4UIVA 4KV1A 4O7EA 2FSAA 5FG6A 5HQ7A 5CPEA 5LJ0A 5DKCA 5E9YA 2R0SA 4MR5A 4Q0OA 4YBMA 4Y03A 5I80A 5CUBA 4X2IA 4AKNA 5ETDA 4MEPA 4HXLA 5A7CA 5D7XA 2F6NA 4ZC9A 5FFYA 3IU6A 4UYFB 4PTBA 5HENA 5L96A 2OSSA 3JVJA 3LQJA 5EI4A 4ALGA 3QZSA 4HXPA 3ONIA 4TYLA 5G4RA 4YBSA 3Q2EA 4O77A 5LVRA 2OO1A 5D25A 4NRAA 4J3IA 5E0RA 4QSPA 4QEWA 3UVXA 2E3KA 5HEMA 4UYHA 3O34A 4YYDA 5ACYA 5E73A 4TU4A 4WHUA 3U5PA 5DYCA 1E6IA 5HRVA 4LRGA 5CQTA 5L97A 4YYIA 4NRCA 5E9VA 5II2A 4YYGA 5D0CA 2D82A 5DX4A 5I40A 4Z1QA 4LZ2A
chains in the Genus database with same CATH topology
5LKUA 4NYVA 4CUPA 4NRBA 4RVRA 5HJCA 5HRWA 2E7OA 3U5LA 2RFJA 5CP5A 4YYHA 4LYWA 5EICA 4TZ8A 4ZW1A 5HQ5A 5D3SA 4QSWA 4YYMA 5KHMA 4NQNA 5DY7A 5JI8A 4BW2A 4N4GA 4C66A 5LKTA 2H60A 5L99A 4QSQA 2DVQA 5A82A 5I7XA 4IR4A 4O78A 5JWMA 3HMHA 3GG3A 2YQDA 4YYNA 4CUUA 4MR3A 4QBMA 5CQ7A 4Q0NA 5FE4A 4PCEA 5E3GA 5CGPA 4QSXA 4N4FA 5FH7A 3LJWA 3DWYA 2RI7A 2DVVA 5EU1A 5A5RA 5CQ8A 4QUTA 5D3PA 4UYDA 5EPRA 4YH4A 4O70A 5EWDA 4YY6A 3Q2FA 4IR6A 4PY6A 4NUEA 5C4QA 5ENBA 4WHWA 3MB4A 5EISA 5CUCA 5CQ5A 2LSPB 5D26A 5FE2A 4UYFA 5CQ6A 4J0RA 5HRXA 4IR3A 5IIDA 4XY9A 4YK0A 5CUEA 4TTEA 4HXRA 4NYXA 2DVSA 5LKXA 5A81A 3UV2A 5DW2A 4QY4A 5K29A 4QSUA 2F6JA 2OUOA 5L8UA 4QYDA 5C85A 5ENCA 5ETBA 5F3AA 5E9MA 5I1QA 5BT3A 5FE6A 5H1TA 4MENA 4MEQA 5L98A 4UITA 5DKDA 5EV9A 4YYJA 2L5EA 4IORA 5A85A 4PKLA 4CUSA 5CUDA 4HXOA 4O75A 3NXBA 3UVWA 4F3IA 5DFBA 2KTBB 4NR5A 5LVQA 4CFLA 4CL9A 5LUUA 1X0JA 4LZRA 4O76A 5DLXA 4TZ2A 5FE0A 5ENEA 4OGJA 5IGKA 4PCIA 5FG5A 2RO1A 4LC2A 4A9NA 4HBXA 2R0VA 5I88A 4BHWA 3SVGA 3HMFA 4Z93A 4XYAA 4NS5A 5IG6A 3K2JA 5C87A 3MUKA 3RCWA 4QSTA 4A9EA 4QR3A 5FFWA 4HXKA 5I83A 2E7NA 2YDWA 2WP1A 5A5PA 5EQ1A 5DBMA 3O33A 4YY4A 4GPJA 4NR8A 4DONA 5E3DA 4WIVA 5D3JA 1EQFA 1F68A 4IR5A 5F2PA 3S91A 5D3NA 2RNWA 2D9EA 5F1HA 5E9IA 4BW4A 4A9MA 3AADA 5TCMA 5AMEA 5KU3A 5CTLA 5CS8A 2I7KA 2I8NA 4NUDA 5H85A 4FLPA 5CU8A 4A9HA 4J0SA 5FE5A 4E96A 5EP7A 3S92A 3DAIA 4NXJA 5CQ3A 3LXJA 5FH6A 4OUFA 1N72A 4UYGA 5F25A 5IGLA 5A5SA 3MQMA 5EWVA 4YBTA 4NR7A 5KTUA 5TB6A 4CUTA 5ENIA 4QC3A 5EWHA 5HM0A 4YABA 5DFCA 5H1VA 4Z6HA 2DATA 4BW1A 5AMFA 5FB0A 4QR5A 3TLPA 4A9KA 4CLBA 4NYWA 2DKWA 4HXNA 4HBVA 4A9JA 5HCLA 5IGNA 4NUCA 5FFVA 4ALHA 4KV4A 5C7NA 4UYEA 3JVLA 3U5MA 4BW3A 2YELA 4YAXA 3G0LA 3MXFA 4TU6A 4LDFA 2N9GA 5F60A 2L85A 4YC9A 5D3RA 5CFWA 2YEMA 5EM3A 4O7AA 4UIWA 5F1LA 5EGUA 5IGMA 4A9OA 5FE1A 4XUAA 4HBWA 4PS5A 5DYAA 5FH8A 4BJXA 5EPSA 5D3HA 4CURA 5E7DA 5FB1A 5HQ6A 5CRZA 5KO4A 4O7BA 5ENHA 4YATA 5I7YA 5KTXA 4QEUA 4HXMA 4YYKA 4A9IA 5I89A 5DFDA 2R10A 4UIUA 4CUQA 5LJ1A 5BT5A 4QB3A 5DKHA 4O74A 3P1DA 4Z6IA 5D3TA 4NR4A 4QSRA 3P1FA 4YH3A 4QSVA 4O72A 4UIYA 5HELA 3QZVA 5E9KA 2RNXA 1WUMA 2GRCA 4HXSA 3U5KA 4LR6A 4O7CA 5FE7A 5FE3A 4NQMA 3SVFA 5LJ2A 3D7CA 4N3WA 4CFKA 5F36A 3HMEA 5E74A 4Z1SA 3O36A 5A5QA 5C89A 5F62A 2MJVB 5EWCA 5DLZA 2RS9B 5F61A 5CQAA 3I3JA 3O35A 2G4AA 5F63A 2R0YA 2DWWA 4A9LA 5L8TA 3FKMX 4XUBA 5H1UA 3LQIA 5C8GA 2L84A 5DYUA 3P5OA 3SVHA 3QZTA 4QEVA 5I86A 5HFRA 1JSPB 2NXBA 5ENGA 3IU5A 4ZQLA 4KCXA 3JVMA 5DYXA 1WUGA 3MULA 5HFQA 4YADA 4QSSA 5FE8A 5EK9A 5G4SA 4QYLA 5KTWA 2WP2A 4N4HA 1JM4B 2YW5A 5EPBA 4MEOA 5BT4A 2RNYA 3O37A 5CUGA 5E9LA 5D3LA 5ENJA 5II1A 4LYSA 5F5ZA 4C67A 4XY8A 5A5NA 5LKZA 5HLSA 4TT6A 5COIA 3AQAA 4QNSA 5A83A 2YYNA 4O7FA 3ZYUA 5D24A 4LZSA 5A5OA 4NR6A 5FE9A 4O71A 5EWWA 5FG4A 3LQHA 3UVYA 3U5OA 3UW9A 4IOQA 3UV5A 5AD2A 5CRMA 4QZSA 5FDZA 2YEKA 3G0JA 4TT4A 4UIZA 4UIXA 4N4IA 5CQ4A 4MR6A 4OGIA 3UVDA 5EA1A 4TS8A 3U5JA 5DW1A 4QC1A 5FBXA 3P1EA 4NR9A 3UV4A 4TQNA 5AD3A 4LYIA 5J0DA 5ENFA 4IOOA 5CY9A 4A9FA 5I29A 4HBYA 4MR4A 4QUUA 5CZGA 5IBNA 1ZS5A 5CUAA 5EVAA 4TT2A 4QR4A 3P1CA 3MB3A 3JVKA 4J1PA 3U5NA 2DVRA 4UIVA 4KV1A 4O7EA 2FSAA 5FG6A 5HQ7A 5CPEA 5LJ0A 5DKCA 5E9YA 2R0SA 4MR5A 4Q0OA 4YBMA 4Y03A 5I80A 5CUBA 4X2IA 4AKNA 5ETDA 4MEPA 4HXLA 5A7CA 5D7XA 2F6NA 4ZC9A 5FFYA 3IU6A 4UYFB 4PTBA 5HENA 5L96A 2OSSA 3JVJA 3LQJA 5EI4A 4ALGA 3QZSA 4HXPA 3ONIA 4TYLA 5G4RA 4YBSA 3Q2EA 4O77A 5LVRA 2OO1A 5D25A 4NRAA 4J3IA 5E0RA 4QSPA 4QEWA 3UVXA 2E3KA 5HEMA 4UYHA 3O34A 4YYDA 5ACYA 5E73A 4TU4A 4WHUA 3U5PA 5DYCA 1E6IA 5HRVA 4LRGA 5CQTA 5L97A 4YYIA 4NRCA 5E9VA 5II2A 4YYGA 5D0CA 2D82A 5DX4A 5I40A 4Z1QA 4LZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKU A;  4NYV A;  4CUP A;  4NRB A;  4RVR A;  5HJC A;  5HRW A;  2E7O A;  3U5L A;  2RFJ A;  5CP5 A;  4YYH A;  4LYW A;  5EIC A;  4TZ8 A;  4ZW1 A;  5HQ5 A;  5D3S A;  4QSW A;  4YYM A;  5KHM A;  4NQN A;  5DY7 A;  5JI8 A;  4BW2 A;  4N4G A;  4C66 A;  5LKT A;  2H60 A;  5L99 A;  4QSQ A;  2DVQ A;  5A82 A;  5I7X A;  4IR4 A;  4O78 A;  5JWM A;  3HMH A;  3GG3 A;  2YQD A;  4YYN A;  4CUU A;  4MR3 A;  4QBM A;  5CQ7 A;  4Q0N A;  5FE4 A;  4PCE A;  5E3G A;  5CGP A;  4QSX A;  4N4F A;  5FH7 A;  3LJW A;  3DWY A;  2RI7 A;  2DVV A;  5EU1 A;  5A5R A;  5CQ8 A;  4QUT A;  5D3P A;  4UYD A;  5EPR A;  4YH4 A;  4O70 A;  5EWD A;  4YY6 A;  3Q2F A;  4IR6 A;  4PY6 A;  4NUE A;  5C4Q A;  5ENB A;  4WHW A;  3MB4 A;  5EIS A;  5CUC A;  5CQ5 A;  2LSP B;  5D26 A;  5FE2 A;  4UYF A;  5CQ6 A;  4J0R A;  5HRX A;  4IR3 A;  5IID A;  4XY9 A;  4YK0 A;  5CUE A;  4TTE A;  4HXR A;  4NYX A;  2DVS A;  5LKX A;  5A81 A;  3UV2 A;  5DW2 A;  4QY4 A;  5K29 A;  4QSU A;  2F6J A;  2OUO A;  5L8U A;  4QYD A;  5C85 A;  5ENC A;  5ETB A;  5F3A A;  5E9M A;  5I1Q A;  5BT3 A;  5FE6 A;  5H1T A;  4MEN A;  4MEQ A;  5L98 A;  4UIT A;  5DKD A;  5EV9 A;  4YYJ A;  2L5E A;  4IOR A;  5A85 A;  4PKL A;  4CUS A;  5CUD A;  4HXO A;  4O75 A;  3NXB A;  3UVW A;  4F3I A;  5DFB A;  2KTB B;  4NR5 A;  5LVQ A;  4CFL A;  4CL9 A;  5LUU A;  1X0J A;  4LZR A;  4O76 A;  5DLX A;  4TZ2 A;  5FE0 A;  5ENE A;  4OGJ A;  5IGK A;  4PCI A;  5FG5 A;  2RO1 A;  4LC2 A;  4A9N A;  4HBX A;  2R0V A;  5I88 A;  4BHW A;  3SVG A;  3HMF A;  4Z93 A;  4XYA A;  4NS5 A;  5IG6 A;  3K2J A;  5C87 A;  3MUK A;  3RCW A;  4QST A;  4A9E A;  4QR3 A;  5FFW A;  4HXK A;  5I83 A;  2E7N A;  2YDW A;  2WP1 A;  5A5P A;  5EQ1 A;  5DBM A;  3O33 A;  4YY4 A;  4GPJ A;  4NR8 A;  4DON A;  5E3D A;  4WIV A;  5D3J A;  1EQF A;  1F68 A;  4IR5 A;  5F2P A;  3S91 A;  5D3N A;  2RNW A;  2D9E A;  5F1H A;  5E9I A;  4BW4 A;  4A9M A;  3AAD A;  5TCM A;  5AME A;  5KU3 A;  5CTL A;  5CS8 A;  2I7K A;  2I8N A;  4NUD A;  5H85 A;  4FLP A;  5CU8 A;  4A9H A;  4J0S A;  5FE5 A;  4E96 A;  5EP7 A;  3S92 A;  3DAI A;  4NXJ A;  5CQ3 A;  3LXJ A;  5FH6 A;  4OUF A;  1N72 A;  4UYG A;  5F25 A;  5IGL A;  5A5S A;  3MQM A;  5EWV A;  4YBT A;  4NR7 A;  5KTU A;  5TB6 A;  4CUT A;  5ENI A;  4QC3 A;  5EWH A;  5HM0 A;  4YAB A;  5DFC A;  5H1V A;  4Z6H A;  2DAT A;  4BW1 A;  5AMF A;  5FB0 A;  4QR5 A;  3TLP A;  4A9K A;  4CLB A;  4NYW A;  2DKW A;  4HXN A;  4HBV A;  4A9J A;  5HCL A;  5IGN A;  4NUC A;  5FFV A;  4ALH A;  4KV4 A;  5C7N A;  4UYE A;  3JVL A;  3U5M A;  4BW3 A;  2YEL A;  4YAX A;  3G0L A;  3MXF A;  4TU6 A;  4LDF A;  2N9G A;  5F60 A;  2L85 A;  4YC9 A;  5D3R A;  5CFW A;  2YEM A;  5EM3 A;  4O7A A;  4UIW A;  5F1L A;  5EGU A;  5IGM A;  4A9O A;  5FE1 A;  4XUA A;  4HBW A;  4PS5 A;  5DYA A;  5FH8 A;  4BJX A;  5EPS A;  5D3H A;  4CUR A;  5E7D A;  5FB1 A;  5HQ6 A;  5CRZ A;  5KO4 A;  4O7B A;  5ENH A;  4YAT A;  5I7Y A;  5KTX A;  4QEU A;  4HXM A;  4YYK A;  4A9I A;  5I89 A;  5DFD A;  2R10 A;  4UIU A;  4CUQ A;  5LJ1 A;  5BT5 A;  4QB3 A;  5DKH A;  4O74 A;  3P1D A;  4Z6I A;  5D3T A;  4NR4 A;  4QSR A;  3P1F A;  4YH3 A;  4QSV A;  4O72 A;  4UIY A;  5HEL A;  3QZV A;  5E9K A;  2RNX A;  1WUM A;  2GRC A;  4HXS A;  3U5K A;  4LR6 A;  4O7C A;  5FE7 A;  5FE3 A;  4NQM A;  3SVF A;  5LJ2 A;  3D7C A;  4N3W A;  4CFK A;  5F36 A;  3HME A;  5E74 A;  4Z1S A;  3O36 A;  5A5Q A;  5C89 A;  5F62 A;  2MJV B;  5EWC A;  5DLZ A;  2RS9 B;  5F61 A;  5CQA A;  3I3J A;  3O35 A;  2G4A A;  5F63 A;  2R0Y A;  2DWW A;  4A9L A;  5L8T A;  3FKM X;  4XUB A;  5H1U A;  3LQI A;  5C8G A;  2L84 A;  5DYU A;  3P5O A;  3SVH A;  3QZT A;  4QEV A;  5I86 A;  5HFR A;  1JSP B;  2NXB A;  5ENG A;  3IU5 A;  4ZQL A;  4KCX A;  3JVM A;  5DYX A;  1WUG A;  3MUL A;  5HFQ A;  4YAD A;  4QSS A;  5FE8 A;  5EK9 A;  5G4S A;  4QYL A;  5KTW A;  2WP2 A;  4N4H A;  1JM4 B;  2YW5 A;  5EPB A;  4MEO A;  5BT4 A;  2RNY A;  3O37 A;  5CUG A;  5E9L A;  5D3L A;  5ENJ A;  5II1 A;  4LYS A;  5F5Z A;  4C67 A;  4XY8 A;  5A5N A;  5LKZ A;  5HLS A;  4TT6 A;  5COI A;  3AQA A;  4QNS A;  5A83 A;  2YYN A;  4O7F A;  3ZYU A;  5D24 A;  4LZS A;  5A5O A;  4NR6 A;  5FE9 A;  4O71 A;  5EWW A;  5FG4 A;  3LQH A;  3UVY A;  3U5O A;  3UW9 A;  4IOQ A;  3UV5 A;  5AD2 A;  5CRM A;  4QZS A;  5FDZ A;  2YEK A;  3G0J A;  4TT4 A;  4UIZ A;  4UIX A;  4N4I A;  5CQ4 A;  4MR6 A;  4OGI A;  3UVD A;  5EA1 A;  4TS8 A;  3U5J A;  5DW1 A;  4QC1 A;  5FBX A;  3P1E A;  4NR9 A;  3UV4 A;  4TQN A;  5AD3 A;  4LYI A;  5J0D A;  5ENF A;  4IOO A;  5CY9 A;  4A9F A;  5I29 A;  4HBY A;  4MR4 A;  4QUU A;  5CZG A;  5IBN A;  1ZS5 A;  5CUA A;  5EVA A;  4TT2 A;  4QR4 A;  3P1C A;  3MB3 A;  3JVK A;  4J1P A;  3U5N A;  2DVR A;  4UIV A;  4KV1 A;  4O7E A;  2FSA A;  5FG6 A;  5HQ7 A;  5CPE A;  5LJ0 A;  5DKC A;  5E9Y A;  2R0S A;  4MR5 A;  4Q0O A;  4YBM A;  4Y03 A;  5I80 A;  5CUB A;  4X2I A;  4AKN A;  5ETD A;  4MEP A;  4HXL A;  5A7C A;  5D7X A;  2F6N A;  4ZC9 A;  5FFY A;  3IU6 A;  4UYF B;  4PTB A;  5HEN A;  5L96 A;  2OSS A;  3JVJ A;  3LQJ A;  5EI4 A;  4ALG A;  3QZS A;  4HXP A;  3ONI A;  4TYL A;  5G4R A;  4YBS A;  3Q2E A;  4O77 A;  5LVR A;  2OO1 A;  5D25 A;  4NRA A;  4J3I A;  5E0R A;  4QSP A;  4QEW A;  3UVX A;  2E3K A;  5HEM A;  4UYH A;  3O34 A;  4YYD A;  5ACY A;  5E73 A;  4TU4 A;  4WHU A;  3U5P A;  5DYC A;  1E6I A;  5HRV A;  4LRG A;  5CQT A;  5L97 A;  4YYI A;  4NRC A;  5E9V A;  5II2 A;  4YYG A;  5D0C A;  2D82 A;  5DX4 A;  5I40 A;  4Z1Q A;  4LZ2 A; 
#chains in the Genus database with same CATH topology
 5LKU A;  4NYV A;  4CUP A;  4NRB A;  4RVR A;  5HJC A;  5HRW A;  2E7O A;  3U5L A;  2RFJ A;  5CP5 A;  4YYH A;  4LYW A;  5EIC A;  4TZ8 A;  4ZW1 A;  5HQ5 A;  5D3S A;  4QSW A;  4YYM A;  5KHM A;  4NQN A;  5DY7 A;  5JI8 A;  4BW2 A;  4N4G A;  4C66 A;  5LKT A;  2H60 A;  5L99 A;  4QSQ A;  2DVQ A;  5A82 A;  5I7X A;  4IR4 A;  4O78 A;  5JWM A;  3HMH A;  3GG3 A;  2YQD A;  4YYN A;  4CUU A;  4MR3 A;  4QBM A;  5CQ7 A;  3VKG A;  4Q0N A;  5FE4 A;  4PCE A;  5E3G A;  5CGP A;  4QSX A;  4N4F A;  5FH7 A;  3LJW A;  3DWY A;  2RI7 A;  2DVV A;  5EU1 A;  1ZKR A;  5CQ8 A;  4QUT A;  5A5R A;  5D3P A;  4UYD A;  5EPR A;  4YH4 A;  4O70 A;  5EWD A;  4YY6 A;  3Q2F A;  4IR6 A;  4PY6 A;  4NUE A;  5C4Q A;  5ENB A;  4WHW A;  3MB4 A;  5EIS A;  5CUC A;  5CQ5 A;  2LSP B;  5D26 A;  5FE2 A;  4UYF A;  5CQ6 A;  4J0R A;  5HRX A;  4IR3 A;  5IID A;  4XY9 A;  4YK0 A;  5CUE A;  4TTE A;  4HXR A;  4NYX A;  2DVS A;  5LKX A;  5A81 A;  3UV2 A;  5DW2 A;  4AKI A;  4QY4 A;  5K29 A;  4QSU A;  2F6J A;  2OUO A;  5L8U A;  4QYD A;  5C85 A;  5ENC A;  5ETB A;  5F3A A;  5E9M A;  5I1Q A;  5BT3 A;  5FE6 A;  5H1T A;  4MEN A;  4MEQ A;  5L98 A;  4UIT A;  5DKD A;  5EV9 A;  4YYJ A;  2L5E A;  4IOR A;  5A85 A;  4PKL A;  4CUS A;  5CUD A;  4HXO A;  4O75 A;  3NXB A;  3UVW A;  4F3I A;  5DFB A;  2KTB B;  4NR5 A;  5LVQ A;  4CFL A;  4CL9 A;  5LUU A;  1X0J A;  4LZR A;  4O76 A;  5DLX A;  4TZ2 A;  5FE0 A;  5ENE A;  4OGJ A;  5IGK A;  4PCI A;  5FG5 A;  2RO1 A;  4LC2 A;  4A9N A;  4HBX A;  2R0V A;  5I88 A;  4BHW A;  3SVG A;  3HMF A;  4Z93 A;  4XYA A;  4NS5 A;  5IG6 A;  3K2J A;  5C87 A;  3MUK A;  3RCW A;  4QST A;  4A9E A;  4QR3 A;  5FFW A;  4HXK A;  5I83 A;  2E7N A;  2YDW A;  2WP1 A;  5A5P A;  5EQ1 A;  5DBM A;  3O33 A;  4YY4 A;  4GPJ A;  4NR8 A;  4DON A;  5E3D A;  4WIV A;  5D3J A;  1EQF A;  1F68 A;  4IR5 A;  5F2P A;  3S91 A;  5D3N A;  2RNW A;  2D9E A;  5F1H A;  5E9I A;  4BW4 A;  4A9M A;  3AAD A;  5TCM A;  5AME A;  5KU3 A;  5CTL A;  5CS8 A;  2I7K A;  2I8N A;  4NUD A;  5H85 A;  4FLP A;  5CU8 A;  4A9H A;  4J0S A;  5FE5 A;  4E96 A;  5EP7 A;  3S92 A;  3DAI A;  4NXJ A;  5CQ3 A;  3LXJ A;  5FH6 A;  4OUF A;  1N72 A;  4UYG A;  5F25 A;  5IGL A;  5A5S A;  3MQM A;  5EWV A;  4YBT A;  4NR7 A;  5KTU A;  5TB6 A;  4CUT A;  5ENI A;  4QC3 A;  5EWH A;  5HM0 A;  4YAB A;  5DFC A;  5H1V A;  4Z6H A;  2DAT A;  4BW1 A;  5AMF A;  5FB0 A;  4QR5 A;  3TLP A;  4A9K A;  4CLB A;  4NYW A;  2DKW A;  4HXN A;  4HBV A;  4A9J A;  5HCL A;  5IGN A;  4NUC A;  5FFV A;  4ALH A;  4KV4 A;  5C7N A;  4UYE A;  3JVL A;  3U5M A;  4BW3 A;  2YEL A;  4YAX A;  3G0L A;  3MXF A;  4TU6 A;  4LDF A;  4AKG A;  2N9G A;  5F60 A;  2L85 A;  4YC9 A;  5D3R A;  5CFW A;  2YEM A;  3D1B A;  5EM3 A;  4O7A A;  4UIW A;  5F1L A;  5EGU A;  5IGM A;  4A9O A;  1PUO A;  5FE1 A;  4XUA A;  4HBW A;  4PS5 A;  5DYA A;  5FH8 A;  4BJX A;  5EPS A;  5D3H A;  4CUR A;  5E7D A;  5FB1 A;  5HQ6 A;  5CRZ A;  5KO4 A;  4O7B A;  5ENH A;  4YAT A;  5I7Y A;  5KTX A;  4QEU A;  4HXM A;  4YYK A;  4A9I A;  5I89 A;  5DFD A;  2R10 A;  4UIU A;  3VKH A;  4CUQ A;  5LJ1 A;  5BT5 A;  4QB3 A;  5DKH A;  4AKH A;  4AI6 A;  4O74 A;  3P1D A;  4Z6I A;  5D3T A;  4NR4 A;  4QSR A;  3P1F A;  4YH3 A;  4QSV A;  4O72 A;  4UIY A;  5HEL A;  3QZV A;  5E9K A;  2RNX A;  1WUM A;  2GRC A;  4HXS A;  3U5K A;  4LR6 A;  4O7C A;  5FE7 A;  5FE3 A;  4NQM A;  3SVF A;  5LJ2 A;  3D7C A;  4N3W A;  4CFK A;  5F36 A;  3HME A;  5E74 A;  4Z1S A;  3O36 A;  5A5Q A;  5C89 A;  5F62 A;  2MJV B;  5EWC A;  5DLZ A;  2RS9 B;  5F61 A;  5CQA A;  3I3J A;  3O35 A;  2G4A A;  5F63 A;  2R0Y A;  2DWW A;  4A9L A;  5L8T A;  3FKM X;  4XUB A;  5H1U A;  3LQI A;  5C8G A;  2L84 A;  5DYU A;  3P5O A;  3SVH A;  3QZT A;  4QEV A;  5I86 A;  5HFR A;  1JSP B;  2NXB A;  5ENG A;  3IU5 A;  4ZQL A;  4KCX A;  3JVM A;  5DYX A;  1WUG A;  3MUL A;  5HFQ A;  4YAD A;  4QSS A;  5FE8 A;  5EK9 A;  5G4S A;  4QYL A;  5KTW A;  2WP2 A;  4N4H A;  1JM4 B;  2YW5 A;  5EPB A;  4MEO A;  5BT4 A;  2RNY A;  3O37 A;  5CUG A;  5E9L A;  5D3L A;  5ENJ A;  5II1 A;  4LYS A;  5F5Z A;  4C67 A;  4XY8 A;  5A5N A;  5LKZ A;  5HLS A;  4TT6 A;  5COI A;  3AQA A;  4QNS A;  5A83 A;  2YYN A;  4O7F A;  3ZYU A;  5D24 A;  4LZS A;  5A5O A;  4NR6 A;  5FE9 A;  4O71 A;  5EWW A;  5FG4 A;  3LQH A;  3UVY A;  3U5O A;  3UW9 A;  4IOQ A;  3UV5 A;  5AD2 A;  5CRM A;  4QZS A;  5FDZ A;  2YEK A;  3G0J A;  3D1D A;  4TT4 A;  4UIZ A;  4UIX A;  4N4I A;  5CQ4 A;  4MR6 A;  4OGI A;  3UVD A;  5EA1 A;  4TS8 A;  3U5J A;  3ERR A;  4QC1 A;  5DW1 A;  3P1E A;  4NR9 A;  5FBX A;  4TQN A;  3UV4 A;  5AD3 A;  4LYI A;  5J0D A;  5ENF A;  4IOO A;  5CY9 A;  2EJN A;  4A9F A;  5I29 A;  4HBY A;  4MR4 A;  4QUU A;  5CZG A;  5IBN A;  1ZS5 A;  5CUA A;  5EVA A;  4TT2 A;  4QR4 A;  3P1C A;  3MB3 A;  3JVK A;  4J1P A;  3U5N A;  2DVR A;  4UIV A;  4KV1 A;  4O7E A;  2FSA A;  5FG6 A;  5HQ7 A;  5CPE A;  5LJ0 A;  5DKC A;  5E9Y A;  2R0S A;  4MR5 A;  4Q0O A;  4YBM A;  4Y03 A;  5I80 A;  5CUB A;  4X2I A;  4AKN A;  5ETD A;  4MEP A;  4HXL A;  5A7C A;  5D7X A;  2F6N A;  4ZC9 A;  5FFY A;  3IU6 A;  4UYF B;  4PTB A;  5HEN A;  5L96 A;  2OSS A;  3JVJ A;  3LQJ A;  5EI4 A;  4ALG A;  3QZS A;  4HXP A;  3ONI A;  4TYL A;  5G4R A;  4YBS A;  3Q2E A;  4O77 A;  5LVR A;  2OO1 A;  5D25 A;  4NRA A;  4J3I A;  5E0R A;  4QSP A;  4QEW A;  3UVX A;  2E3K A;  5HEM A;  4UYH A;  3O34 A;  4YYD A;  5ACY A;  5E73 A;  4TU4 A;  4WHU A;  3U5P A;  5DYC A;  1E6I A;  5HRV A;  4LRG A;  5CQT A;  5L97 A;  4YYI A;  4NRC A;  5E9V A;  5II2 A;  4YYG A;  5D0C A;  2D82 A;  5DX4 A;  5I40 A;  4Z1Q A;  4LZ2 A; 
#chains in the Genus database with same CATH homology
 5LKU A;  4NYV A;  4CUP A;  4NRB A;  4RVR A;  5HJC A;  5HRW A;  2E7O A;  3U5L A;  2RFJ A;  5CP5 A;  4YYH A;  4LYW A;  5EIC A;  4TZ8 A;  4ZW1 A;  5HQ5 A;  5D3S A;  4QSW A;  4YYM A;  5KHM A;  4NQN A;  5DY7 A;  5JI8 A;  4BW2 A;  4N4G A;  4C66 A;  5LKT A;  2H60 A;  5L99 A;  4QSQ A;  2DVQ A;  5A82 A;  5I7X A;  4IR4 A;  4O78 A;  5JWM A;  3HMH A;  3GG3 A;  2YQD A;  4YYN A;  4CUU A;  4MR3 A;  4QBM A;  5CQ7 A;  4Q0N A;  5FE4 A;  4PCE A;  5E3G A;  5CGP A;  4QSX A;  4N4F A;  5FH7 A;  3LJW A;  3DWY A;  2RI7 A;  2DVV A;  5EU1 A;  5A5R A;  5CQ8 A;  4QUT A;  5D3P A;  4UYD A;  5EPR A;  4YH4 A;  4O70 A;  5EWD A;  4YY6 A;  3Q2F A;  4IR6 A;  4PY6 A;  4NUE A;  5C4Q A;  5ENB A;  4WHW A;  3MB4 A;  5EIS A;  5CUC A;  5CQ5 A;  2LSP B;  5D26 A;  5FE2 A;  4UYF A;  5CQ6 A;  4J0R A;  5HRX A;  4IR3 A;  5IID A;  4XY9 A;  4YK0 A;  5CUE A;  4TTE A;  4HXR A;  4NYX A;  2DVS A;  5LKX A;  5A81 A;  3UV2 A;  5DW2 A;  4QY4 A;  5K29 A;  4QSU A;  2F6J A;  2OUO A;  5L8U A;  4QYD A;  5C85 A;  5ENC A;  5ETB A;  5F3A A;  5E9M A;  5I1Q A;  5BT3 A;  5FE6 A;  5H1T A;  4MEN A;  4MEQ A;  5L98 A;  4UIT A;  5DKD A;  5EV9 A;  4YYJ A;  2L5E A;  4IOR A;  5A85 A;  4PKL A;  4CUS A;  5CUD A;  4HXO A;  4O75 A;  3NXB A;  3UVW A;  4F3I A;  5DFB A;  2KTB B;  4NR5 A;  5LVQ A;  4CFL A;  4CL9 A;  5LUU A;  1X0J A;  4LZR A;  4O76 A;  5DLX A;  4TZ2 A;  5FE0 A;  5ENE A;  4OGJ A;  5IGK A;  4PCI A;  5FG5 A;  2RO1 A;  4LC2 A;  4A9N A;  4HBX A;  2R0V A;  5I88 A;  4BHW A;  3SVG A;  3HMF A;  4Z93 A;  4XYA A;  4NS5 A;  5IG6 A;  3K2J A;  5C87 A;  3MUK A;  3RCW A;  4QST A;  4A9E A;  4QR3 A;  5FFW A;  4HXK A;  5I83 A;  2E7N A;  2YDW A;  2WP1 A;  5A5P A;  5EQ1 A;  5DBM A;  3O33 A;  4YY4 A;  4GPJ A;  4NR8 A;  4DON A;  5E3D A;  4WIV A;  5D3J A;  1EQF A;  1F68 A;  4IR5 A;  5F2P A;  3S91 A;  5D3N A;  2RNW A;  2D9E A;  5F1H A;  5E9I A;  4BW4 A;  4A9M A;  3AAD A;  5TCM A;  5AME A;  5KU3 A;  5CTL A;  5CS8 A;  2I7K A;  2I8N A;  4NUD A;  5H85 A;  4FLP A;  5CU8 A;  4A9H A;  4J0S A;  5FE5 A;  4E96 A;  5EP7 A;  3S92 A;  3DAI A;  4NXJ A;  5CQ3 A;  3LXJ A;  5FH6 A;  4OUF A;  1N72 A;  4UYG A;  5F25 A;  5IGL A;  5A5S A;  3MQM A;  5EWV A;  4YBT A;  4NR7 A;  5KTU A;  5TB6 A;  4CUT A;  5ENI A;  4QC3 A;  5EWH A;  5HM0 A;  4YAB A;  5DFC A;  5H1V A;  4Z6H A;  2DAT A;  4BW1 A;  5AMF A;  5FB0 A;  4QR5 A;  3TLP A;  4A9K A;  4CLB A;  4NYW A;  2DKW A;  4HXN A;  4HBV A;  4A9J A;  5HCL A;  5IGN A;  4NUC A;  5FFV A;  4ALH A;  4KV4 A;  5C7N A;  4UYE A;  3JVL A;  3U5M A;  4BW3 A;  2YEL A;  4YAX A;  3G0L A;  3MXF A;  4TU6 A;  4LDF A;  2N9G A;  5F60 A;  2L85 A;  4YC9 A;  5D3R A;  5CFW A;  2YEM A;  5EM3 A;  4O7A A;  4UIW A;  5F1L A;  5EGU A;  5IGM A;  4A9O A;  5FE1 A;  4XUA A;  4HBW A;  4PS5 A;  5DYA A;  5FH8 A;  4BJX A;  5EPS A;  5D3H A;  4CUR A;  5E7D A;  5FB1 A;  5HQ6 A;  5CRZ A;  5KO4 A;  4O7B A;  5ENH A;  4YAT A;  5I7Y A;  5KTX A;  4QEU A;  4HXM A;  4YYK A;  4A9I A;  5I89 A;  5DFD A;  2R10 A;  4UIU A;  4CUQ A;  5LJ1 A;  5BT5 A;  4QB3 A;  5DKH A;  4O74 A;  3P1D A;  4Z6I A;  5D3T A;  4NR4 A;  4QSR A;  3P1F A;  4YH3 A;  4QSV A;  4O72 A;  4UIY A;  5HEL A;  3QZV A;  5E9K A;  2RNX A;  1WUM A;  2GRC A;  4HXS A;  3U5K A;  4LR6 A;  4O7C A;  5FE7 A;  5FE3 A;  4NQM A;  3SVF A;  5LJ2 A;  3D7C A;  4N3W A;  4CFK A;  5F36 A;  3HME A;  5E74 A;  4Z1S A;  3O36 A;  5A5Q A;  5C89 A;  5F62 A;  2MJV B;  5EWC A;  5DLZ A;  2RS9 B;  5F61 A;  5CQA A;  3I3J A;  3O35 A;  2G4A A;  5F63 A;  2R0Y A;  2DWW A;  4A9L A;  5L8T A;  3FKM X;  4XUB A;  5H1U A;  3LQI A;  5C8G A;  2L84 A;  5DYU A;  3P5O A;  3SVH A;  3QZT A;  4QEV A;  5I86 A;  5HFR A;  1JSP B;  2NXB A;  5ENG A;  3IU5 A;  4ZQL A;  4KCX A;  3JVM A;  5DYX A;  1WUG A;  3MUL A;  5HFQ A;  4YAD A;  4QSS A;  5FE8 A;  5EK9 A;  5G4S A;  4QYL A;  5KTW A;  2WP2 A;  4N4H A;  1JM4 B;  2YW5 A;  5EPB A;  4MEO A;  5BT4 A;  2RNY A;  3O37 A;  5CUG A;  5E9L A;  5D3L A;  5ENJ A;  5II1 A;  4LYS A;  5F5Z A;  4C67 A;  4XY8 A;  5A5N A;  5LKZ A;  5HLS A;  4TT6 A;  5COI A;  3AQA A;  4QNS A;  5A83 A;  2YYN A;  4O7F A;  3ZYU A;  5D24 A;  4LZS A;  5A5O A;  4NR6 A;  5FE9 A;  4O71 A;  5EWW A;  5FG4 A;  3LQH A;  3UVY A;  3U5O A;  3UW9 A;  4IOQ A;  3UV5 A;  5AD2 A;  5CRM A;  4QZS A;  5FDZ A;  2YEK A;  3G0J A;  4TT4 A;  4UIZ A;  4UIX A;  4N4I A;  5CQ4 A;  4MR6 A;  4OGI A;  3UVD A;  5EA1 A;  4TS8 A;  3U5J A;  5DW1 A;  4QC1 A;  5FBX A;  3P1E A;  4NR9 A;  3UV4 A;  4TQN A;  5AD3 A;  4LYI A;  5J0D A;  5ENF A;  4IOO A;  5CY9 A;  4A9F A;  5I29 A;  4HBY A;  4MR4 A;  4QUU A;  5CZG A;  5IBN A;  1ZS5 A;  5CUA A;  5EVA A;  4TT2 A;  4QR4 A;  3P1C A;  3MB3 A;  3JVK A;  4J1P A;  3U5N A;  2DVR A;  4UIV A;  4KV1 A;  4O7E A;  2FSA A;  5FG6 A;  5HQ7 A;  5CPE A;  5LJ0 A;  5DKC A;  5E9Y A;  2R0S A;  4MR5 A;  4Q0O A;  4YBM A;  4Y03 A;  5I80 A;  5CUB A;  4X2I A;  4AKN A;  5ETD A;  4MEP A;  4HXL A;  5A7C A;  5D7X A;  2F6N A;  4ZC9 A;  5FFY A;  3IU6 A;  4UYF B;  4PTB A;  5HEN A;  5L96 A;  2OSS A;  3JVJ A;  3LQJ A;  5EI4 A;  4ALG A;  3QZS A;  4HXP A;  3ONI A;  4TYL A;  5G4R A;  4YBS A;  3Q2E A;  4O77 A;  5LVR A;  2OO1 A;  5D25 A;  4NRA A;  4J3I A;  5E0R A;  4QSP A;  4QEW A;  3UVX A;  2E3K A;  5HEM A;  4UYH A;  3O34 A;  4YYD A;  5ACY A;  5E73 A;  4TU4 A;  4WHU A;  3U5P A;  5DYC A;  1E6I A;  5HRV A;  4LRG A;  5CQT A;  5L97 A;  4YYI A;  4NRC A;  5E9V A;  5II2 A;  4YYG A;  5D0C A;  2D82 A;  5DX4 A;  5I40 A;  4Z1Q A;  4LZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...