4Z6IA

Crystal structure of brd9 bromodomain in complex with a substituted valerolactam quinolone ligand
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LP99: Discovery and Synthesis of the First Selective BRD7/9 Bromodomain Inhibitor.
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 9
molecule tags Transcription
source organism Homo sapiens
total genus 44
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z6iA00
5CUDA 5E74A 5HRWA 4QC3A 5TB6A 4YBTA 5ETDA 3MB3A 5HCLA 5D3HA 4HBVA 4HXPA 5HRXA 4YH3A 4N4HA 3SVHA 5FE3A 3DAIA 5BT3A 3SVFA 4XY9A 5E3GA 4MEOA 3GG3A 4QUUA 4YYMA 4LYWA 5ENEA 4TU4A 5I1QA 5I7YA 4NQMA 4QSQA 5ENGA 5LJ1A 5HQ6A 5FBXA 4YYIA 5HFRA 1X0JA 2R10A 4ALHA 5F36A 3MULA 5D26A 4DONA 5D3LA 4J3IA 4UYGA 2LSPB 5ENHA 3P1FA 5ACYA 4O7AA 5E9VA 4QEVA 4YY4A 4NRAA 5JI8A 3FKMX 4QYLA 4OGJA 5FB0A 4BW1A 5F25A 4J0SA 5A5QA 2R0YA 4HXLA 4LRGA 4O7BA 4YK0A 5E3DA 5CQ7A 5H1TA 4CUSA 4YBMA 4CFKA 4CUUA 3Q2EA 4QBMA 4HBXA 5I86A 5LUUA 4HXOA 4XUBA 5EP7A 4NUEA 5II2A 3U5JA 3P5OA 5KU3A 4QEUA 5CP5A 5C8GA 4HXMA 4PTBA 3O37A 5EI4A 4NXJA 5DFDA 4IORA 4LZ2A 4UIWA 5D0CA 3LQIA 5G4SA 5G4RA 5H1VA 4IOOA 4TT6A 5EICA 4PCEA 4QSPA 5FG4A 5DYXA 3MXFA 5FE0A 5E0RA 4Q0OA 2N9GA 5C7NA 4CUQA 4WHWA 5II1A 5IGNA 5A5SA 2R0VA 5EV9A 4OUFA 4YABA 4PKLA 5C87A 2R0SA 2RO1A 5HQ5A 4QZSA 4OGIA 5LKXA 2FSAA 3JVKA 4TZ8A 4TQNA 4CURA 4IOQA 4LR6A 5D3SA 4LDFA 5A5NA 5FFWA 4A9IA 5HM0A 4J0RA 5L96A 4A9MA 2YDWA 4YYHA 5CQ4A 5C4QA 3TLPA 4YYDA 2YW5A 1WUGA 5A5OA 5EWWA 4UIXA 3AADA 5ENCA 4O75A 4QC1A 3U5KA 1JSPB 4O71A 5AD2A 4MR3A 5DKHA 5FDZA 5CUCA 3S92A 4NUCA 5F1LA 5FG5A 5CQ5A 4RVRA 5CQ8A 5EWVA 5KO4A 4NQNA 4AKNA 5CGPA 5ENIA 2DVSA 2OUOA 4IR6A 3I3JA 4O70A 5ENJA 2D9EA 3U5LA 5I83A 4NS5A 5EM3A 5CS8A 4UYFB 5IGMA 4QR5A 5I89A 2E7OA 5CTLA 4QEWA 4NR9A 4Y03A 3IU6A 2H60A 5HLSA 5DW2A 5D3JA 5EGUA 4XUAA 5LJ2A 5CU8A 5F5ZA 5DLXA 3LJWA 3O36A 5FE1A 5CRZA 3G0LA 5A5RA 5F63A 5HELA 4NYVA 5I88A 4CUTA 4Z1QA 5LKTA 4ZC9A 2RFJA 4O76A 4MR5A 5A85A 4BHWA 1WUMA 5EPBA 2NXBA 4Z93A 3O33A 5DBMA 3UVWA 5FE2A 5EK9A 3JVLA 3G0JA 4NRCA 3QZTA 3SVGA 1EQFA 4PY6A 5DKCA 5I7XA 4QSVA 3U5MA 4A9KA 4BW3A 5I80A 4BW4A 5C85A 4NR7A 5E9IA 5DYCA 4HXSA 2G4AA 4IR3A 5A5PA 5DX4A 2DKWA 3ZYUA 2GRCA 4QSWA 4NRBA 5I29A 5HFQA 3HMFA 5F3AA 4HXNA 4MEPA 4QSRA 5EPRA 5E73A 2E3KA 4WIVA 4QY4A 2I7KA 4MR4A 5FFYA 5A7CA 5AD3A 5ENFA 5JWMA 5K29A 5DLZA 4XY8A 3JVJA 3U5PA 2RNWA 5IIDA 4ALGA 4MENA 4NYXA 4QR4A 4TT2A 5LVRA 4O77A 5CQTA 5IG6A 4YBSA 4O7CA 2F6NA 5FH8A 4QB3A 4E96A 5E7DA 5EA1A 3UV4A 3UV2A 2D82A 4UYHA 5DYAA 4A9JA 4N4IA 4KV1A 5CZGA 4BW2A 5FE8A 5DFCA 3P1EA 4N3WA 5C89A 4TTEA 4NUDA 4YYJA 4PS5A 4TS8A 5AMEA 5FE5A 1F68A 4YADA 2RI7A 3MQMA 3U5NA 4CLBA 5FH6A 5IBNA 4C66A 5LVQA 3ONIA 5F61A 3MB4A 5HQ7A 4ZQLA 4Z6HA 5EISA 4YAXA 3UVXA 5CUGA 4QNSA 4KV4A 4YATA 5COIA 5HEMA 4YYKA 5BT5A 5BT4A 4QSUA 2OO1A 3HMHA 4YYNA 4MR6A 5CUAA 5FE4A 4NR8A 4QSTA 4IR5A 5F62A 5LKZA 4XYAA 5E9LA 4UIYA 4YH4A 4GPJA 4WHUA 5KHMA 5EVAA 5DFBA 2DVVA 2L5EA 2MJVB 3JVMA 3UW9A 4NYWA 2E7NA 5CQ6A 5E9YA 5ETBA 3P1CA 4X2IA 4O7EA 4A9OA 4A9HA 5IGLA 4LZRA 5CUBA 2YEKA 4QYDA 4HXRA 4FLPA 5KTUA 5EWHA 3U5OA 4QR3A 3O35A 4YYGA 3Q2FA 4LC2A 5HRVA 2YEMA 5L8TA 4TT4A 2DATA 2DWWA 4LYSA 4TYLA 2DVRA 5FE7A 3K2JA 3DWYA 4Q0NA 2RS9B 4NR6A 3LQJA 5I40A 4QUTA 3IU5A 3UVYA 4MEQA 5L8UA 5H1UA 5E9MA 2L84A 5AMFA 2KTBB 5D24A 4PCIA 1N72A 2RNXA 5E9KA 5ENBA 5J0DA 4O78A 2WP2A 5D3PA 3QZSA 3P1DA 5CRMA 4O7FA 5DKDA 5D3RA 4UYEA 5HENA 4O74A 5CQAA 4YY6A 4UIZA 4TU6A 4NR4A 4A9FA 3MUKA 4C67A 2WP1A 5A82A 4UYFA 4A9EA 4LYIA 5KTWA 3UVDA 4HBWA 5FH7A 4QSSA 5FE9A 4A9NA 4NR5A 5FG6A 5DYUA 5TCMA 4QSXA 5L97A 2RNYA 4TZ2A 1JM4B 4UIVA 5DY7A 3D7CA 5EWDA 5D7XA 5A83A 4UYDA 2YQDA 4F3IA 4CUPA 3LQHA 3NXBA 5A81A 1E6IA 4A9LA 2OSSA 3RCWA 5EWCA 5KTXA 3QZVA 3LXJA 5F2PA 3UV5A 5F60A 1ZS5A 5FE6A 4UITA 4J1PA 5F1HA 5H85A 2L85A 4BJXA 5CFWA 2I8NA 2YELA 4HBYA 4O72A 4HXKA 4YC9A 3HMEA 4N4GA 5EPSA 4KCXA 5FB1A 5CPEA 4IR4A 5D3NA 3S91A 4Z1SA 5LKUA 4N4FA 5IGKA 5EQ1A 5L98A 5FFVA 3AQAA 5L99A 4ZW1A 3O34A 5D25A 5DW1A 5CQ3A 4Z6IA 4CFLA 5HJCA 5CY9A 2F6JA 2YYNA 5D3TA 4CL9A 2DVQA 5EU1A 4UIUA 4LZSA 5CUEA 5LJ0A
chains in the Genus database with same CATH superfamily
5CUDA 5E74A 5HRWA 4QC3A 5TB6A 4YBTA 5ETDA 3MB3A 5HCLA 5D3HA 4HBVA 4HXPA 5HRXA 4YH3A 4N4HA 3SVHA 5FE3A 3DAIA 5BT3A 3SVFA 4XY9A 5E3GA 4MEOA 3GG3A 4QUUA 4YYMA 4LYWA 5ENEA 4TU4A 5I1QA 5I7YA 4NQMA 4QSQA 5ENGA 5LJ1A 5HQ6A 5FBXA 4YYIA 5HFRA 1PUOA 1X0JA 2R10A 4ALHA 5F36A 3MULA 5D26A 4DONA 5D3LA 4J3IA 4UYGA 2EJNA 2LSPB 5ENHA 3P1FA 5ACYA 4O7AA 5E9VA 4QEVA 4YY4A 4NRAA 5JI8A 3FKMX 4QYLA 4OGJA 5FB0A 4BW1A 5F25A 4J0SA 5A5QA 2R0YA 4HXLA 4LRGA 4O7BA 4YK0A 5E3DA 5CQ7A 5H1TA 4CUSA 4YBMA 4CFKA 4CUUA 3Q2EA 4QBMA 4HBXA 3VKHA 5I86A 5LUUA 4HXOA 4XUBA 5EP7A 4NUEA 5II2A 3U5JA 3P5OA 5KU3A 4QEUA 5CP5A 5C8GA 4HXMA 4PTBA 3O37A 5EI4A 4NXJA 5DFDA 4AKGA 4IORA 4LZ2A 4UIWA 5D0CA 3LQIA 5G4SA 5G4RA 5H1VA 4IOOA 4TT6A 5EICA 4PCEA 1ZKRA 4QSPA 5FG4A 5DYXA 3MXFA 5FE0A 5E0RA 4Q0OA 2N9GA 5C7NA 4CUQA 4WHWA 5II1A 5IGNA 5A5SA 2R0VA 5EV9A 4OUFA 4YABA 4PKLA 5C87A 2R0SA 2RO1A 5HQ5A 4QZSA 4OGIA 5LKXA 2FSAA 3JVKA 4TZ8A 4TQNA 4CURA 4IOQA 4LR6A 5D3SA 4LDFA 5A5NA 5FFWA 4A9IA 5HM0A 4J0RA 5L96A 4A9MA 2YDWA 4YYHA 5CQ4A 5C4QA 3TLPA 4YYDA 2YW5A 1WUGA 5A5OA 5EWWA 4UIXA 3AADA 5ENCA 4O75A 4QC1A 3U5KA 4AKIA 1JSPB 3VKGA 4O71A 5AD2A 4MR3A 5DKHA 5FDZA 5CUCA 3S92A 4NUCA 5F1LA 5FG5A 5CQ5A 4RVRA 5CQ8A 5EWVA 5KO4A 4NQNA 4AKNA 5CGPA 5ENIA 2DVSA 2OUOA 4IR6A 3I3JA 4O70A 5ENJA 2D9EA 3U5LA 5I83A 4NS5A 5EM3A 5CS8A 4UYFB 5IGMA 4QR5A 5I89A 2E7OA 5CTLA 4QEWA 4NR9A 4Y03A 3IU6A 2H60A 5HLSA 5DW2A 5D3JA 5EGUA 4XUAA 5LJ2A 5CU8A 5F5ZA 5DLXA 3LJWA 3O36A 4AI6A 5FE1A 5CRZA 3G0LA 5A5RA 5F63A 5HELA 4NYVA 5I88A 4CUTA 4Z1QA 5LKTA 4ZC9A 2RFJA 4O76A 4MR5A 5A85A 4BHWA 1WUMA 5EPBA 2NXBA 4Z93A 3O33A 5DBMA 3UVWA 5FE2A 5EK9A 3JVLA 3G0JA 4NRCA 3QZTA 3SVGA 1EQFA 4PY6A 5DKCA 5I7XA 4QSVA 3U5MA 4A9KA 4BW3A 5I80A 4BW4A 5C85A 4NR7A 5E9IA 5DYCA 4HXSA 2G4AA 4IR3A 5A5PA 5DX4A 2DKWA 3ZYUA 2GRCA 4QSWA 4NRBA 5I29A 5HFQA 3HMFA 5F3AA 4HXNA 4MEPA 4QSRA 5EPRA 5E73A 2E3KA 4WIVA 4QY4A 2I7KA 4MR4A 5FFYA 5A7CA 5AD3A 5ENFA 5JWMA 5K29A 5DLZA 4XY8A 3JVJA 3U5PA 2RNWA 5IIDA 4ALGA 4MENA 4NYXA 4QR4A 4TT2A 5LVRA 4O77A 5CQTA 5IG6A 4YBSA 4O7CA 2F6NA 5FH8A 4QB3A 4E96A 5E7DA 5EA1A 3UV4A 3UV2A 2D82A 4UYHA 5DYAA 4A9JA 4N4IA 4KV1A 5CZGA 4BW2A 5FE8A 5DFCA 3P1EA 4N3WA 5C89A 4TTEA 4NUDA 4YYJA 4PS5A 4TS8A 5AMEA 5FE5A 1F68A 4YADA 2RI7A 3MQMA 3U5NA 4CLBA 5FH6A 3D1BA 5IBNA 4C66A 5LVQA 3ONIA 5F61A 3MB4A 5HQ7A 4ZQLA 4Z6HA 5EISA 4YAXA 3UVXA 5CUGA 4QNSA 4KV4A 4YATA 5COIA 5HEMA 4YYKA 5BT5A 5BT4A 4QSUA 2OO1A 3HMHA 4YYNA 4MR6A 5CUAA 5FE4A 4NR8A 4QSTA 4IR5A 5F62A 5LKZA 4XYAA 5E9LA 4UIYA 4YH4A 4GPJA 4WHUA 5KHMA 5EVAA 5DFBA 2DVVA 2L5EA 2MJVB 3JVMA 3UW9A 4NYWA 2E7NA 5CQ6A 5E9YA 5ETBA 3P1CA 4X2IA 4O7EA 4A9OA 4A9HA 5IGLA 4LZRA 5CUBA 2YEKA 4QYDA 4HXRA 4FLPA 5KTUA 5EWHA 3U5OA 4QR3A 3O35A 4YYGA 3Q2FA 4LC2A 5HRVA 2YEMA 5L8TA 4TT4A 2DATA 2DWWA 4LYSA 4TYLA 2DVRA 5FE7A 3K2JA 3DWYA 4Q0NA 2RS9B 4NR6A 3LQJA 5I40A 4QUTA 3IU5A 3UVYA 4MEQA 5L8UA 5H1UA 5E9MA 2L84A 5AMFA 2KTBB 5D24A 4PCIA 1N72A 2RNXA 5E9KA 5ENBA 5J0DA 4O78A 2WP2A 5D3PA 3QZSA 3P1DA 5CRMA 4O7FA 5DKDA 3D1DA 5D3RA 4UYEA 5HENA 4O74A 5CQAA 4YY6A 4UIZA 4TU6A 4NR4A 4A9FA 3MUKA 4C67A 2WP1A 5A82A 4UYFA 4A9EA 4LYIA 5KTWA 3UVDA 4HBWA 5FH7A 4QSSA 5FE9A 4A9NA 4NR5A 5FG6A 5DYUA 5TCMA 4QSXA 5L97A 2RNYA 4TZ2A 1JM4B 4UIVA 5DY7A 3D7CA 5EWDA 5D7XA 5A83A 4UYDA 2YQDA 4F3IA 4CUPA 3LQHA 3NXBA 5A81A 1E6IA 4A9LA 2OSSA 3RCWA 5EWCA 5KTXA 3QZVA 3LXJA 5F2PA 3UV5A 5F60A 1ZS5A 5FE6A 4UITA 4J1PA 5F1HA 5H85A 2L85A 3ERRA 4BJXA 5CFWA 2I8NA 2YELA 4HBYA 4O72A 4HXKA 4YC9A 3HMEA 4N4GA 5EPSA 4KCXA 5FB1A 5CPEA 4IR4A 5D3NA 3S91A 4Z1SA 5LKUA 4AKHA 4N4FA 5IGKA 5EQ1A 5L98A 5FFVA 3AQAA 5L99A 4ZW1A 3O34A 5D25A 5DW1A 5CQ3A 4Z6IA 4CFLA 5HJCA 5CY9A 2F6JA 2YYNA 5D3TA 4CL9A 2DVQA 5EU1A 4UIUA 4LZSA 5CUEA 5LJ0A
chains in the Genus database with same CATH topology
5CUDA 5E74A 5HRWA 4QC3A 5TB6A 4YBTA 5ETDA 3MB3A 5HCLA 5D3HA 4HBVA 4HXPA 5HRXA 4YH3A 4N4HA 3SVHA 5FE3A 3DAIA 5BT3A 3SVFA 4XY9A 5E3GA 4MEOA 3GG3A 4QUUA 4YYMA 4LYWA 5ENEA 4TU4A 5I1QA 5I7YA 4NQMA 4QSQA 5ENGA 5LJ1A 5HQ6A 5FBXA 4YYIA 5HFRA 1X0JA 2R10A 4ALHA 5F36A 3MULA 5D26A 4DONA 5D3LA 4J3IA 4UYGA 2LSPB 5ENHA 3P1FA 5ACYA 4O7AA 5E9VA 4QEVA 4YY4A 4NRAA 5JI8A 3FKMX 4QYLA 4OGJA 5FB0A 4BW1A 5F25A 4J0SA 5A5QA 2R0YA 4HXLA 4LRGA 4O7BA 4YK0A 5E3DA 5CQ7A 5H1TA 4CUSA 4YBMA 4CFKA 4CUUA 3Q2EA 4QBMA 4HBXA 5I86A 5LUUA 4HXOA 4XUBA 5EP7A 4NUEA 5II2A 3U5JA 3P5OA 5KU3A 4QEUA 5CP5A 5C8GA 4HXMA 4PTBA 3O37A 5EI4A 4NXJA 5DFDA 4IORA 4LZ2A 4UIWA 5D0CA 3LQIA 5G4SA 5G4RA 5H1VA 4IOOA 4TT6A 5EICA 4PCEA 4QSPA 5FG4A 5DYXA 3MXFA 5FE0A 5E0RA 4Q0OA 2N9GA 5C7NA 4CUQA 4WHWA 5II1A 5IGNA 5A5SA 2R0VA 5EV9A 4OUFA 4YABA 4PKLA 5C87A 2R0SA 2RO1A 5HQ5A 4QZSA 4OGIA 5LKXA 2FSAA 3JVKA 4TZ8A 4TQNA 4CURA 4IOQA 4LR6A 5D3SA 4LDFA 5A5NA 5FFWA 4A9IA 5HM0A 4J0RA 5L96A 4A9MA 2YDWA 4YYHA 5CQ4A 5C4QA 3TLPA 4YYDA 2YW5A 1WUGA 5A5OA 5EWWA 4UIXA 3AADA 5ENCA 4O75A 4QC1A 3U5KA 1JSPB 4O71A 5AD2A 4MR3A 5DKHA 5FDZA 5CUCA 3S92A 4NUCA 5F1LA 5FG5A 5CQ5A 4RVRA 5CQ8A 5EWVA 5KO4A 4NQNA 4AKNA 5CGPA 5ENIA 2DVSA 2OUOA 4IR6A 3I3JA 4O70A 5ENJA 2D9EA 3U5LA 5I83A 4NS5A 5EM3A 5CS8A 4UYFB 5IGMA 4QR5A 5I89A 2E7OA 5CTLA 4QEWA 4NR9A 4Y03A 3IU6A 2H60A 5HLSA 5DW2A 5D3JA 5EGUA 4XUAA 5LJ2A 5CU8A 5F5ZA 5DLXA 3LJWA 3O36A 5FE1A 5CRZA 3G0LA 5A5RA 5F63A 5HELA 4NYVA 5I88A 4CUTA 4Z1QA 5LKTA 4ZC9A 2RFJA 4O76A 4MR5A 5A85A 4BHWA 1WUMA 5EPBA 2NXBA 4Z93A 3O33A 5DBMA 3UVWA 5FE2A 5EK9A 3JVLA 3G0JA 4NRCA 3QZTA 3SVGA 1EQFA 4PY6A 5DKCA 5I7XA 4QSVA 3U5MA 4A9KA 4BW3A 5I80A 4BW4A 5C85A 4NR7A 5E9IA 5DYCA 4HXSA 2G4AA 4IR3A 5A5PA 5DX4A 2DKWA 3ZYUA 2GRCA 4QSWA 4NRBA 5I29A 5HFQA 3HMFA 5F3AA 4HXNA 4MEPA 4QSRA 5EPRA 5E73A 2E3KA 4WIVA 4QY4A 2I7KA 4MR4A 5FFYA 5A7CA 5AD3A 5ENFA 5JWMA 5K29A 5DLZA 4XY8A 3JVJA 3U5PA 2RNWA 5IIDA 4ALGA 4MENA 4NYXA 4QR4A 4TT2A 5LVRA 4O77A 5CQTA 5IG6A 4YBSA 4O7CA 2F6NA 5FH8A 4QB3A 4E96A 5E7DA 5EA1A 3UV4A 3UV2A 2D82A 4UYHA 5DYAA 4A9JA 4N4IA 4KV1A 5CZGA 4BW2A 5FE8A 5DFCA 3P1EA 4N3WA 5C89A 4TTEA 4NUDA 4YYJA 4PS5A 4TS8A 5AMEA 5FE5A 1F68A 4YADA 2RI7A 3MQMA 3U5NA 4CLBA 5FH6A 5IBNA 4C66A 5LVQA 3ONIA 5F61A 3MB4A 5HQ7A 4ZQLA 4Z6HA 5EISA 4YAXA 3UVXA 5CUGA 4QNSA 4KV4A 4YATA 5COIA 5HEMA 4YYKA 5BT5A 5BT4A 4QSUA 2OO1A 3HMHA 4YYNA 4MR6A 5CUAA 5FE4A 4NR8A 4QSTA 4IR5A 5F62A 5LKZA 4XYAA 5E9LA 4UIYA 4YH4A 4GPJA 4WHUA 5KHMA 5EVAA 5DFBA 2DVVA 2L5EA 2MJVB 3JVMA 3UW9A 4NYWA 2E7NA 5CQ6A 5E9YA 5ETBA 3P1CA 4X2IA 4O7EA 4A9OA 4A9HA 5IGLA 4LZRA 5CUBA 2YEKA 4QYDA 4HXRA 4FLPA 5KTUA 5EWHA 3U5OA 4QR3A 3O35A 4YYGA 3Q2FA 4LC2A 5HRVA 2YEMA 5L8TA 4TT4A 2DATA 2DWWA 4LYSA 4TYLA 2DVRA 5FE7A 3K2JA 3DWYA 4Q0NA 2RS9B 4NR6A 3LQJA 5I40A 4QUTA 3IU5A 3UVYA 4MEQA 5L8UA 5H1UA 5E9MA 2L84A 5AMFA 2KTBB 5D24A 4PCIA 1N72A 2RNXA 5E9KA 5ENBA 5J0DA 4O78A 2WP2A 5D3PA 3QZSA 3P1DA 5CRMA 4O7FA 5DKDA 5D3RA 4UYEA 5HENA 4O74A 5CQAA 4YY6A 4UIZA 4TU6A 4NR4A 4A9FA 3MUKA 4C67A 2WP1A 5A82A 4UYFA 4A9EA 4LYIA 5KTWA 3UVDA 4HBWA 5FH7A 4QSSA 5FE9A 4A9NA 4NR5A 5FG6A 5DYUA 5TCMA 4QSXA 5L97A 2RNYA 4TZ2A 1JM4B 4UIVA 5DY7A 3D7CA 5EWDA 5D7XA 5A83A 4UYDA 2YQDA 4F3IA 4CUPA 3LQHA 3NXBA 5A81A 1E6IA 4A9LA 2OSSA 3RCWA 5EWCA 5KTXA 3QZVA 3LXJA 5F2PA 3UV5A 5F60A 1ZS5A 5FE6A 4UITA 4J1PA 5F1HA 5H85A 2L85A 4BJXA 5CFWA 2I8NA 2YELA 4HBYA 4O72A 4HXKA 4YC9A 3HMEA 4N4GA 5EPSA 4KCXA 5FB1A 5CPEA 4IR4A 5D3NA 3S91A 4Z1SA 5LKUA 4N4FA 5IGKA 5EQ1A 5L98A 5FFVA 3AQAA 5L99A 4ZW1A 3O34A 5D25A 5DW1A 5CQ3A 4Z6IA 4CFLA 5HJCA 5CY9A 2F6JA 2YYNA 5D3TA 4CL9A 2DVQA 5EU1A 4UIUA 4LZSA 5CUEA 5LJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUD A;  5E74 A;  5HRW A;  4QC3 A;  5TB6 A;  4YBT A;  5ETD A;  3MB3 A;  5HCL A;  5D3H A;  4HBV A;  4HXP A;  5HRX A;  4YH3 A;  4N4H A;  3SVH A;  5FE3 A;  3DAI A;  5BT3 A;  3SVF A;  4XY9 A;  5E3G A;  4MEO A;  3GG3 A;  4QUU A;  4YYM A;  4LYW A;  5ENE A;  4TU4 A;  5I1Q A;  5I7Y A;  4NQM A;  4QSQ A;  5ENG A;  5LJ1 A;  5HQ6 A;  5FBX A;  4YYI A;  5HFR A;  1X0J A;  2R10 A;  4ALH A;  5F36 A;  3MUL A;  5D26 A;  4DON A;  5D3L A;  4J3I A;  4UYG A;  2LSP B;  5ENH A;  3P1F A;  5ACY A;  4O7A A;  5E9V A;  4QEV A;  4YY4 A;  4NRA A;  5JI8 A;  3FKM X;  4QYL A;  4OGJ A;  5FB0 A;  4BW1 A;  5F25 A;  4J0S A;  5A5Q A;  2R0Y A;  4HXL A;  4LRG A;  4O7B A;  4YK0 A;  5E3D A;  5CQ7 A;  5H1T A;  4CUS A;  4YBM A;  4CFK A;  4CUU A;  3Q2E A;  4QBM A;  4HBX A;  5I86 A;  5LUU A;  4HXO A;  4XUB A;  5EP7 A;  4NUE A;  5II2 A;  3U5J A;  3P5O A;  5KU3 A;  4QEU A;  5CP5 A;  5C8G A;  4HXM A;  4PTB A;  3O37 A;  5EI4 A;  4NXJ A;  5DFD A;  4IOR A;  4LZ2 A;  4UIW A;  5D0C A;  3LQI A;  5G4S A;  5G4R A;  5H1V A;  4IOO A;  4TT6 A;  5EIC A;  4PCE A;  4QSP A;  5FG4 A;  5DYX A;  3MXF A;  5FE0 A;  5E0R A;  4Q0O A;  2N9G A;  5C7N A;  4CUQ A;  4WHW A;  5II1 A;  5IGN A;  5A5S A;  2R0V A;  5EV9 A;  4OUF A;  4YAB A;  4PKL A;  5C87 A;  2R0S A;  2RO1 A;  5HQ5 A;  4QZS A;  4OGI A;  5LKX A;  2FSA A;  3JVK A;  4TZ8 A;  4TQN A;  4CUR A;  4IOQ A;  4LR6 A;  5D3S A;  4LDF A;  5A5N A;  5FFW A;  4A9I A;  5HM0 A;  4J0R A;  5L96 A;  4A9M A;  2YDW A;  4YYH A;  5CQ4 A;  5C4Q A;  3TLP A;  4YYD A;  2YW5 A;  1WUG A;  5A5O A;  5EWW A;  4UIX A;  3AAD A;  5ENC A;  4O75 A;  4QC1 A;  3U5K A;  1JSP B;  4O71 A;  5AD2 A;  4MR3 A;  5DKH A;  5FDZ A;  5CUC A;  3S92 A;  4NUC A;  5F1L A;  5FG5 A;  5CQ5 A;  4RVR A;  5CQ8 A;  5EWV A;  5KO4 A;  4NQN A;  4AKN A;  5CGP A;  5ENI A;  2DVS A;  2OUO A;  4IR6 A;  3I3J A;  4O70 A;  5ENJ A;  2D9E A;  3U5L A;  5I83 A;  4NS5 A;  5EM3 A;  5CS8 A;  4UYF B;  5IGM A;  4QR5 A;  5I89 A;  2E7O A;  5CTL A;  4QEW A;  4NR9 A;  4Y03 A;  3IU6 A;  2H60 A;  5HLS A;  5DW2 A;  5D3J A;  5EGU A;  4XUA A;  5LJ2 A;  5CU8 A;  5F5Z A;  5DLX A;  3LJW A;  3O36 A;  5FE1 A;  5CRZ A;  3G0L A;  5A5R A;  5F63 A;  5HEL A;  4NYV A;  5I88 A;  4CUT A;  4Z1Q A;  5LKT A;  4ZC9 A;  2RFJ A;  4O76 A;  4MR5 A;  5A85 A;  4BHW A;  1WUM A;  5EPB A;  2NXB A;  4Z93 A;  3O33 A;  5DBM A;  3UVW A;  5FE2 A;  5EK9 A;  3JVL A;  3G0J A;  4NRC A;  3QZT A;  3SVG A;  1EQF A;  4PY6 A;  5DKC A;  5I7X A;  4QSV A;  3U5M A;  4A9K A;  4BW3 A;  5I80 A;  4BW4 A;  5C85 A;  4NR7 A;  5E9I A;  5DYC A;  4HXS A;  2G4A A;  4IR3 A;  5A5P A;  5DX4 A;  2DKW A;  3ZYU A;  2GRC A;  4QSW A;  4NRB A;  5I29 A;  5HFQ A;  3HMF A;  5F3A A;  4HXN A;  4MEP A;  4QSR A;  5EPR A;  5E73 A;  2E3K A;  4WIV A;  4QY4 A;  2I7K A;  4MR4 A;  5FFY A;  5A7C A;  5AD3 A;  5ENF A;  5JWM A;  5K29 A;  5DLZ A;  4XY8 A;  3JVJ A;  3U5P A;  2RNW A;  5IID A;  4ALG A;  4MEN A;  4NYX A;  4QR4 A;  4TT2 A;  5LVR A;  4O77 A;  5CQT A;  5IG6 A;  4YBS A;  4O7C A;  2F6N A;  5FH8 A;  4QB3 A;  4E96 A;  5E7D A;  5EA1 A;  3UV4 A;  3UV2 A;  2D82 A;  4UYH A;  5DYA A;  4A9J A;  4N4I A;  4KV1 A;  5CZG A;  4BW2 A;  5FE8 A;  5DFC A;  3P1E A;  4N3W A;  5C89 A;  4TTE A;  4NUD A;  4YYJ A;  4PS5 A;  4TS8 A;  5AME A;  5FE5 A;  1F68 A;  4YAD A;  2RI7 A;  3MQM A;  3U5N A;  4CLB A;  5FH6 A;  5IBN A;  4C66 A;  5LVQ A;  3ONI A;  5F61 A;  3MB4 A;  5HQ7 A;  4ZQL A;  4Z6H A;  5EIS A;  4YAX A;  3UVX A;  5CUG A;  4QNS A;  4KV4 A;  4YAT A;  5COI A;  5HEM A;  4YYK A;  5BT5 A;  5BT4 A;  4QSU A;  2OO1 A;  3HMH A;  4YYN A;  4MR6 A;  5CUA A;  5FE4 A;  4NR8 A;  4QST A;  4IR5 A;  5F62 A;  5LKZ A;  4XYA A;  5E9L A;  4UIY A;  4YH4 A;  4GPJ A;  4WHU A;  5KHM A;  5EVA A;  5DFB A;  2DVV A;  2L5E A;  2MJV B;  3JVM A;  3UW9 A;  4NYW A;  2E7N A;  5CQ6 A;  5E9Y A;  5ETB A;  3P1C A;  4X2I A;  4O7E A;  4A9O A;  4A9H A;  5IGL A;  4LZR A;  5CUB A;  2YEK A;  4QYD A;  4HXR A;  4FLP A;  5KTU A;  5EWH A;  3U5O A;  4QR3 A;  3O35 A;  4YYG A;  3Q2F A;  4LC2 A;  5HRV A;  2YEM A;  5L8T A;  4TT4 A;  2DAT A;  2DWW A;  4LYS A;  4TYL A;  2DVR A;  5FE7 A;  3K2J A;  3DWY A;  4Q0N A;  2RS9 B;  4NR6 A;  3LQJ A;  5I40 A;  4QUT A;  3IU5 A;  3UVY A;  4MEQ A;  5L8U A;  5H1U A;  5E9M A;  2L84 A;  5AMF A;  2KTB B;  5D24 A;  4PCI A;  1N72 A;  2RNX A;  5E9K A;  5ENB A;  5J0D A;  4O78 A;  2WP2 A;  5D3P A;  3QZS A;  3P1D A;  5CRM A;  4O7F A;  5DKD A;  5D3R A;  4UYE A;  5HEN A;  4O74 A;  5CQA A;  4YY6 A;  4UIZ A;  4TU6 A;  4NR4 A;  4A9F A;  3MUK A;  4C67 A;  2WP1 A;  5A82 A;  4UYF A;  4A9E A;  4LYI A;  5KTW A;  3UVD A;  4HBW A;  5FH7 A;  4QSS A;  5FE9 A;  4A9N A;  4NR5 A;  5FG6 A;  5DYU A;  5TCM A;  4QSX A;  5L97 A;  2RNY A;  4TZ2 A;  1JM4 B;  4UIV A;  5DY7 A;  3D7C A;  5EWD A;  5D7X A;  5A83 A;  4UYD A;  2YQD A;  4F3I A;  4CUP A;  3LQH A;  3NXB A;  5A81 A;  1E6I A;  4A9L A;  2OSS A;  3RCW A;  5EWC A;  5KTX A;  3QZV A;  3LXJ A;  5F2P A;  3UV5 A;  5F60 A;  1ZS5 A;  5FE6 A;  4UIT A;  4J1P A;  5F1H A;  5H85 A;  2L85 A;  4BJX A;  5CFW A;  2I8N A;  2YEL A;  4HBY A;  4O72 A;  4HXK A;  4YC9 A;  3HME A;  4N4G A;  5EPS A;  4KCX A;  5FB1 A;  5CPE A;  4IR4 A;  5D3N A;  3S91 A;  4Z1S A;  5LKU A;  4N4F A;  5IGK A;  5EQ1 A;  5L98 A;  5FFV A;  3AQA A;  5L99 A;  4ZW1 A;  3O34 A;  5D25 A;  5DW1 A;  5CQ3 A;  4Z6I A;  4CFL A;  5HJC A;  5CY9 A;  2F6J A;  2YYN A;  5D3T A;  4CL9 A;  2DVQ A;  5EU1 A;  4UIU A;  4LZS A;  5CUE A;  5LJ0 A; 
#chains in the Genus database with same CATH topology
 5CUD A;  5E74 A;  5HRW A;  4QC3 A;  5TB6 A;  4YBT A;  5ETD A;  3MB3 A;  5HCL A;  5D3H A;  4HBV A;  4HXP A;  5HRX A;  4YH3 A;  4N4H A;  3SVH A;  5FE3 A;  3DAI A;  5BT3 A;  3SVF A;  4XY9 A;  5E3G A;  4MEO A;  3GG3 A;  4QUU A;  4YYM A;  4LYW A;  5ENE A;  4TU4 A;  5I1Q A;  5I7Y A;  4NQM A;  4QSQ A;  5ENG A;  5LJ1 A;  5HQ6 A;  5FBX A;  4YYI A;  5HFR A;  1PUO A;  1X0J A;  2R10 A;  4ALH A;  5F36 A;  3MUL A;  5D26 A;  4DON A;  5D3L A;  4J3I A;  4UYG A;  2EJN A;  2LSP B;  5ENH A;  3P1F A;  5ACY A;  4O7A A;  5E9V A;  4QEV A;  4YY4 A;  4NRA A;  5JI8 A;  3FKM X;  4QYL A;  4OGJ A;  5FB0 A;  4BW1 A;  5F25 A;  4J0S A;  5A5Q A;  2R0Y A;  4HXL A;  4LRG A;  4O7B A;  4YK0 A;  5E3D A;  5CQ7 A;  5H1T A;  4CUS A;  4YBM A;  4CFK A;  4CUU A;  3Q2E A;  4QBM A;  4HBX A;  3VKH A;  5I86 A;  5LUU A;  4HXO A;  4XUB A;  5EP7 A;  4NUE A;  5II2 A;  3U5J A;  3P5O A;  5KU3 A;  4QEU A;  5CP5 A;  5C8G A;  4HXM A;  4PTB A;  3O37 A;  5EI4 A;  4NXJ A;  5DFD A;  4AKG A;  4IOR A;  4LZ2 A;  4UIW A;  5D0C A;  3LQI A;  5G4S A;  5G4R A;  5H1V A;  4IOO A;  4TT6 A;  5EIC A;  4PCE A;  1ZKR A;  4QSP A;  5FG4 A;  5DYX A;  3MXF A;  5FE0 A;  5E0R A;  4Q0O A;  2N9G A;  5C7N A;  4CUQ A;  4WHW A;  5II1 A;  5IGN A;  5A5S A;  2R0V A;  5EV9 A;  4OUF A;  4YAB A;  4PKL A;  5C87 A;  2R0S A;  2RO1 A;  5HQ5 A;  4QZS A;  4OGI A;  5LKX A;  2FSA A;  3JVK A;  4TZ8 A;  4TQN A;  4CUR A;  4IOQ A;  4LR6 A;  5D3S A;  4LDF A;  5A5N A;  5FFW A;  4A9I A;  5HM0 A;  4J0R A;  5L96 A;  4A9M A;  2YDW A;  4YYH A;  5CQ4 A;  5C4Q A;  3TLP A;  4YYD A;  2YW5 A;  1WUG A;  5A5O A;  5EWW A;  4UIX A;  3AAD A;  5ENC A;  4O75 A;  4QC1 A;  3U5K A;  4AKI A;  1JSP B;  3VKG A;  4O71 A;  5AD2 A;  4MR3 A;  5DKH A;  5FDZ A;  5CUC A;  3S92 A;  4NUC A;  5F1L A;  5FG5 A;  5CQ5 A;  4RVR A;  5CQ8 A;  5EWV A;  5KO4 A;  4NQN A;  4AKN A;  5CGP A;  5ENI A;  2DVS A;  2OUO A;  4IR6 A;  3I3J A;  4O70 A;  5ENJ A;  2D9E A;  3U5L A;  5I83 A;  4NS5 A;  5EM3 A;  5CS8 A;  4UYF B;  5IGM A;  4QR5 A;  5I89 A;  2E7O A;  5CTL A;  4QEW A;  4NR9 A;  4Y03 A;  3IU6 A;  2H60 A;  5HLS A;  5DW2 A;  5D3J A;  5EGU A;  4XUA A;  5LJ2 A;  5CU8 A;  5F5Z A;  5DLX A;  3LJW A;  3O36 A;  4AI6 A;  5FE1 A;  5CRZ A;  3G0L A;  5A5R A;  5F63 A;  5HEL A;  4NYV A;  5I88 A;  4CUT A;  4Z1Q A;  5LKT A;  4ZC9 A;  2RFJ A;  4O76 A;  4MR5 A;  5A85 A;  4BHW A;  1WUM A;  5EPB A;  2NXB A;  4Z93 A;  3O33 A;  5DBM A;  3UVW A;  5FE2 A;  5EK9 A;  3JVL A;  3G0J A;  4NRC A;  3QZT A;  3SVG A;  1EQF A;  4PY6 A;  5DKC A;  5I7X A;  4QSV A;  3U5M A;  4A9K A;  4BW3 A;  5I80 A;  4BW4 A;  5C85 A;  4NR7 A;  5E9I A;  5DYC A;  4HXS A;  2G4A A;  4IR3 A;  5A5P A;  5DX4 A;  2DKW A;  3ZYU A;  2GRC A;  4QSW A;  4NRB A;  5I29 A;  5HFQ A;  3HMF A;  5F3A A;  4HXN A;  4MEP A;  4QSR A;  5EPR A;  5E73 A;  2E3K A;  4WIV A;  4QY4 A;  2I7K A;  4MR4 A;  5FFY A;  5A7C A;  5AD3 A;  5ENF A;  5JWM A;  5K29 A;  5DLZ A;  4XY8 A;  3JVJ A;  3U5P A;  2RNW A;  5IID A;  4ALG A;  4MEN A;  4NYX A;  4QR4 A;  4TT2 A;  5LVR A;  4O77 A;  5CQT A;  5IG6 A;  4YBS A;  4O7C A;  2F6N A;  5FH8 A;  4QB3 A;  4E96 A;  5E7D A;  5EA1 A;  3UV4 A;  3UV2 A;  2D82 A;  4UYH A;  5DYA A;  4A9J A;  4N4I A;  4KV1 A;  5CZG A;  4BW2 A;  5FE8 A;  5DFC A;  3P1E A;  4N3W A;  5C89 A;  4TTE A;  4NUD A;  4YYJ A;  4PS5 A;  4TS8 A;  5AME A;  5FE5 A;  1F68 A;  4YAD A;  2RI7 A;  3MQM A;  3U5N A;  4CLB A;  5FH6 A;  3D1B A;  5IBN A;  4C66 A;  5LVQ A;  3ONI A;  5F61 A;  3MB4 A;  5HQ7 A;  4ZQL A;  4Z6H A;  5EIS A;  4YAX A;  3UVX A;  5CUG A;  4QNS A;  4KV4 A;  4YAT A;  5COI A;  5HEM A;  4YYK A;  5BT5 A;  5BT4 A;  4QSU A;  2OO1 A;  3HMH A;  4YYN A;  4MR6 A;  5CUA A;  5FE4 A;  4NR8 A;  4QST A;  4IR5 A;  5F62 A;  5LKZ A;  4XYA A;  5E9L A;  4UIY A;  4YH4 A;  4GPJ A;  4WHU A;  5KHM A;  5EVA A;  5DFB A;  2DVV A;  2L5E A;  2MJV B;  3JVM A;  3UW9 A;  4NYW A;  2E7N A;  5CQ6 A;  5E9Y A;  5ETB A;  3P1C A;  4X2I A;  4O7E A;  4A9O A;  4A9H A;  5IGL A;  4LZR A;  5CUB A;  2YEK A;  4QYD A;  4HXR A;  4FLP A;  5KTU A;  5EWH A;  3U5O A;  4QR3 A;  3O35 A;  4YYG A;  3Q2F A;  4LC2 A;  5HRV A;  2YEM A;  5L8T A;  4TT4 A;  2DAT A;  2DWW A;  4LYS A;  4TYL A;  2DVR A;  5FE7 A;  3K2J A;  3DWY A;  4Q0N A;  2RS9 B;  4NR6 A;  3LQJ A;  5I40 A;  4QUT A;  3IU5 A;  3UVY A;  4MEQ A;  5L8U A;  5H1U A;  5E9M A;  2L84 A;  5AMF A;  2KTB B;  5D24 A;  4PCI A;  1N72 A;  2RNX A;  5E9K A;  5ENB A;  5J0D A;  4O78 A;  2WP2 A;  5D3P A;  3QZS A;  3P1D A;  5CRM A;  4O7F A;  5DKD A;  3D1D A;  5D3R A;  4UYE A;  5HEN A;  4O74 A;  5CQA A;  4YY6 A;  4UIZ A;  4TU6 A;  4NR4 A;  4A9F A;  3MUK A;  4C67 A;  2WP1 A;  5A82 A;  4UYF A;  4A9E A;  4LYI A;  5KTW A;  3UVD A;  4HBW A;  5FH7 A;  4QSS A;  5FE9 A;  4A9N A;  4NR5 A;  5FG6 A;  5DYU A;  5TCM A;  4QSX A;  5L97 A;  2RNY A;  4TZ2 A;  1JM4 B;  4UIV A;  5DY7 A;  3D7C A;  5EWD A;  5D7X A;  5A83 A;  4UYD A;  2YQD A;  4F3I A;  4CUP A;  3LQH A;  3NXB A;  5A81 A;  1E6I A;  4A9L A;  2OSS A;  3RCW A;  5EWC A;  5KTX A;  3QZV A;  3LXJ A;  5F2P A;  3UV5 A;  5F60 A;  1ZS5 A;  5FE6 A;  4UIT A;  4J1P A;  5F1H A;  5H85 A;  2L85 A;  3ERR A;  4BJX A;  5CFW A;  2I8N A;  2YEL A;  4HBY A;  4O72 A;  4HXK A;  4YC9 A;  3HME A;  4N4G A;  5EPS A;  4KCX A;  5FB1 A;  5CPE A;  4IR4 A;  5D3N A;  3S91 A;  4Z1S A;  5LKU A;  4AKH A;  4N4F A;  5IGK A;  5EQ1 A;  5L98 A;  5FFV A;  3AQA A;  5L99 A;  4ZW1 A;  3O34 A;  5D25 A;  5DW1 A;  5CQ3 A;  4Z6I A;  4CFL A;  5HJC A;  5CY9 A;  2F6J A;  2YYN A;  5D3T A;  4CL9 A;  2DVQ A;  5EU1 A;  4UIU A;  4LZS A;  5CUE A;  5LJ0 A; 
#chains in the Genus database with same CATH homology
 5CUD A;  5E74 A;  5HRW A;  4QC3 A;  5TB6 A;  4YBT A;  5ETD A;  3MB3 A;  5HCL A;  5D3H A;  4HBV A;  4HXP A;  5HRX A;  4YH3 A;  4N4H A;  3SVH A;  5FE3 A;  3DAI A;  5BT3 A;  3SVF A;  4XY9 A;  5E3G A;  4MEO A;  3GG3 A;  4QUU A;  4YYM A;  4LYW A;  5ENE A;  4TU4 A;  5I1Q A;  5I7Y A;  4NQM A;  4QSQ A;  5ENG A;  5LJ1 A;  5HQ6 A;  5FBX A;  4YYI A;  5HFR A;  1X0J A;  2R10 A;  4ALH A;  5F36 A;  3MUL A;  5D26 A;  4DON A;  5D3L A;  4J3I A;  4UYG A;  2LSP B;  5ENH A;  3P1F A;  5ACY A;  4O7A A;  5E9V A;  4QEV A;  4YY4 A;  4NRA A;  5JI8 A;  3FKM X;  4QYL A;  4OGJ A;  5FB0 A;  4BW1 A;  5F25 A;  4J0S A;  5A5Q A;  2R0Y A;  4HXL A;  4LRG A;  4O7B A;  4YK0 A;  5E3D A;  5CQ7 A;  5H1T A;  4CUS A;  4YBM A;  4CFK A;  4CUU A;  3Q2E A;  4QBM A;  4HBX A;  5I86 A;  5LUU A;  4HXO A;  4XUB A;  5EP7 A;  4NUE A;  5II2 A;  3U5J A;  3P5O A;  5KU3 A;  4QEU A;  5CP5 A;  5C8G A;  4HXM A;  4PTB A;  3O37 A;  5EI4 A;  4NXJ A;  5DFD A;  4IOR A;  4LZ2 A;  4UIW A;  5D0C A;  3LQI A;  5G4S A;  5G4R A;  5H1V A;  4IOO A;  4TT6 A;  5EIC A;  4PCE A;  4QSP A;  5FG4 A;  5DYX A;  3MXF A;  5FE0 A;  5E0R A;  4Q0O A;  2N9G A;  5C7N A;  4CUQ A;  4WHW A;  5II1 A;  5IGN A;  5A5S A;  2R0V A;  5EV9 A;  4OUF A;  4YAB A;  4PKL A;  5C87 A;  2R0S A;  2RO1 A;  5HQ5 A;  4QZS A;  4OGI A;  5LKX A;  2FSA A;  3JVK A;  4TZ8 A;  4TQN A;  4CUR A;  4IOQ A;  4LR6 A;  5D3S A;  4LDF A;  5A5N A;  5FFW A;  4A9I A;  5HM0 A;  4J0R A;  5L96 A;  4A9M A;  2YDW A;  4YYH A;  5CQ4 A;  5C4Q A;  3TLP A;  4YYD A;  2YW5 A;  1WUG A;  5A5O A;  5EWW A;  4UIX A;  3AAD A;  5ENC A;  4O75 A;  4QC1 A;  3U5K A;  1JSP B;  4O71 A;  5AD2 A;  4MR3 A;  5DKH A;  5FDZ A;  5CUC A;  3S92 A;  4NUC A;  5F1L A;  5FG5 A;  5CQ5 A;  4RVR A;  5CQ8 A;  5EWV A;  5KO4 A;  4NQN A;  4AKN A;  5CGP A;  5ENI A;  2DVS A;  2OUO A;  4IR6 A;  3I3J A;  4O70 A;  5ENJ A;  2D9E A;  3U5L A;  5I83 A;  4NS5 A;  5EM3 A;  5CS8 A;  4UYF B;  5IGM A;  4QR5 A;  5I89 A;  2E7O A;  5CTL A;  4QEW A;  4NR9 A;  4Y03 A;  3IU6 A;  2H60 A;  5HLS A;  5DW2 A;  5D3J A;  5EGU A;  4XUA A;  5LJ2 A;  5CU8 A;  5F5Z A;  5DLX A;  3LJW A;  3O36 A;  5FE1 A;  5CRZ A;  3G0L A;  5A5R A;  5F63 A;  5HEL A;  4NYV A;  5I88 A;  4CUT A;  4Z1Q A;  5LKT A;  4ZC9 A;  2RFJ A;  4O76 A;  4MR5 A;  5A85 A;  4BHW A;  1WUM A;  5EPB A;  2NXB A;  4Z93 A;  3O33 A;  5DBM A;  3UVW A;  5FE2 A;  5EK9 A;  3JVL A;  3G0J A;  4NRC A;  3QZT A;  3SVG A;  1EQF A;  4PY6 A;  5DKC A;  5I7X A;  4QSV A;  3U5M A;  4A9K A;  4BW3 A;  5I80 A;  4BW4 A;  5C85 A;  4NR7 A;  5E9I A;  5DYC A;  4HXS A;  2G4A A;  4IR3 A;  5A5P A;  5DX4 A;  2DKW A;  3ZYU A;  2GRC A;  4QSW A;  4NRB A;  5I29 A;  5HFQ A;  3HMF A;  5F3A A;  4HXN A;  4MEP A;  4QSR A;  5EPR A;  5E73 A;  2E3K A;  4WIV A;  4QY4 A;  2I7K A;  4MR4 A;  5FFY A;  5A7C A;  5AD3 A;  5ENF A;  5JWM A;  5K29 A;  5DLZ A;  4XY8 A;  3JVJ A;  3U5P A;  2RNW A;  5IID A;  4ALG A;  4MEN A;  4NYX A;  4QR4 A;  4TT2 A;  5LVR A;  4O77 A;  5CQT A;  5IG6 A;  4YBS A;  4O7C A;  2F6N A;  5FH8 A;  4QB3 A;  4E96 A;  5E7D A;  5EA1 A;  3UV4 A;  3UV2 A;  2D82 A;  4UYH A;  5DYA A;  4A9J A;  4N4I A;  4KV1 A;  5CZG A;  4BW2 A;  5FE8 A;  5DFC A;  3P1E A;  4N3W A;  5C89 A;  4TTE A;  4NUD A;  4YYJ A;  4PS5 A;  4TS8 A;  5AME A;  5FE5 A;  1F68 A;  4YAD A;  2RI7 A;  3MQM A;  3U5N A;  4CLB A;  5FH6 A;  5IBN A;  4C66 A;  5LVQ A;  3ONI A;  5F61 A;  3MB4 A;  5HQ7 A;  4ZQL A;  4Z6H A;  5EIS A;  4YAX A;  3UVX A;  5CUG A;  4QNS A;  4KV4 A;  4YAT A;  5COI A;  5HEM A;  4YYK A;  5BT5 A;  5BT4 A;  4QSU A;  2OO1 A;  3HMH A;  4YYN A;  4MR6 A;  5CUA A;  5FE4 A;  4NR8 A;  4QST A;  4IR5 A;  5F62 A;  5LKZ A;  4XYA A;  5E9L A;  4UIY A;  4YH4 A;  4GPJ A;  4WHU A;  5KHM A;  5EVA A;  5DFB A;  2DVV A;  2L5E A;  2MJV B;  3JVM A;  3UW9 A;  4NYW A;  2E7N A;  5CQ6 A;  5E9Y A;  5ETB A;  3P1C A;  4X2I A;  4O7E A;  4A9O A;  4A9H A;  5IGL A;  4LZR A;  5CUB A;  2YEK A;  4QYD A;  4HXR A;  4FLP A;  5KTU A;  5EWH A;  3U5O A;  4QR3 A;  3O35 A;  4YYG A;  3Q2F A;  4LC2 A;  5HRV A;  2YEM A;  5L8T A;  4TT4 A;  2DAT A;  2DWW A;  4LYS A;  4TYL A;  2DVR A;  5FE7 A;  3K2J A;  3DWY A;  4Q0N A;  2RS9 B;  4NR6 A;  3LQJ A;  5I40 A;  4QUT A;  3IU5 A;  3UVY A;  4MEQ A;  5L8U A;  5H1U A;  5E9M A;  2L84 A;  5AMF A;  2KTB B;  5D24 A;  4PCI A;  1N72 A;  2RNX A;  5E9K A;  5ENB A;  5J0D A;  4O78 A;  2WP2 A;  5D3P A;  3QZS A;  3P1D A;  5CRM A;  4O7F A;  5DKD A;  5D3R A;  4UYE A;  5HEN A;  4O74 A;  5CQA A;  4YY6 A;  4UIZ A;  4TU6 A;  4NR4 A;  4A9F A;  3MUK A;  4C67 A;  2WP1 A;  5A82 A;  4UYF A;  4A9E A;  4LYI A;  5KTW A;  3UVD A;  4HBW A;  5FH7 A;  4QSS A;  5FE9 A;  4A9N A;  4NR5 A;  5FG6 A;  5DYU A;  5TCM A;  4QSX A;  5L97 A;  2RNY A;  4TZ2 A;  1JM4 B;  4UIV A;  5DY7 A;  3D7C A;  5EWD A;  5D7X A;  5A83 A;  4UYD A;  2YQD A;  4F3I A;  4CUP A;  3LQH A;  3NXB A;  5A81 A;  1E6I A;  4A9L A;  2OSS A;  3RCW A;  5EWC A;  5KTX A;  3QZV A;  3LXJ A;  5F2P A;  3UV5 A;  5F60 A;  1ZS5 A;  5FE6 A;  4UIT A;  4J1P A;  5F1H A;  5H85 A;  2L85 A;  4BJX A;  5CFW A;  2I8N A;  2YEL A;  4HBY A;  4O72 A;  4HXK A;  4YC9 A;  3HME A;  4N4G A;  5EPS A;  4KCX A;  5FB1 A;  5CPE A;  4IR4 A;  5D3N A;  3S91 A;  4Z1S A;  5LKU A;  4N4F A;  5IGK A;  5EQ1 A;  5L98 A;  5FFV A;  3AQA A;  5L99 A;  4ZW1 A;  3O34 A;  5D25 A;  5DW1 A;  5CQ3 A;  4Z6I A;  4CFL A;  5HJC A;  5CY9 A;  2F6J A;  2YYN A;  5D3T A;  4CL9 A;  2DVQ A;  5EU1 A;  4UIU A;  4LZS A;  5CUE A;  5LJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...