4YYMA

Crystal structure of taf1 bd2 bromodomain bound to a butyryllysine peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
132
structure length
132
Chain Sequence
DDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
molecule keywords Transcription initiation factor TFIID subunit 1
molecule tags Protein binding
source organism Homo sapiens
total genus 50
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yymA00
5H85A 4O75A 4PY6A 5FH8A 3O33A 4QSSA 4YYDA 2MJVB 5D3HA 5FE7A 5EVAA 5CUAA 4J1PA 4CFLA 4HBVA 2YEKA 5LUUA 5E3GA 4O77A 4YYKA 4A9NA 4NR7A 2YDWA 3MB4A 5DKHA 4O72A 5AMEA 3NXBA 5CUCA 5L96A 1WUMA 2WP2A 5HM0A 3MB3A 3S92A 2DVSA 4J0SA 4ZQLA 2R10A 5BT3A 3JVMA 3IU5A 5HENA 4OGJA 5LJ0A 3TLPA 4XY8A 3MULA 4TU4A 3MQMA 4A9LA 5CPEA 4NQMA 5EPRA 4N3WA 5DW2A 4RVRA 5FDZA 4YADA 5I89A 4QSQA 3I3JA 4CURA 5I1QA 5LKTA 5LVRA 5G4RA 4QSVA 5ENBA 5F25A 5C7NA 5EK9A 4TU6A 5EPSA 5A5OA 5A5PA 5JWMA 2WP1A 4HXSA 4MR6A 4QYDA 4YATA 4N4GA 2GRCA 5ENFA 3HMFA 4LZSA 4YAXA 5FE8A 4NUDA 4NR9A 2I7KA 2RFJA 5HRWA 5II1A 5L97A 5H1TA 4OUFA 5L99A 5CGPA 3DWYA 4O78A 4A9OA 5E0RA 4TYLA 4J0RA 4YABA 3RCWA 5I7YA 3AADA 2RS9B 5ENCA 5FB1A 3ONIA 5C85A 5L8TA 4XUAA 5FE0A 5F60A 5D26A 5HFRA 5F63A 4UYFB 4PCIA 5IGNA 5COIA 5DBMA 4XYAA 3P1FA 4NRCA 4CUUA 5KTXA 2YYNA 4QEUA 4QEVA 5IGKA 3S91A 4QEWA 4IORA 4YBSA 5F1HA 5F5ZA 4HXKA 2DVQA 5EP7A 5I88A 4O7AA 4UIYA 5IIDA 5CY9A 5A5QA 4UIVA 5DFBA 4BW4A 4PCEA 1F68A 4O76A 4YH3A 3P5OA 4ZC9A 5FE9A 3QZSA 5D24A 4NYWA 5EM3A 5CQTA 4KCXA 5E3DA 4O7EA 5DFDA 4NQNA 4A9IA 3O36A 5I86A 5DFCA 4UYFA 5DYXA 4HXLA 5F2PA 5FFYA 5E9MA 5FB0A 5C89A 2DKWA 4PKLA 4BW2A 5FG4A 4IR6A 4QC3A 2F6JA 4QB3A 4UIZA 5I40A 3SVHA 3Q2EA 5LKUA 5FE1A 3P1CA 5E9YA 5F62A 2R0YA 4N4HA 5J0DA 3U5KA 2RNYA 5E9KA 4QSWA 5I29A 5CQ5A 2RNWA 5CQ6A 5AD3A 4BHWA 4YH4A 5FFVA 5IG6A 3U5OA 5E9LA 5EWHA 4HXMA 4PTBA 3P1EA 3D7CA 2I8NA 3JVLA 5EGUA 4YY6A 3SVFA 2L5EA 4LDFA 4HXRA 5JI8A 1JSPB 4DONA 2E7OA 4LRGA 5CUBA 4O7BA 5HELA 5HRXA 4MEOA 4NXJA 4YYJA 5ENEA 2D9EA 4LYSA 4TTEA 4LZ2A 4YYNA 5HQ6A 5EWVA 3HMEA 4QSTA 4HBXA 5D3SA 2DATA 4YYHA 4UYHA 4Y03A 2RI7A 4HXPA 1WUGA 5EV9A 5ETDA 4LYWA 5KTUA 5KU3A 4CL9A 3MUKA 5HQ7A 4QR3A 4LR6A 4KV1A 3FKMX 4YY4A 3LQIA 4BW1A 1X0JA 4LYIA 4MR5A 5E7DA 4N4FA 5I83A 5A82A 5LJ2A 5D3TA 4IR4A 2YEMA 2YW5A 2R0VA 5AD2A 4QR4A 5HFQA 5D3PA 4BW3A 4MENA 5CRZA 5E74A 5ENIA 5EI4A 5C8GA 2E3KA 5F36A 3O34A 4Z1SA 4TT6A 4YYMA 4NUCA 1EQFA 3UV4A 5EWDA 4YBMA 5ENHA 4NS5A 3HMHA 3LQHA 5A5NA 5A5SA 2R0SA 4IR5A 4F3IA 4UITA 1E6IA 5TCMA 5LJ1A 4UIWA 3JVJA 4WHWA 5E73A 5F3AA 3U5PA 4YBTA 4QY4A 1ZS5A 4O70A 5KO4A 5DLXA 5FBXA 4QC1A 4UYEA 4PS5A 4WIVA 3UV5A 2H60A 5FFWA 5A5RA 3UW9A 5EWWA 5HQ5A 5FH6A 5HCLA 4NUEA 4TT4A 2E7NA 5CRMA 4A9KA 5ACYA 3ZYUA 4O7CA 4HBWA 5EWCA 4Z93A 5IGLA 5FE6A 2KTBB 3O35A 4HXOA 4UYDA 4ALHA 2OSSA 4QNSA 4XY9A 5CQ8A 5ETBA 3U5NA 4NR4A 4J3IA 5EU1A 4NYXA 5E9IA 2DWWA 5CQ7A 5CQ4A 5BT5A 5D3LA 4YYIA 4TQNA 5I7XA 5A83A 5ENJA 4OGIA 5H1UA 3LXJA 5FG6A 2G4AA 4HBYA 4O71A 5LKZA 5FE3A 4A9FA 4QBMA 4AKNA 2FSAA 4YYGA 3P1DA 4HXNA 5EPBA 5KTWA 4X2IA 3UVWA 5ENGA 1N72A 4QSUA 4UIXA 5CUEA 5EA1A 5FE4A 4FLPA 4O7FA 5CP5A 4MEPA 4Q0OA 4QSRA 3UVYA 5H1VA 5IBNA 4C66A 4Z6IA 3UVXA 5FE2A 5CQ3A 5FH7A 4CUSA 2DVVA 4TZ8A 4NYVA 5D3RA 3IU6A 5CZGA 5CTLA 5L8UA 5G4SA 2OO1A 4UYGA 4LC2A 5EICA 4XUBA 5EQ1A 5CS8A 5DYUA 4ALGA 4MEQA 5F1LA 2OUOA 4KV4A 4QUUA 5D3JA 3U5JA 4IOQA 5AMFA 4A9MA 3SVGA 2YELA 4UIUA 5D3NA 3U5MA 5DYCA 4NRBA 5A7CA 5CUDA 5FG5A 4E96A 4WHUA 2L84A 4A9EA 5D0CA 2LSPB 5DYAA 4MR4A 5HJCA 4IOOA 2NXBA 4BJXA 5CU8A 4CFKA 5D7XA 3UVDA 4TT2A 5TB6A 5LKXA 5CFWA 5DX4A 5EISA 4GPJA 4A9JA 4Q0NA 4QZSA 5C4QA 5IGMA 3G0JA 4YC9A 5D25A 3DAIA 3JVKA 5HLSA 5F61A 4Z1QA 5DY7A 4YK0A 4MR3A 5I80A 4CUQA 5E9VA 4ZW1A 4TZ2A 4NR5A 2RO1A 5DW1A 4QSXA 4LZRA 3LQJA 5II2A 4NRAA 5CUGA 2YQDA 2N9GA 5BT4A 4QR5A 3K2JA 4QYLA 4CUTA 2L85A 4NR6A 3MXFA 2DVRA 4O74A 2D82A 4NR8A 5DKCA 3U5LA 4QUTA 3GG3A 2F6NA 3QZTA 5DLZA 4CLBA 5DKDA 5CQAA 5A81A 4QSPA 2RNXA 3AQAA 5C87A 3O37A 3Q2FA 5K29A 4C67A 5FE5A 3LJWA 3QZVA 3G0LA 1JM4B 4TS8A 5L98A 4A9HA 5HEMA 5KHMA 5LVQA 4IR3A 5A85A 4CUPA 4Z6HA 4N4IA 5HRVA 3UV2A
chains in the Genus database with same CATH superfamily
5H85A 4O75A 4PY6A 5FH8A 3O33A 4QSSA 4YYDA 2MJVB 5D3HA 5FE7A 5EVAA 5CUAA 4J1PA 4CFLA 4HBVA 2YEKA 5LUUA 5E3GA 4O77A 4YYKA 4A9NA 4NR7A 2YDWA 3MB4A 5DKHA 4O72A 5AMEA 3NXBA 5CUCA 5L96A 1WUMA 2WP2A 5HM0A 3MB3A 3S92A 2DVSA 4J0SA 4ZQLA 2R10A 5BT3A 3JVMA 3IU5A 5HENA 4OGJA 5LJ0A 3TLPA 4XY8A 3MULA 4TU4A 3MQMA 4A9LA 5CPEA 4NQMA 5EPRA 4N3WA 5DW2A 4RVRA 5FDZA 4YADA 5I89A 4QSQA 3I3JA 4CURA 5I1QA 5LKTA 5LVRA 5G4RA 4QSVA 5ENBA 5F25A 5C7NA 5EK9A 4TU6A 5EPSA 5A5OA 5A5PA 5JWMA 2WP1A 4HXSA 4MR6A 4QYDA 4YATA 4N4GA 4AKHA 2GRCA 5ENFA 4AKGA 3HMFA 4LZSA 4YAXA 5FE8A 4NUDA 4NR9A 2I7KA 2RFJA 5HRWA 5II1A 5L97A 5H1TA 4OUFA 5L99A 5CGPA 3DWYA 4O78A 4A9OA 5E0RA 4TYLA 4J0RA 4YABA 3RCWA 5I7YA 3AADA 2RS9B 5ENCA 5FB1A 3ONIA 5C85A 5L8TA 4XUAA 5FE0A 5F60A 5D26A 5HFRA 5F63A 3VKGA 4UYFB 4PCIA 5IGNA 5COIA 5DBMA 4XYAA 3P1FA 4NRCA 4CUUA 5KTXA 2YYNA 4QEUA 4QEVA 5IGKA 3S91A 4QEWA 4IORA 4YBSA 5F1HA 5F5ZA 4HXKA 2DVQA 5EP7A 5I88A 4O7AA 4UIYA 5IIDA 5CY9A 5A5QA 4UIVA 5DFBA 4BW4A 4PCEA 1F68A 4O76A 4YH3A 3P5OA 4ZC9A 5FE9A 3QZSA 5D24A 4NYWA 5EM3A 5CQTA 4KCXA 5E3DA 4O7EA 5DFDA 4NQNA 4A9IA 3O36A 5I86A 5DFCA 4UYFA 5DYXA 4HXLA 5F2PA 5FFYA 5E9MA 5FB0A 5C89A 2DKWA 4PKLA 4BW2A 5FG4A 4AKIA 4IR6A 4QC3A 2F6JA 4QB3A 4UIZA 5I40A 3SVHA 3Q2EA 5LKUA 5FE1A 3P1CA 5E9YA 5F62A 2R0YA 4N4HA 5J0DA 3U5KA 2RNYA 5E9KA 4QSWA 5I29A 5CQ5A 2RNWA 5CQ6A 5AD3A 4BHWA 4YH4A 5FFVA 5IG6A 3U5OA 5E9LA 5EWHA 4HXMA 4PTBA 3P1EA 3D7CA 2I8NA 3JVLA 5EGUA 4YY6A 3SVFA 2L5EA 4LDFA 4HXRA 5JI8A 1JSPB 4DONA 2E7OA 4LRGA 5CUBA 4O7BA 5HELA 5HRXA 4MEOA 4NXJA 4YYJA 5ENEA 2D9EA 4LYSA 4TTEA 4LZ2A 4YYNA 5HQ6A 5EWVA 3HMEA 4QSTA 4HBXA 5D3SA 3VKHA 2DATA 4YYHA 4UYHA 4Y03A 2RI7A 4HXPA 1WUGA 5EV9A 5ETDA 4LYWA 5KTUA 5KU3A 4CL9A 3MUKA 5HQ7A 4QR3A 4LR6A 4KV1A 3FKMX 4YY4A 3LQIA 4BW1A 1X0JA 4LYIA 4MR5A 5E7DA 4N4FA 5I83A 5A82A 5LJ2A 5D3TA 4IR4A 3D1BA 2YEMA 2YW5A 2R0VA 5AD2A 4QR4A 5HFQA 5D3PA 4BW3A 4MENA 5CRZA 5E74A 5ENIA 5EI4A 5C8GA 2E3KA 5F36A 3O34A 4Z1SA 4TT6A 4YYMA 4NUCA 1EQFA 3UV4A 5EWDA 4YBMA 1PUOA 4NS5A 5ENHA 3HMHA 3LQHA 5A5NA 5A5SA 2R0SA 4IR5A 4F3IA 4UITA 1E6IA 5TCMA 5LJ1A 4UIWA 3JVJA 4WHWA 5E73A 5F3AA 3U5PA 4YBTA 4QY4A 1ZS5A 4O70A 5KO4A 5DLXA 5FBXA 4QC1A 4UYEA 4PS5A 4WIVA 3UV5A 2H60A 5FFWA 5A5RA 3UW9A 5EWWA 5HQ5A 5FH6A 5HCLA 4NUEA 4AI6A 4TT4A 2E7NA 5CRMA 4A9KA 5ACYA 3ZYUA 4O7CA 4HBWA 2EJNA 5EWCA 4Z93A 5IGLA 5FE6A 2KTBB 3O35A 4HXOA 4UYDA 4ALHA 2OSSA 4QNSA 4XY9A 5CQ8A 5ETBA 3U5NA 4NR4A 4J3IA 5EU1A 4NYXA 5E9IA 2DWWA 5CQ7A 5CQ4A 5BT5A 5D3LA 4YYIA 4TQNA 5I7XA 5A83A 5ENJA 4OGIA 5H1UA 3D1DA 3LXJA 5FG6A 2G4AA 4HBYA 4O71A 5LKZA 5FE3A 4A9FA 4QBMA 4AKNA 2FSAA 4YYGA 3P1DA 4HXNA 5EPBA 5KTWA 4X2IA 3UVWA 5ENGA 1N72A 4QSUA 4UIXA 5CUEA 5EA1A 5FE4A 4FLPA 4O7FA 5CP5A 4MEPA 4Q0OA 4QSRA 3UVYA 5H1VA 5IBNA 1ZKRA 4C66A 4Z6IA 3UVXA 5FE2A 5CQ3A 5FH7A 4CUSA 2DVVA 4TZ8A 4NYVA 5D3RA 3IU6A 5CZGA 5CTLA 5L8UA 5G4SA 2OO1A 4UYGA 4LC2A 5EICA 4XUBA 5EQ1A 5CS8A 5DYUA 4ALGA 4MEQA 5F1LA 2OUOA 4KV4A 4QUUA 5D3JA 3U5JA 4IOQA 5AMFA 4A9MA 3SVGA 2YELA 4UIUA 5D3NA 3U5MA 5DYCA 4NRBA 5A7CA 5CUDA 5FG5A 4E96A 4WHUA 2L84A 4A9EA 5D0CA 2LSPB 5DYAA 4MR4A 5HJCA 4IOOA 2NXBA 4BJXA 5CU8A 4CFKA 5D7XA 3UVDA 4TT2A 5TB6A 5LKXA 5CFWA 5DX4A 5EISA 4GPJA 4A9JA 4Q0NA 4QZSA 5C4QA 5IGMA 3G0JA 4YC9A 5D25A 3DAIA 3JVKA 5HLSA 5F61A 4Z1QA 5DY7A 4YK0A 4MR3A 5I80A 4CUQA 5E9VA 4ZW1A 4TZ2A 4NR5A 2RO1A 5DW1A 4QSXA 4LZRA 3LQJA 5II2A 4NRAA 5CUGA 2YQDA 2N9GA 5BT4A 4QR5A 3K2JA 4QYLA 4CUTA 2L85A 4NR6A 3MXFA 2DVRA 4O74A 2D82A 4NR8A 5DKCA 3U5LA 4QUTA 3GG3A 2F6NA 3QZTA 5DLZA 4CLBA 5DKDA 5CQAA 5A81A 4QSPA 2RNXA 3AQAA 5C87A 3O37A 3Q2FA 5K29A 4C67A 5FE5A 3LJWA 3QZVA 3G0LA 1JM4B 3ERRA 4TS8A 5L98A 4A9HA 5HEMA 5KHMA 5LVQA 4IR3A 5A85A 4CUPA 4Z6HA 4N4IA 5HRVA 3UV2A
chains in the Genus database with same CATH topology
5H85A 4O75A 4PY6A 5FH8A 3O33A 4QSSA 4YYDA 2MJVB 5D3HA 5FE7A 5EVAA 5CUAA 4J1PA 4CFLA 4HBVA 2YEKA 5LUUA 5E3GA 4O77A 4YYKA 4A9NA 4NR7A 2YDWA 3MB4A 5DKHA 4O72A 5AMEA 3NXBA 5CUCA 5L96A 1WUMA 2WP2A 5HM0A 3MB3A 3S92A 2DVSA 4J0SA 4ZQLA 2R10A 5BT3A 3JVMA 3IU5A 5HENA 4OGJA 5LJ0A 3TLPA 4XY8A 3MULA 4TU4A 3MQMA 4A9LA 5CPEA 4NQMA 5EPRA 4N3WA 5DW2A 4RVRA 5FDZA 4YADA 5I89A 4QSQA 3I3JA 4CURA 5I1QA 5LKTA 5LVRA 5G4RA 4QSVA 5ENBA 5F25A 5C7NA 5EK9A 4TU6A 5EPSA 5A5OA 5A5PA 5JWMA 2WP1A 4HXSA 4MR6A 4QYDA 4YATA 4N4GA 2GRCA 5ENFA 3HMFA 4LZSA 4YAXA 5FE8A 4NUDA 4NR9A 2I7KA 2RFJA 5HRWA 5II1A 5L97A 5H1TA 4OUFA 5L99A 5CGPA 3DWYA 4O78A 4A9OA 5E0RA 4TYLA 4J0RA 4YABA 3RCWA 5I7YA 3AADA 2RS9B 5ENCA 5FB1A 3ONIA 5C85A 5L8TA 4XUAA 5FE0A 5F60A 5D26A 5HFRA 5F63A 4UYFB 4PCIA 5IGNA 5COIA 5DBMA 4XYAA 3P1FA 4NRCA 4CUUA 5KTXA 2YYNA 4QEUA 4QEVA 5IGKA 3S91A 4QEWA 4IORA 4YBSA 5F1HA 5F5ZA 4HXKA 2DVQA 5EP7A 5I88A 4O7AA 4UIYA 5IIDA 5CY9A 5A5QA 4UIVA 5DFBA 4BW4A 4PCEA 1F68A 4O76A 4YH3A 3P5OA 4ZC9A 5FE9A 3QZSA 5D24A 4NYWA 5EM3A 5CQTA 4KCXA 5E3DA 4O7EA 5DFDA 4NQNA 4A9IA 3O36A 5I86A 5DFCA 4UYFA 5DYXA 4HXLA 5F2PA 5FFYA 5E9MA 5FB0A 5C89A 2DKWA 4PKLA 4BW2A 5FG4A 4IR6A 4QC3A 2F6JA 4QB3A 4UIZA 5I40A 3SVHA 3Q2EA 5LKUA 5FE1A 3P1CA 5E9YA 5F62A 2R0YA 4N4HA 5J0DA 3U5KA 2RNYA 5E9KA 4QSWA 5I29A 5CQ5A 2RNWA 5CQ6A 5AD3A 4BHWA 4YH4A 5FFVA 5IG6A 3U5OA 5E9LA 5EWHA 4HXMA 4PTBA 3P1EA 3D7CA 2I8NA 3JVLA 5EGUA 4YY6A 3SVFA 2L5EA 4LDFA 4HXRA 5JI8A 1JSPB 4DONA 2E7OA 4LRGA 5CUBA 4O7BA 5HELA 5HRXA 4MEOA 4NXJA 4YYJA 5ENEA 2D9EA 4LYSA 4TTEA 4LZ2A 4YYNA 5HQ6A 5EWVA 3HMEA 4QSTA 4HBXA 5D3SA 2DATA 4YYHA 4UYHA 4Y03A 2RI7A 4HXPA 1WUGA 5EV9A 5ETDA 4LYWA 5KTUA 5KU3A 4CL9A 3MUKA 5HQ7A 4QR3A 4LR6A 4KV1A 3FKMX 4YY4A 3LQIA 4BW1A 1X0JA 4LYIA 4MR5A 5E7DA 4N4FA 5I83A 5A82A 5LJ2A 5D3TA 4IR4A 2YEMA 2YW5A 2R0VA 5AD2A 4QR4A 5HFQA 5D3PA 4BW3A 4MENA 5CRZA 5E74A 5ENIA 5EI4A 5C8GA 2E3KA 5F36A 3O34A 4Z1SA 4TT6A 4YYMA 4NUCA 1EQFA 3UV4A 5EWDA 4YBMA 5ENHA 4NS5A 3HMHA 3LQHA 5A5NA 5A5SA 2R0SA 4IR5A 4F3IA 4UITA 1E6IA 5TCMA 5LJ1A 4UIWA 3JVJA 4WHWA 5E73A 5F3AA 3U5PA 4YBTA 4QY4A 1ZS5A 4O70A 5KO4A 5DLXA 5FBXA 4QC1A 4UYEA 4PS5A 4WIVA 3UV5A 2H60A 5FFWA 5A5RA 3UW9A 5EWWA 5HQ5A 5FH6A 5HCLA 4NUEA 4TT4A 2E7NA 5CRMA 4A9KA 5ACYA 3ZYUA 4O7CA 4HBWA 5EWCA 4Z93A 5IGLA 5FE6A 2KTBB 3O35A 4HXOA 4UYDA 4ALHA 2OSSA 4QNSA 4XY9A 5CQ8A 5ETBA 3U5NA 4NR4A 4J3IA 5EU1A 4NYXA 5E9IA 2DWWA 5CQ7A 5CQ4A 5BT5A 5D3LA 4YYIA 4TQNA 5I7XA 5A83A 5ENJA 4OGIA 5H1UA 3LXJA 5FG6A 2G4AA 4HBYA 4O71A 5LKZA 5FE3A 4A9FA 4QBMA 4AKNA 2FSAA 4YYGA 3P1DA 4HXNA 5EPBA 5KTWA 4X2IA 3UVWA 5ENGA 1N72A 4QSUA 4UIXA 5CUEA 5EA1A 5FE4A 4FLPA 4O7FA 5CP5A 4MEPA 4Q0OA 4QSRA 3UVYA 5H1VA 5IBNA 4C66A 4Z6IA 3UVXA 5FE2A 5CQ3A 5FH7A 4CUSA 2DVVA 4TZ8A 4NYVA 5D3RA 3IU6A 5CZGA 5CTLA 5L8UA 5G4SA 2OO1A 4UYGA 4LC2A 5EICA 4XUBA 5EQ1A 5CS8A 5DYUA 4ALGA 4MEQA 5F1LA 2OUOA 4KV4A 4QUUA 5D3JA 3U5JA 4IOQA 5AMFA 4A9MA 3SVGA 2YELA 4UIUA 5D3NA 3U5MA 5DYCA 4NRBA 5A7CA 5CUDA 5FG5A 4E96A 4WHUA 2L84A 4A9EA 5D0CA 2LSPB 5DYAA 4MR4A 5HJCA 4IOOA 2NXBA 4BJXA 5CU8A 4CFKA 5D7XA 3UVDA 4TT2A 5TB6A 5LKXA 5CFWA 5DX4A 5EISA 4GPJA 4A9JA 4Q0NA 4QZSA 5C4QA 5IGMA 3G0JA 4YC9A 5D25A 3DAIA 3JVKA 5HLSA 5F61A 4Z1QA 5DY7A 4YK0A 4MR3A 5I80A 4CUQA 5E9VA 4ZW1A 4TZ2A 4NR5A 2RO1A 5DW1A 4QSXA 4LZRA 3LQJA 5II2A 4NRAA 5CUGA 2YQDA 2N9GA 5BT4A 4QR5A 3K2JA 4QYLA 4CUTA 2L85A 4NR6A 3MXFA 2DVRA 4O74A 2D82A 4NR8A 5DKCA 3U5LA 4QUTA 3GG3A 2F6NA 3QZTA 5DLZA 4CLBA 5DKDA 5CQAA 5A81A 4QSPA 2RNXA 3AQAA 5C87A 3O37A 3Q2FA 5K29A 4C67A 5FE5A 3LJWA 3QZVA 3G0LA 1JM4B 4TS8A 5L98A 4A9HA 5HEMA 5KHMA 5LVQA 4IR3A 5A85A 4CUPA 4Z6HA 4N4IA 5HRVA 3UV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H85 A;  4O75 A;  4PY6 A;  5FH8 A;  3O33 A;  4QSS A;  4YYD A;  2MJV B;  5D3H A;  5FE7 A;  5EVA A;  5CUA A;  4J1P A;  4CFL A;  4HBV A;  2YEK A;  5LUU A;  5E3G A;  4O77 A;  4YYK A;  4A9N A;  4NR7 A;  2YDW A;  3MB4 A;  5DKH A;  4O72 A;  5AME A;  3NXB A;  5CUC A;  5L96 A;  1WUM A;  2WP2 A;  5HM0 A;  3MB3 A;  3S92 A;  2DVS A;  4J0S A;  4ZQL A;  2R10 A;  5BT3 A;  3JVM A;  3IU5 A;  5HEN A;  4OGJ A;  5LJ0 A;  3TLP A;  4XY8 A;  3MUL A;  4TU4 A;  3MQM A;  4A9L A;  5CPE A;  4NQM A;  5EPR A;  4N3W A;  5DW2 A;  4RVR A;  5FDZ A;  4YAD A;  5I89 A;  4QSQ A;  3I3J A;  4CUR A;  5I1Q A;  5LKT A;  5LVR A;  5G4R A;  4QSV A;  5ENB A;  5F25 A;  5C7N A;  5EK9 A;  4TU6 A;  5EPS A;  5A5O A;  5A5P A;  5JWM A;  2WP1 A;  4HXS A;  4MR6 A;  4QYD A;  4YAT A;  4N4G A;  2GRC A;  5ENF A;  3HMF A;  4LZS A;  4YAX A;  5FE8 A;  4NUD A;  4NR9 A;  2I7K A;  2RFJ A;  5HRW A;  5II1 A;  5L97 A;  5H1T A;  4OUF A;  5L99 A;  5CGP A;  3DWY A;  4O78 A;  4A9O A;  5E0R A;  4TYL A;  4J0R A;  4YAB A;  3RCW A;  5I7Y A;  3AAD A;  2RS9 B;  5ENC A;  5FB1 A;  3ONI A;  5C85 A;  5L8T A;  4XUA A;  5FE0 A;  5F60 A;  5D26 A;  5HFR A;  5F63 A;  4UYF B;  4PCI A;  5IGN A;  5COI A;  5DBM A;  4XYA A;  3P1F A;  4NRC A;  4CUU A;  5KTX A;  2YYN A;  4QEU A;  4QEV A;  5IGK A;  3S91 A;  4QEW A;  4IOR A;  4YBS A;  5F1H A;  5F5Z A;  4HXK A;  2DVQ A;  5EP7 A;  5I88 A;  4O7A A;  4UIY A;  5IID A;  5CY9 A;  5A5Q A;  4UIV A;  5DFB A;  4BW4 A;  4PCE A;  1F68 A;  4O76 A;  4YH3 A;  3P5O A;  4ZC9 A;  5FE9 A;  3QZS A;  5D24 A;  4NYW A;  5EM3 A;  5CQT A;  4KCX A;  5E3D A;  4O7E A;  5DFD A;  4NQN A;  4A9I A;  3O36 A;  5I86 A;  5DFC A;  4UYF A;  5DYX A;  4HXL A;  5F2P A;  5FFY A;  5E9M A;  5FB0 A;  5C89 A;  2DKW A;  4PKL A;  4BW2 A;  5FG4 A;  4IR6 A;  4QC3 A;  2F6J A;  4QB3 A;  4UIZ A;  5I40 A;  3SVH A;  3Q2E A;  5LKU A;  5FE1 A;  3P1C A;  5E9Y A;  5F62 A;  2R0Y A;  4N4H A;  5J0D A;  3U5K A;  2RNY A;  5E9K A;  4QSW A;  5I29 A;  5CQ5 A;  2RNW A;  5CQ6 A;  5AD3 A;  4BHW A;  4YH4 A;  5FFV A;  5IG6 A;  3U5O A;  5E9L A;  5EWH A;  4HXM A;  4PTB A;  3P1E A;  3D7C A;  2I8N A;  3JVL A;  5EGU A;  4YY6 A;  3SVF A;  2L5E A;  4LDF A;  4HXR A;  5JI8 A;  1JSP B;  4DON A;  2E7O A;  4LRG A;  5CUB A;  4O7B A;  5HEL A;  5HRX A;  4MEO A;  4NXJ A;  4YYJ A;  5ENE A;  2D9E A;  4LYS A;  4TTE A;  4LZ2 A;  4YYN A;  5HQ6 A;  5EWV A;  3HME A;  4QST A;  4HBX A;  5D3S A;  2DAT A;  4YYH A;  4UYH A;  4Y03 A;  2RI7 A;  4HXP A;  1WUG A;  5EV9 A;  5ETD A;  4LYW A;  5KTU A;  5KU3 A;  4CL9 A;  3MUK A;  5HQ7 A;  4QR3 A;  4LR6 A;  4KV1 A;  3FKM X;  4YY4 A;  3LQI A;  4BW1 A;  1X0J A;  4LYI A;  4MR5 A;  5E7D A;  4N4F A;  5I83 A;  5A82 A;  5LJ2 A;  5D3T A;  4IR4 A;  2YEM A;  2YW5 A;  2R0V A;  5AD2 A;  4QR4 A;  5HFQ A;  5D3P A;  4BW3 A;  4MEN A;  5CRZ A;  5E74 A;  5ENI A;  5EI4 A;  5C8G A;  2E3K A;  5F36 A;  3O34 A;  4Z1S A;  4TT6 A;  4YYM A;  4NUC A;  1EQF A;  3UV4 A;  5EWD A;  4YBM A;  5ENH A;  4NS5 A;  3HMH A;  3LQH A;  5A5N A;  5A5S A;  2R0S A;  4IR5 A;  4F3I A;  4UIT A;  1E6I A;  5TCM A;  5LJ1 A;  4UIW A;  3JVJ A;  4WHW A;  5E73 A;  5F3A A;  3U5P A;  4YBT A;  4QY4 A;  1ZS5 A;  4O70 A;  5KO4 A;  5DLX A;  5FBX A;  4QC1 A;  4UYE A;  4PS5 A;  4WIV A;  3UV5 A;  2H60 A;  5FFW A;  5A5R A;  3UW9 A;  5EWW A;  5HQ5 A;  5FH6 A;  5HCL A;  4NUE A;  4TT4 A;  2E7N A;  5CRM A;  4A9K A;  5ACY A;  3ZYU A;  4O7C A;  4HBW A;  5EWC A;  4Z93 A;  5IGL A;  5FE6 A;  2KTB B;  3O35 A;  4HXO A;  4UYD A;  4ALH A;  2OSS A;  4QNS A;  4XY9 A;  5CQ8 A;  5ETB A;  3U5N A;  4NR4 A;  4J3I A;  5EU1 A;  4NYX A;  5E9I A;  2DWW A;  5CQ7 A;  5CQ4 A;  5BT5 A;  5D3L A;  4YYI A;  4TQN A;  5I7X A;  5A83 A;  5ENJ A;  4OGI A;  5H1U A;  3LXJ A;  5FG6 A;  2G4A A;  4HBY A;  4O71 A;  5LKZ A;  5FE3 A;  4A9F A;  4QBM A;  4AKN A;  2FSA A;  4YYG A;  3P1D A;  4HXN A;  5EPB A;  5KTW A;  4X2I A;  3UVW A;  5ENG A;  1N72 A;  4QSU A;  4UIX A;  5CUE A;  5EA1 A;  5FE4 A;  4FLP A;  4O7F A;  5CP5 A;  4MEP A;  4Q0O A;  4QSR A;  3UVY A;  5H1V A;  5IBN A;  4C66 A;  4Z6I A;  3UVX A;  5FE2 A;  5CQ3 A;  5FH7 A;  4CUS A;  2DVV A;  4TZ8 A;  4NYV A;  5D3R A;  3IU6 A;  5CZG A;  5CTL A;  5L8U A;  5G4S A;  2OO1 A;  4UYG A;  4LC2 A;  5EIC A;  4XUB A;  5EQ1 A;  5CS8 A;  5DYU A;  4ALG A;  4MEQ A;  5F1L A;  2OUO A;  4KV4 A;  4QUU A;  5D3J A;  3U5J A;  4IOQ A;  5AMF A;  4A9M A;  3SVG A;  2YEL A;  4UIU A;  5D3N A;  3U5M A;  5DYC A;  4NRB A;  5A7C A;  5CUD A;  5FG5 A;  4E96 A;  4WHU A;  2L84 A;  4A9E A;  5D0C A;  2LSP B;  5DYA A;  4MR4 A;  5HJC A;  4IOO A;  2NXB A;  4BJX A;  5CU8 A;  4CFK A;  5D7X A;  3UVD A;  4TT2 A;  5TB6 A;  5LKX A;  5CFW A;  5DX4 A;  5EIS A;  4GPJ A;  4A9J A;  4Q0N A;  4QZS A;  5C4Q A;  5IGM A;  3G0J A;  4YC9 A;  5D25 A;  3DAI A;  3JVK A;  5HLS A;  5F61 A;  4Z1Q A;  5DY7 A;  4YK0 A;  4MR3 A;  5I80 A;  4CUQ A;  5E9V A;  4ZW1 A;  4TZ2 A;  4NR5 A;  2RO1 A;  5DW1 A;  4QSX A;  4LZR A;  3LQJ A;  5II2 A;  4NRA A;  5CUG A;  2YQD A;  2N9G A;  5BT4 A;  4QR5 A;  3K2J A;  4QYL A;  4CUT A;  2L85 A;  4NR6 A;  3MXF A;  2DVR A;  4O74 A;  2D82 A;  4NR8 A;  5DKC A;  3U5L A;  4QUT A;  3GG3 A;  2F6N A;  3QZT A;  5DLZ A;  4CLB A;  5DKD A;  5CQA A;  5A81 A;  4QSP A;  2RNX A;  3AQA A;  5C87 A;  3O37 A;  3Q2F A;  5K29 A;  4C67 A;  5FE5 A;  3LJW A;  3QZV A;  3G0L A;  1JM4 B;  4TS8 A;  5L98 A;  4A9H A;  5HEM A;  5KHM A;  5LVQ A;  4IR3 A;  5A85 A;  4CUP A;  4Z6H A;  4N4I A;  5HRV A;  3UV2 A; 
#chains in the Genus database with same CATH topology
 5H85 A;  4O75 A;  4PY6 A;  5FH8 A;  3O33 A;  4QSS A;  4YYD A;  2MJV B;  5D3H A;  5FE7 A;  5EVA A;  5CUA A;  4J1P A;  4CFL A;  4HBV A;  2YEK A;  5LUU A;  5E3G A;  4O77 A;  4YYK A;  4A9N A;  4NR7 A;  2YDW A;  3MB4 A;  5DKH A;  4O72 A;  5AME A;  3NXB A;  5CUC A;  5L96 A;  1WUM A;  2WP2 A;  5HM0 A;  3MB3 A;  3S92 A;  2DVS A;  4J0S A;  4ZQL A;  2R10 A;  5BT3 A;  3JVM A;  3IU5 A;  5HEN A;  4OGJ A;  5LJ0 A;  3TLP A;  4XY8 A;  3MUL A;  4TU4 A;  3MQM A;  4A9L A;  5CPE A;  4NQM A;  5EPR A;  4N3W A;  5DW2 A;  4RVR A;  5FDZ A;  4YAD A;  5I89 A;  4QSQ A;  3I3J A;  4CUR A;  5I1Q A;  5LKT A;  5LVR A;  5G4R A;  4QSV A;  5ENB A;  5F25 A;  5C7N A;  5EK9 A;  4TU6 A;  5EPS A;  5A5O A;  5A5P A;  5JWM A;  2WP1 A;  4HXS A;  4MR6 A;  4QYD A;  4YAT A;  4N4G A;  4AKH A;  2GRC A;  5ENF A;  4AKG A;  3HMF A;  4LZS A;  4YAX A;  5FE8 A;  4NUD A;  4NR9 A;  2I7K A;  2RFJ A;  5HRW A;  5II1 A;  5L97 A;  5H1T A;  4OUF A;  5L99 A;  5CGP A;  3DWY A;  4O78 A;  4A9O A;  5E0R A;  4TYL A;  4J0R A;  4YAB A;  3RCW A;  5I7Y A;  3AAD A;  2RS9 B;  5ENC A;  5FB1 A;  3ONI A;  5C85 A;  5L8T A;  4XUA A;  5FE0 A;  5F60 A;  5D26 A;  5HFR A;  5F63 A;  3VKG A;  4UYF B;  4PCI A;  5IGN A;  5COI A;  5DBM A;  4XYA A;  3P1F A;  4NRC A;  4CUU A;  5KTX A;  2YYN A;  4QEU A;  4QEV A;  5IGK A;  3S91 A;  4QEW A;  4IOR A;  4YBS A;  5F1H A;  5F5Z A;  4HXK A;  2DVQ A;  5EP7 A;  5I88 A;  4O7A A;  4UIY A;  5IID A;  5CY9 A;  5A5Q A;  4UIV A;  5DFB A;  4BW4 A;  4PCE A;  1F68 A;  4O76 A;  4YH3 A;  3P5O A;  4ZC9 A;  5FE9 A;  3QZS A;  5D24 A;  4NYW A;  5EM3 A;  5CQT A;  4KCX A;  5E3D A;  4O7E A;  5DFD A;  4NQN A;  4A9I A;  3O36 A;  5I86 A;  5DFC A;  4UYF A;  5DYX A;  4HXL A;  5F2P A;  5FFY A;  5E9M A;  5FB0 A;  5C89 A;  2DKW A;  4PKL A;  4BW2 A;  5FG4 A;  4AKI A;  4IR6 A;  4QC3 A;  2F6J A;  4QB3 A;  4UIZ A;  5I40 A;  3SVH A;  3Q2E A;  5LKU A;  5FE1 A;  3P1C A;  5E9Y A;  5F62 A;  2R0Y A;  4N4H A;  5J0D A;  3U5K A;  2RNY A;  5E9K A;  4QSW A;  5I29 A;  5CQ5 A;  2RNW A;  5CQ6 A;  5AD3 A;  4BHW A;  4YH4 A;  5FFV A;  5IG6 A;  3U5O A;  5E9L A;  5EWH A;  4HXM A;  4PTB A;  3P1E A;  3D7C A;  2I8N A;  3JVL A;  5EGU A;  4YY6 A;  3SVF A;  2L5E A;  4LDF A;  4HXR A;  5JI8 A;  1JSP B;  4DON A;  2E7O A;  4LRG A;  5CUB A;  4O7B A;  5HEL A;  5HRX A;  4MEO A;  4NXJ A;  4YYJ A;  5ENE A;  2D9E A;  4LYS A;  4TTE A;  4LZ2 A;  4YYN A;  5HQ6 A;  5EWV A;  3HME A;  4QST A;  4HBX A;  5D3S A;  3VKH A;  2DAT A;  4YYH A;  4UYH A;  4Y03 A;  2RI7 A;  4HXP A;  1WUG A;  5EV9 A;  5ETD A;  4LYW A;  5KTU A;  5KU3 A;  4CL9 A;  3MUK A;  5HQ7 A;  4QR3 A;  4LR6 A;  4KV1 A;  3FKM X;  4YY4 A;  3LQI A;  4BW1 A;  1X0J A;  4LYI A;  4MR5 A;  5E7D A;  4N4F A;  5I83 A;  5A82 A;  5LJ2 A;  5D3T A;  4IR4 A;  3D1B A;  2YEM A;  2YW5 A;  2R0V A;  5AD2 A;  4QR4 A;  5HFQ A;  5D3P A;  4BW3 A;  4MEN A;  5CRZ A;  5E74 A;  5ENI A;  5EI4 A;  5C8G A;  2E3K A;  5F36 A;  3O34 A;  4Z1S A;  4TT6 A;  4YYM A;  4NUC A;  1EQF A;  3UV4 A;  5EWD A;  4YBM A;  1PUO A;  4NS5 A;  5ENH A;  3HMH A;  3LQH A;  5A5N A;  5A5S A;  2R0S A;  4IR5 A;  4F3I A;  4UIT A;  1E6I A;  5TCM A;  5LJ1 A;  4UIW A;  3JVJ A;  4WHW A;  5E73 A;  5F3A A;  3U5P A;  4YBT A;  4QY4 A;  1ZS5 A;  4O70 A;  5KO4 A;  5DLX A;  5FBX A;  4QC1 A;  4UYE A;  4PS5 A;  4WIV A;  3UV5 A;  2H60 A;  5FFW A;  5A5R A;  3UW9 A;  5EWW A;  5HQ5 A;  5FH6 A;  5HCL A;  4NUE A;  4AI6 A;  4TT4 A;  2E7N A;  5CRM A;  4A9K A;  5ACY A;  3ZYU A;  4O7C A;  4HBW A;  2EJN A;  5EWC A;  4Z93 A;  5IGL A;  5FE6 A;  2KTB B;  3O35 A;  4HXO A;  4UYD A;  4ALH A;  2OSS A;  4QNS A;  4XY9 A;  5CQ8 A;  5ETB A;  3U5N A;  4NR4 A;  4J3I A;  5EU1 A;  4NYX A;  5E9I A;  2DWW A;  5CQ7 A;  5CQ4 A;  5BT5 A;  5D3L A;  4YYI A;  4TQN A;  5I7X A;  5A83 A;  5ENJ A;  4OGI A;  5H1U A;  3D1D A;  3LXJ A;  5FG6 A;  2G4A A;  4HBY A;  4O71 A;  5LKZ A;  5FE3 A;  4A9F A;  4QBM A;  4AKN A;  2FSA A;  4YYG A;  3P1D A;  4HXN A;  5EPB A;  5KTW A;  4X2I A;  3UVW A;  5ENG A;  1N72 A;  4QSU A;  4UIX A;  5CUE A;  5EA1 A;  5FE4 A;  4FLP A;  4O7F A;  5CP5 A;  4MEP A;  4Q0O A;  4QSR A;  3UVY A;  5H1V A;  5IBN A;  1ZKR A;  4C66 A;  4Z6I A;  3UVX A;  5FE2 A;  5CQ3 A;  5FH7 A;  4CUS A;  2DVV A;  4TZ8 A;  4NYV A;  5D3R A;  3IU6 A;  5CZG A;  5CTL A;  5L8U A;  5G4S A;  2OO1 A;  4UYG A;  4LC2 A;  5EIC A;  4XUB A;  5EQ1 A;  5CS8 A;  5DYU A;  4ALG A;  4MEQ A;  5F1L A;  2OUO A;  4KV4 A;  4QUU A;  5D3J A;  3U5J A;  4IOQ A;  5AMF A;  4A9M A;  3SVG A;  2YEL A;  4UIU A;  5D3N A;  3U5M A;  5DYC A;  4NRB A;  5A7C A;  5CUD A;  5FG5 A;  4E96 A;  4WHU A;  2L84 A;  4A9E A;  5D0C A;  2LSP B;  5DYA A;  4MR4 A;  5HJC A;  4IOO A;  2NXB A;  4BJX A;  5CU8 A;  4CFK A;  5D7X A;  3UVD A;  4TT2 A;  5TB6 A;  5LKX A;  5CFW A;  5DX4 A;  5EIS A;  4GPJ A;  4A9J A;  4Q0N A;  4QZS A;  5C4Q A;  5IGM A;  3G0J A;  4YC9 A;  5D25 A;  3DAI A;  3JVK A;  5HLS A;  5F61 A;  4Z1Q A;  5DY7 A;  4YK0 A;  4MR3 A;  5I80 A;  4CUQ A;  5E9V A;  4ZW1 A;  4TZ2 A;  4NR5 A;  2RO1 A;  5DW1 A;  4QSX A;  4LZR A;  3LQJ A;  5II2 A;  4NRA A;  5CUG A;  2YQD A;  2N9G A;  5BT4 A;  4QR5 A;  3K2J A;  4QYL A;  4CUT A;  2L85 A;  4NR6 A;  3MXF A;  2DVR A;  4O74 A;  2D82 A;  4NR8 A;  5DKC A;  3U5L A;  4QUT A;  3GG3 A;  2F6N A;  3QZT A;  5DLZ A;  4CLB A;  5DKD A;  5CQA A;  5A81 A;  4QSP A;  2RNX A;  3AQA A;  5C87 A;  3O37 A;  3Q2F A;  5K29 A;  4C67 A;  5FE5 A;  3LJW A;  3QZV A;  3G0L A;  1JM4 B;  3ERR A;  4TS8 A;  5L98 A;  4A9H A;  5HEM A;  5KHM A;  5LVQ A;  4IR3 A;  5A85 A;  4CUP A;  4Z6H A;  4N4I A;  5HRV A;  3UV2 A; 
#chains in the Genus database with same CATH homology
 5H85 A;  4O75 A;  4PY6 A;  5FH8 A;  3O33 A;  4QSS A;  4YYD A;  2MJV B;  5D3H A;  5FE7 A;  5EVA A;  5CUA A;  4J1P A;  4CFL A;  4HBV A;  2YEK A;  5LUU A;  5E3G A;  4O77 A;  4YYK A;  4A9N A;  4NR7 A;  2YDW A;  3MB4 A;  5DKH A;  4O72 A;  5AME A;  3NXB A;  5CUC A;  5L96 A;  1WUM A;  2WP2 A;  5HM0 A;  3MB3 A;  3S92 A;  2DVS A;  4J0S A;  4ZQL A;  2R10 A;  5BT3 A;  3JVM A;  3IU5 A;  5HEN A;  4OGJ A;  5LJ0 A;  3TLP A;  4XY8 A;  3MUL A;  4TU4 A;  3MQM A;  4A9L A;  5CPE A;  4NQM A;  5EPR A;  4N3W A;  5DW2 A;  4RVR A;  5FDZ A;  4YAD A;  5I89 A;  4QSQ A;  3I3J A;  4CUR A;  5I1Q A;  5LKT A;  5LVR A;  5G4R A;  4QSV A;  5ENB A;  5F25 A;  5C7N A;  5EK9 A;  4TU6 A;  5EPS A;  5A5O A;  5A5P A;  5JWM A;  2WP1 A;  4HXS A;  4MR6 A;  4QYD A;  4YAT A;  4N4G A;  2GRC A;  5ENF A;  3HMF A;  4LZS A;  4YAX A;  5FE8 A;  4NUD A;  4NR9 A;  2I7K A;  2RFJ A;  5HRW A;  5II1 A;  5L97 A;  5H1T A;  4OUF A;  5L99 A;  5CGP A;  3DWY A;  4O78 A;  4A9O A;  5E0R A;  4TYL A;  4J0R A;  4YAB A;  3RCW A;  5I7Y A;  3AAD A;  2RS9 B;  5ENC A;  5FB1 A;  3ONI A;  5C85 A;  5L8T A;  4XUA A;  5FE0 A;  5F60 A;  5D26 A;  5HFR A;  5F63 A;  4UYF B;  4PCI A;  5IGN A;  5COI A;  5DBM A;  4XYA A;  3P1F A;  4NRC A;  4CUU A;  5KTX A;  2YYN A;  4QEU A;  4QEV A;  5IGK A;  3S91 A;  4QEW A;  4IOR A;  4YBS A;  5F1H A;  5F5Z A;  4HXK A;  2DVQ A;  5EP7 A;  5I88 A;  4O7A A;  4UIY A;  5IID A;  5CY9 A;  5A5Q A;  4UIV A;  5DFB A;  4BW4 A;  4PCE A;  1F68 A;  4O76 A;  4YH3 A;  3P5O A;  4ZC9 A;  5FE9 A;  3QZS A;  5D24 A;  4NYW A;  5EM3 A;  5CQT A;  4KCX A;  5E3D A;  4O7E A;  5DFD A;  4NQN A;  4A9I A;  3O36 A;  5I86 A;  5DFC A;  4UYF A;  5DYX A;  4HXL A;  5F2P A;  5FFY A;  5E9M A;  5FB0 A;  5C89 A;  2DKW A;  4PKL A;  4BW2 A;  5FG4 A;  4IR6 A;  4QC3 A;  2F6J A;  4QB3 A;  4UIZ A;  5I40 A;  3SVH A;  3Q2E A;  5LKU A;  5FE1 A;  3P1C A;  5E9Y A;  5F62 A;  2R0Y A;  4N4H A;  5J0D A;  3U5K A;  2RNY A;  5E9K A;  4QSW A;  5I29 A;  5CQ5 A;  2RNW A;  5CQ6 A;  5AD3 A;  4BHW A;  4YH4 A;  5FFV A;  5IG6 A;  3U5O A;  5E9L A;  5EWH A;  4HXM A;  4PTB A;  3P1E A;  3D7C A;  2I8N A;  3JVL A;  5EGU A;  4YY6 A;  3SVF A;  2L5E A;  4LDF A;  4HXR A;  5JI8 A;  1JSP B;  4DON A;  2E7O A;  4LRG A;  5CUB A;  4O7B A;  5HEL A;  5HRX A;  4MEO A;  4NXJ A;  4YYJ A;  5ENE A;  2D9E A;  4LYS A;  4TTE A;  4LZ2 A;  4YYN A;  5HQ6 A;  5EWV A;  3HME A;  4QST A;  4HBX A;  5D3S A;  2DAT A;  4YYH A;  4UYH A;  4Y03 A;  2RI7 A;  4HXP A;  1WUG A;  5EV9 A;  5ETD A;  4LYW A;  5KTU A;  5KU3 A;  4CL9 A;  3MUK A;  5HQ7 A;  4QR3 A;  4LR6 A;  4KV1 A;  3FKM X;  4YY4 A;  3LQI A;  4BW1 A;  1X0J A;  4LYI A;  4MR5 A;  5E7D A;  4N4F A;  5I83 A;  5A82 A;  5LJ2 A;  5D3T A;  4IR4 A;  2YEM A;  2YW5 A;  2R0V A;  5AD2 A;  4QR4 A;  5HFQ A;  5D3P A;  4BW3 A;  4MEN A;  5CRZ A;  5E74 A;  5ENI A;  5EI4 A;  5C8G A;  2E3K A;  5F36 A;  3O34 A;  4Z1S A;  4TT6 A;  4YYM A;  4NUC A;  1EQF A;  3UV4 A;  5EWD A;  4YBM A;  5ENH A;  4NS5 A;  3HMH A;  3LQH A;  5A5N A;  5A5S A;  2R0S A;  4IR5 A;  4F3I A;  4UIT A;  1E6I A;  5TCM A;  5LJ1 A;  4UIW A;  3JVJ A;  4WHW A;  5E73 A;  5F3A A;  3U5P A;  4YBT A;  4QY4 A;  1ZS5 A;  4O70 A;  5KO4 A;  5DLX A;  5FBX A;  4QC1 A;  4UYE A;  4PS5 A;  4WIV A;  3UV5 A;  2H60 A;  5FFW A;  5A5R A;  3UW9 A;  5EWW A;  5HQ5 A;  5FH6 A;  5HCL A;  4NUE A;  4TT4 A;  2E7N A;  5CRM A;  4A9K A;  5ACY A;  3ZYU A;  4O7C A;  4HBW A;  5EWC A;  4Z93 A;  5IGL A;  5FE6 A;  2KTB B;  3O35 A;  4HXO A;  4UYD A;  4ALH A;  2OSS A;  4QNS A;  4XY9 A;  5CQ8 A;  5ETB A;  3U5N A;  4NR4 A;  4J3I A;  5EU1 A;  4NYX A;  5E9I A;  2DWW A;  5CQ7 A;  5CQ4 A;  5BT5 A;  5D3L A;  4YYI A;  4TQN A;  5I7X A;  5A83 A;  5ENJ A;  4OGI A;  5H1U A;  3LXJ A;  5FG6 A;  2G4A A;  4HBY A;  4O71 A;  5LKZ A;  5FE3 A;  4A9F A;  4QBM A;  4AKN A;  2FSA A;  4YYG A;  3P1D A;  4HXN A;  5EPB A;  5KTW A;  4X2I A;  3UVW A;  5ENG A;  1N72 A;  4QSU A;  4UIX A;  5CUE A;  5EA1 A;  5FE4 A;  4FLP A;  4O7F A;  5CP5 A;  4MEP A;  4Q0O A;  4QSR A;  3UVY A;  5H1V A;  5IBN A;  4C66 A;  4Z6I A;  3UVX A;  5FE2 A;  5CQ3 A;  5FH7 A;  4CUS A;  2DVV A;  4TZ8 A;  4NYV A;  5D3R A;  3IU6 A;  5CZG A;  5CTL A;  5L8U A;  5G4S A;  2OO1 A;  4UYG A;  4LC2 A;  5EIC A;  4XUB A;  5EQ1 A;  5CS8 A;  5DYU A;  4ALG A;  4MEQ A;  5F1L A;  2OUO A;  4KV4 A;  4QUU A;  5D3J A;  3U5J A;  4IOQ A;  5AMF A;  4A9M A;  3SVG A;  2YEL A;  4UIU A;  5D3N A;  3U5M A;  5DYC A;  4NRB A;  5A7C A;  5CUD A;  5FG5 A;  4E96 A;  4WHU A;  2L84 A;  4A9E A;  5D0C A;  2LSP B;  5DYA A;  4MR4 A;  5HJC A;  4IOO A;  2NXB A;  4BJX A;  5CU8 A;  4CFK A;  5D7X A;  3UVD A;  4TT2 A;  5TB6 A;  5LKX A;  5CFW A;  5DX4 A;  5EIS A;  4GPJ A;  4A9J A;  4Q0N A;  4QZS A;  5C4Q A;  5IGM A;  3G0J A;  4YC9 A;  5D25 A;  3DAI A;  3JVK A;  5HLS A;  5F61 A;  4Z1Q A;  5DY7 A;  4YK0 A;  4MR3 A;  5I80 A;  4CUQ A;  5E9V A;  4ZW1 A;  4TZ2 A;  4NR5 A;  2RO1 A;  5DW1 A;  4QSX A;  4LZR A;  3LQJ A;  5II2 A;  4NRA A;  5CUG A;  2YQD A;  2N9G A;  5BT4 A;  4QR5 A;  3K2J A;  4QYL A;  4CUT A;  2L85 A;  4NR6 A;  3MXF A;  2DVR A;  4O74 A;  2D82 A;  4NR8 A;  5DKC A;  3U5L A;  4QUT A;  3GG3 A;  2F6N A;  3QZT A;  5DLZ A;  4CLB A;  5DKD A;  5CQA A;  5A81 A;  4QSP A;  2RNX A;  3AQA A;  5C87 A;  3O37 A;  3Q2F A;  5K29 A;  4C67 A;  5FE5 A;  3LJW A;  3QZV A;  3G0L A;  1JM4 B;  4TS8 A;  5L98 A;  4A9H A;  5HEM A;  5KHM A;  5LVQ A;  4IR3 A;  5A85 A;  4CUP A;  4Z6H A;  4N4I A;  5HRV A;  3UV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...