5A5QA

Crystal structure of human atad2 bromodomain in complex with 3-methyl- 8-piperidin-4-ylamino-1,2-dihydro-1,7-naphthyridin-2-one hydrochloride
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
molecule tags Hydrolase
source organism Homo sapiens
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5qA00
3U5JA 4LZSA 5I80A 4BW4A 4Z93A 2OSSA 4QEWA 3D7CA 5A5PA 5LVQA 4MEOA 3UVWA 4A9LA 3U5OA 4O7EA 5AD3A 5AMFA 2DVSA 5HFRA 5E0RA 5EV9A 4YYGA 4HBXA 3MB4A 3ZYUA 5LJ1A 4YH4A 5D3HA 4MEPA 4PKLA 4ZW1A 5F61A 2GRCA 5HRWA 5EWCA 3O35A 5FB1A 4YYJA 4TZ8A 5DW2A 5F60A 5KO4A 5E9VA 5FBXA 5FE1A 3MQMA 5I89A 5ENHA 2RNXA 1WUMA 5ACYA 4MR4A 3SVFA 3U5NA 3S91A 5BT5A 4QY4A 3UVDA 4WHUA 4YYIA 5E9MA 4C67A 4YY4A 5LVRA 5CUBA 4QSPA 5F36A 5IG6A 4F3IA 4MR6A 4CUTA 3O36A 4HBWA 5DY7A 5CZGA 2R0VA 4IOOA 5LKXA 4LYIA 5F5ZA 4A9OA 2N9GA 5CQ6A 5CQ5A 4UYGA 5HENA 4NR7A 4O74A 4TTEA 5EP7A 3K2JA 4QYLA 2YEKA 4X2IA 5H85A 4HBYA 5D3LA 5KTUA 4Q0NA 4TT2A 4IR4A 2YEMA 4YYHA 3P1DA 2R0SA 5IBNA 4GPJA 5A85A 3UVXA 3UV4A 4NRCA 5BT4A 5D3JA 3DAIA 2YELA 5F1HA 5JWMA 5LUUA 5CUEA 5HQ6A 4A9FA 5HFQA 5HEMA 3QZSA 2E7OA 4QSUA 4Q0OA 4YBMA 4LZRA 2I7KA 4O78A 2YDWA 5FE9A 5E3GA 5FE0A 3HMFA 5EWDA 5DKHA 3NXBA 4PY6A 5A83A 5DX4A 5HRVA 3P1CA 5F3AA 3U5LA 5HJCA 1ZS5A 2NXBA 4PS5A 5FH8A 3SVGA 4O7AA 2H60A 5EISA 5FE6A 3S92A 3UV5A 2YQDA 5TB6A 3LJWA 4NXJA 4O71A 5KU3A 5EPSA 5I1QA 5L99A 5CUCA 2DKWA 3JVKA 4N4GA 5E74A 5C7NA 5CQTA 4Z6IA 4QSWA 3P1FA 4NYWA 3U5PA 4QEVA 5EWVA 5DYAA 5CPEA 4CL9A 5EI4A 4CFLA 2L5EA 4QC1A 4XUBA 5CP5A 5DFDA 2WP2A 4UYEA 5E9LA 5L97A 4NR4A 5FH6A 5J0DA 4O7BA 5A7CA 1N72A 4O77A 4YBSA 5L98A 4NRBA 4YYNA 3G0LA 4J0RA 5CQAA 5IGKA 5H1VA 2RNYA 4J1PA 5LJ2A 5II2A 3Q2EA 2KTBB 4KCXA 5A5SA 5HQ5A 4N4HA 4Z1QA 2FSAA 4PTBA 4NYXA 4A9MA 5A82A 5DYCA 5EU1A 5F25A 5KHMA 5FE2A 5G4SA 3AQAA 4NQNA 4HXPA 5LKUA 4CUSA 3U5MA 5AD2A 3SVHA 4HXSA 4YYMA 1E6IA 4QZSA 4O75A 4IR5A 5D3TA 4ALHA 3G0JA 5DFBA 1F68A 2LSPB 4O7FA 4NR6A 5F2PA 5FG5A 4NS5A 2DVRA 5FE3A 4NQMA 4O7CA 4QSXA 4LR6A 5C89A 5CTLA 4CFKA 4NUCA 2L84A 2E3KA 5DBMA 4IR6A 4IR3A 3DWYA 5HM0A 5E73A 4NRAA 4J3IA 5F63A 4A9NA 3JVLA 4NYVA 5A5RA 5I83A 4NUDA 3HMEA 3QZVA 5C4QA 4QUTA 5ENBA 4UIVA 5CQ4A 5CRZA 2RFJA 5EGUA 5CS8A 4QR3A 4QUUA 4ZC9A 5A81A 4MR3A 3LQJA 4J0SA 4PCIA 5CGPA 4TYLA 2DVVA 3MXFA 5D26A 4TT6A 2D82A 4HXKA 5FFYA 5EWHA 5F1LA 5EVAA 5IGMA 4ALGA 5EICA 4WHWA 5ENGA 3LQIA 1EQFA 4TU4A 1WUGA 2YW5A 3P5OA 2RNWA 4WIVA 5C8GA 5L96A 4A9IA 4MR5A 3O37A 5E9IA 2E7NA 5ENCA 5G4RA 4LYSA 5A5QA 4XYAA 5HELA 5DYUA 4BHWA 5E9YA 5FH7A 4C66A 4BJXA 5A5OA 4Z6HA 5CQ3A 4MEQA 4UYDA 4A9HA 3IU5A 2D9EA 5CU8A 2DVQA 5D24A 5EM3A 4LRGA 4KV4A 4QSTA 4N4FA 4KV1A 4BW1A 4A9JA 4IORA 4HBVA 4OGJA 3HMHA 4DONA 5COIA 3UVYA 4AKNA 4RVRA 3JVMA 5FG6A 5IGLA 4UYHA 4NR9A 4LYWA 5HQ7A 4A9EA 4CLBA 4QSQA 4YAXA 2RI7A 3JVJA 4HXRA 4NUEA 5LKZA 3U5KA 5DYXA 5L8TA 2OUOA 2YYNA 2DWWA 5HRXA 5C85A 4HXNA 5FFVA 3O34A 5L8UA 5H1UA 3LXJA 3FKMX 2WP1A 3MULA 5I29A 5KTWA 4UYFA 5EA1A 5DLZA 5CQ8A 1JM4B 3IU6A 2L85A 3P1EA 4ZQLA 3QZTA 3ONIA 4YY6A 5FE4A 5ENJA 5I88A 5FB0A 4UITA 5FFWA 5I7XA 5D25A 4QSRA 5CQ7A 3MB3A 5A5NA 2DATA 3AADA 2R0YA 4QBMA 4O72A 4XY9A 5II1A 5DKDA 2G4AA 5ETDA 4BW3A 5EK9A 5JI8A 4QB3A 3LQHA 4TS8A 3TLPA 4PCEA 5H1TA 4QSVA 5D3PA 4UIUA 5FG4A 4Z1SA 3UW9A 5DW1A 4YC9A 5D3RA 5AMEA 1JSPB 4QSSA 5I7YA 5TCMA 3RCWA 4BW2A 5E7DA 2R10A 3UV2A 5CUDA 2F6NA 4OGIA 3Q2FA 4CURA 5CFWA 5IGNA 4CUPA 4XUAA 5EPRA 2F6JA 5CUAA 2I8NA 3GG3A 4HXLA 4UYFB 5DLXA 5EPBA 4QR5A 5LKTA 5CUGA 5FDZA 4UIXA 4YH3A 5K29A 4QC3A 5DFCA 5BT3A 5I40A 2OO1A 4Y03A 1X0JA 4N3WA 4YYKA 5I86A 5D3SA 5FE8A 3MUKA 4YBTA 5C87A 4TQNA 5D7XA 4LDFA 5LJ0A 5EQ1A 4QR4A 4LC2A 2RO1A 5DKCA 4E96A 5ENFA 4MENA 4UIYA 2MJVB 4YATA 5FE7A 5E3DA 4CUQA 3O33A 4YYDA 5HCLA 4HXOA 4A9KA 4QYDA 4UIZA 4NR5A 4QEUA 5CY9A 5IIDA 5ENIA 5EWWA 3I3JA 4N4IA 4TT4A 5ETBA 5FE5A 4UIWA 4YABA 4LZ2A 4TZ2A 5D3NA 5CRMA 5KTXA 5E9KA 4IOQA 4YADA 4YK0A 4HXMA 5D0CA 4FLPA 4O70A 4O76A 4QNSA 2RS9B 5F62A 4OUFA 4XY8A 4NR8A 5HLSA 4CUUA 4TU6A 5ENEA
chains in the Genus database with same CATH superfamily
3U5JA 4LZSA 5I80A 4BW4A 4Z93A 2OSSA 4QEWA 3D7CA 5A5PA 5LVQA 4MEOA 3UVWA 4A9LA 3U5OA 4O7EA 5AD3A 5AMFA 2DVSA 5HFRA 5E0RA 5EV9A 4YYGA 4HBXA 3MB4A 3ZYUA 5LJ1A 4YH4A 5D3HA 4MEPA 4PKLA 4ZW1A 5F61A 2GRCA 5HRWA 5EWCA 3O35A 5FB1A 4YYJA 4TZ8A 5DW2A 5F60A 5KO4A 5E9VA 5FBXA 5FE1A 3MQMA 5I89A 5ENHA 2RNXA 1WUMA 5ACYA 4MR4A 3SVFA 3U5NA 3S91A 5BT5A 4QY4A 3UVDA 4WHUA 4YYIA 5E9MA 4C67A 4YY4A 5LVRA 5CUBA 4QSPA 5F36A 5IG6A 4F3IA 4MR6A 4CUTA 3O36A 4HBWA 5DY7A 5CZGA 2R0VA 4IOOA 5LKXA 4LYIA 5F5ZA 4A9OA 2N9GA 5CQ6A 5CQ5A 4UYGA 5HENA 4NR7A 4O74A 4TTEA 5EP7A 3K2JA 4QYLA 2YEKA 4X2IA 5H85A 4HBYA 5D3LA 5KTUA 4Q0NA 4TT2A 4IR4A 2YEMA 4YYHA 3P1DA 2R0SA 5IBNA 4GPJA 5A85A 4AKGA 3UVXA 3UV4A 4NRCA 5BT4A 5D3JA 3DAIA 2YELA 5F1HA 5JWMA 5LUUA 5CUEA 5HQ6A 4A9FA 5HFQA 5HEMA 3QZSA 2E7OA 4QSUA 4Q0OA 4YBMA 4LZRA 2I7KA 4O78A 2YDWA 5FE9A 5E3GA 5FE0A 3HMFA 5EWDA 5DKHA 3NXBA 4PY6A 5A83A 5DX4A 5HRVA 3P1CA 5F3AA 3U5LA 5HJCA 1ZS5A 2NXBA 4PS5A 5FH8A 3SVGA 4O7AA 2H60A 5EISA 5FE6A 3S92A 3UV5A 2YQDA 5TB6A 3LJWA 4NXJA 4O71A 5KU3A 5EPSA 4AKHA 5I1QA 5L99A 5CUCA 2DKWA 3JVKA 4N4GA 5E74A 5C7NA 5CQTA 4Z6IA 4QSWA 3P1FA 4NYWA 3U5PA 4QEVA 5EWVA 5DYAA 5CPEA 4CL9A 5EI4A 4CFLA 2L5EA 4QC1A 4XUBA 5CP5A 5DFDA 2WP2A 4UYEA 5E9LA 5L97A 4NR4A 5FH6A 5J0DA 4O7BA 5A7CA 1N72A 4O77A 4YBSA 5L98A 4NRBA 4YYNA 3G0LA 4J0RA 5CQAA 5IGKA 5H1VA 2RNYA 4J1PA 5LJ2A 5II2A 3Q2EA 2KTBB 4KCXA 3VKHA 5A5SA 5HQ5A 4N4HA 3VKGA 4Z1QA 2FSAA 4PTBA 4NYXA 4A9MA 5A82A 5DYCA 5EU1A 5F25A 5KHMA 5FE2A 5G4SA 3AQAA 4NQNA 3D1BA 4HXPA 5LKUA 4CUSA 3U5MA 5AD2A 3SVHA 4HXSA 4YYMA 1E6IA 4QZSA 4O75A 4IR5A 5D3TA 4ALHA 3G0JA 5DFBA 1F68A 2LSPB 4O7FA 4NR6A 5F2PA 5FG5A 2EJNA 4NS5A 2DVRA 5FE3A 4NQMA 4O7CA 4QSXA 4LR6A 5C89A 5CTLA 4CFKA 4NUCA 2L84A 2E3KA 5DBMA 4IR6A 4IR3A 3DWYA 5HM0A 5E73A 4NRAA 4J3IA 5F63A 4A9NA 3JVLA 4NYVA 5A5RA 5I83A 4NUDA 3HMEA 3QZVA 5C4QA 4QUTA 5ENBA 4UIVA 5CQ4A 5CRZA 2RFJA 5EGUA 5CS8A 4QR3A 4QUUA 4ZC9A 5A81A 4AKIA 4MR3A 3LQJA 4J0SA 4PCIA 5CGPA 4TYLA 2DVVA 3MXFA 5D26A 4TT6A 2D82A 4HXKA 5FFYA 5EWHA 5F1LA 5EVAA 5IGMA 4ALGA 5EICA 4WHWA 5ENGA 3LQIA 1EQFA 4TU4A 1WUGA 2YW5A 3P5OA 2RNWA 4WIVA 5C8GA 5L96A 4A9IA 4MR5A 3O37A 5E9IA 2E7NA 5ENCA 5G4RA 4LYSA 5A5QA 4XYAA 5HELA 5DYUA 4BHWA 5E9YA 5FH7A 4C66A 4BJXA 5A5OA 4Z6HA 5CQ3A 4MEQA 4UYDA 4A9HA 3IU5A 2D9EA 5CU8A 2DVQA 5D24A 5EM3A 4LRGA 4KV4A 4QSTA 4N4FA 1ZKRA 4KV1A 4BW1A 4A9JA 4IORA 4HBVA 4OGJA 4AI6A 3HMHA 4DONA 5COIA 3UVYA 4AKNA 4RVRA 3JVMA 5FG6A 5IGLA 4UYHA 4NR9A 4LYWA 5HQ7A 4A9EA 4CLBA 4QSQA 4YAXA 2RI7A 3JVJA 4HXRA 4NUEA 5LKZA 3U5KA 5DYXA 5L8TA 2OUOA 2YYNA 2DWWA 5HRXA 5C85A 4HXNA 5FFVA 3O34A 5L8UA 5H1UA 3LXJA 3FKMX 2WP1A 3MULA 5I29A 5KTWA 4UYFA 5EA1A 5DLZA 5CQ8A 1JM4B 3IU6A 2L85A 3P1EA 4ZQLA 3QZTA 3ONIA 4YY6A 5FE4A 5ENJA 5I88A 5FB0A 4UITA 5FFWA 5I7XA 5D25A 4QSRA 5CQ7A 3MB3A 5A5NA 2DATA 3AADA 2R0YA 4QBMA 4O72A 4XY9A 5II1A 5DKDA 2G4AA 5ETDA 4BW3A 5EK9A 5JI8A 4QB3A 3LQHA 4TS8A 3TLPA 4PCEA 5H1TA 4QSVA 5D3PA 4UIUA 5FG4A 4Z1SA 3UW9A 5DW1A 3D1DA 4YC9A 5D3RA 5AMEA 1JSPB 4QSSA 5I7YA 5TCMA 3RCWA 4BW2A 5E7DA 2R10A 3UV2A 5CUDA 2F6NA 4OGIA 3Q2FA 4CURA 5CFWA 5IGNA 4CUPA 4XUAA 5EPRA 2F6JA 5CUAA 2I8NA 3GG3A 4HXLA 4UYFB 5DLXA 5EPBA 4QR5A 5LKTA 5CUGA 5FDZA 4UIXA 4YH3A 5K29A 4QC3A 5DFCA 5BT3A 5I40A 2OO1A 4Y03A 1X0JA 4N3WA 4YYKA 5I86A 5D3SA 5FE8A 3MUKA 4YBTA 5C87A 4TQNA 5D7XA 4LDFA 5LJ0A 5EQ1A 4QR4A 4LC2A 2RO1A 5DKCA 4E96A 3ERRA 5ENFA 4MENA 4UIYA 2MJVB 4YATA 5FE7A 5E3DA 4CUQA 3O33A 4YYDA 5HCLA 4HXOA 4A9KA 4QYDA 4UIZA 4NR5A 4QEUA 5CY9A 5IIDA 5ENIA 5EWWA 3I3JA 4N4IA 4TT4A 5ETBA 5FE5A 4UIWA 4YABA 4LZ2A 4TZ2A 5D3NA 5CRMA 5KTXA 5E9KA 4IOQA 4YADA 4YK0A 4HXMA 5D0CA 4FLPA 4O70A 4O76A 4QNSA 2RS9B 5F62A 1PUOA 4OUFA 4XY8A 4NR8A 5HLSA 4CUUA 4TU6A 5ENEA
chains in the Genus database with same CATH topology
3U5JA 4LZSA 5I80A 4BW4A 4Z93A 2OSSA 4QEWA 3D7CA 5A5PA 5LVQA 4MEOA 3UVWA 4A9LA 3U5OA 4O7EA 5AD3A 5AMFA 2DVSA 5HFRA 5E0RA 5EV9A 4YYGA 4HBXA 3MB4A 3ZYUA 5LJ1A 4YH4A 5D3HA 4MEPA 4PKLA 4ZW1A 5F61A 2GRCA 5HRWA 5EWCA 3O35A 5FB1A 4YYJA 4TZ8A 5DW2A 5F60A 5KO4A 5E9VA 5FBXA 5FE1A 3MQMA 5I89A 5ENHA 2RNXA 1WUMA 5ACYA 4MR4A 3SVFA 3U5NA 3S91A 5BT5A 4QY4A 3UVDA 4WHUA 4YYIA 5E9MA 4C67A 4YY4A 5LVRA 5CUBA 4QSPA 5F36A 5IG6A 4F3IA 4MR6A 4CUTA 3O36A 4HBWA 5DY7A 5CZGA 2R0VA 4IOOA 5LKXA 4LYIA 5F5ZA 4A9OA 2N9GA 5CQ6A 5CQ5A 4UYGA 5HENA 4NR7A 4O74A 4TTEA 5EP7A 3K2JA 4QYLA 2YEKA 4X2IA 5H85A 4HBYA 5D3LA 5KTUA 4Q0NA 4TT2A 4IR4A 2YEMA 4YYHA 3P1DA 2R0SA 5IBNA 4GPJA 5A85A 3UVXA 3UV4A 4NRCA 5BT4A 5D3JA 3DAIA 2YELA 5F1HA 5JWMA 5LUUA 5CUEA 5HQ6A 4A9FA 5HFQA 5HEMA 3QZSA 2E7OA 4QSUA 4Q0OA 4YBMA 4LZRA 2I7KA 4O78A 2YDWA 5FE9A 5E3GA 5FE0A 3HMFA 5EWDA 5DKHA 3NXBA 4PY6A 5A83A 5DX4A 5HRVA 3P1CA 5F3AA 3U5LA 5HJCA 1ZS5A 2NXBA 4PS5A 5FH8A 3SVGA 4O7AA 2H60A 5EISA 5FE6A 3S92A 3UV5A 2YQDA 5TB6A 3LJWA 4NXJA 4O71A 5KU3A 5EPSA 5I1QA 5L99A 5CUCA 2DKWA 3JVKA 4N4GA 5E74A 5C7NA 5CQTA 4Z6IA 4QSWA 3P1FA 4NYWA 3U5PA 4QEVA 5EWVA 5DYAA 5CPEA 4CL9A 5EI4A 4CFLA 2L5EA 4QC1A 4XUBA 5CP5A 5DFDA 2WP2A 4UYEA 5E9LA 5L97A 4NR4A 5FH6A 5J0DA 4O7BA 5A7CA 1N72A 4O77A 4YBSA 5L98A 4NRBA 4YYNA 3G0LA 4J0RA 5CQAA 5IGKA 5H1VA 2RNYA 4J1PA 5LJ2A 5II2A 3Q2EA 2KTBB 4KCXA 5A5SA 5HQ5A 4N4HA 4Z1QA 2FSAA 4PTBA 4NYXA 4A9MA 5A82A 5DYCA 5EU1A 5F25A 5KHMA 5FE2A 5G4SA 3AQAA 4NQNA 4HXPA 5LKUA 4CUSA 3U5MA 5AD2A 3SVHA 4HXSA 4YYMA 1E6IA 4QZSA 4O75A 4IR5A 5D3TA 4ALHA 3G0JA 5DFBA 1F68A 2LSPB 4O7FA 4NR6A 5F2PA 5FG5A 4NS5A 2DVRA 5FE3A 4NQMA 4O7CA 4QSXA 4LR6A 5C89A 5CTLA 4CFKA 4NUCA 2L84A 2E3KA 5DBMA 4IR6A 4IR3A 3DWYA 5HM0A 5E73A 4NRAA 4J3IA 5F63A 4A9NA 3JVLA 4NYVA 5A5RA 5I83A 4NUDA 3HMEA 3QZVA 5C4QA 4QUTA 5ENBA 4UIVA 5CQ4A 5CRZA 2RFJA 5EGUA 5CS8A 4QR3A 4QUUA 4ZC9A 5A81A 4MR3A 3LQJA 4J0SA 4PCIA 5CGPA 4TYLA 2DVVA 3MXFA 5D26A 4TT6A 2D82A 4HXKA 5FFYA 5EWHA 5F1LA 5EVAA 5IGMA 4ALGA 5EICA 4WHWA 5ENGA 3LQIA 1EQFA 4TU4A 1WUGA 2YW5A 3P5OA 2RNWA 4WIVA 5C8GA 5L96A 4A9IA 4MR5A 3O37A 5E9IA 2E7NA 5ENCA 5G4RA 4LYSA 5A5QA 4XYAA 5HELA 5DYUA 4BHWA 5E9YA 5FH7A 4C66A 4BJXA 5A5OA 4Z6HA 5CQ3A 4MEQA 4UYDA 4A9HA 3IU5A 2D9EA 5CU8A 2DVQA 5D24A 5EM3A 4LRGA 4KV4A 4QSTA 4N4FA 4KV1A 4BW1A 4A9JA 4IORA 4HBVA 4OGJA 3HMHA 4DONA 5COIA 3UVYA 4AKNA 4RVRA 3JVMA 5FG6A 5IGLA 4UYHA 4NR9A 4LYWA 5HQ7A 4A9EA 4CLBA 4QSQA 4YAXA 2RI7A 3JVJA 4HXRA 4NUEA 5LKZA 3U5KA 5DYXA 5L8TA 2OUOA 2YYNA 2DWWA 5HRXA 5C85A 4HXNA 5FFVA 3O34A 5L8UA 5H1UA 3LXJA 3FKMX 2WP1A 3MULA 5I29A 5KTWA 4UYFA 5EA1A 5DLZA 5CQ8A 1JM4B 3IU6A 2L85A 3P1EA 4ZQLA 3QZTA 3ONIA 4YY6A 5FE4A 5ENJA 5I88A 5FB0A 4UITA 5FFWA 5I7XA 5D25A 4QSRA 5CQ7A 3MB3A 5A5NA 2DATA 3AADA 2R0YA 4QBMA 4O72A 4XY9A 5II1A 5DKDA 2G4AA 5ETDA 4BW3A 5EK9A 5JI8A 4QB3A 3LQHA 4TS8A 3TLPA 4PCEA 5H1TA 4QSVA 5D3PA 4UIUA 5FG4A 4Z1SA 3UW9A 5DW1A 4YC9A 5D3RA 5AMEA 1JSPB 4QSSA 5I7YA 5TCMA 3RCWA 4BW2A 5E7DA 2R10A 3UV2A 5CUDA 2F6NA 4OGIA 3Q2FA 4CURA 5CFWA 5IGNA 4CUPA 4XUAA 5EPRA 2F6JA 5CUAA 2I8NA 3GG3A 4HXLA 4UYFB 5DLXA 5EPBA 4QR5A 5LKTA 5CUGA 5FDZA 4UIXA 4YH3A 5K29A 4QC3A 5DFCA 5BT3A 5I40A 2OO1A 4Y03A 1X0JA 4N3WA 4YYKA 5I86A 5D3SA 5FE8A 3MUKA 4YBTA 5C87A 4TQNA 5D7XA 4LDFA 5LJ0A 5EQ1A 4QR4A 4LC2A 2RO1A 5DKCA 4E96A 5ENFA 4MENA 4UIYA 2MJVB 4YATA 5FE7A 5E3DA 4CUQA 3O33A 4YYDA 5HCLA 4HXOA 4A9KA 4QYDA 4UIZA 4NR5A 4QEUA 5CY9A 5IIDA 5ENIA 5EWWA 3I3JA 4N4IA 4TT4A 5ETBA 5FE5A 4UIWA 4YABA 4LZ2A 4TZ2A 5D3NA 5CRMA 5KTXA 5E9KA 4IOQA 4YADA 4YK0A 4HXMA 5D0CA 4FLPA 4O70A 4O76A 4QNSA 2RS9B 5F62A 4OUFA 4XY8A 4NR8A 5HLSA 4CUUA 4TU6A 5ENEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5J A;  4LZS A;  5I80 A;  4BW4 A;  4Z93 A;  2OSS A;  4QEW A;  3D7C A;  5A5P A;  5LVQ A;  4MEO A;  3UVW A;  4A9L A;  3U5O A;  4O7E A;  5AD3 A;  5AMF A;  2DVS A;  5HFR A;  5E0R A;  5EV9 A;  4YYG A;  4HBX A;  3MB4 A;  3ZYU A;  5LJ1 A;  4YH4 A;  5D3H A;  4MEP A;  4PKL A;  4ZW1 A;  5F61 A;  2GRC A;  5HRW A;  5EWC A;  3O35 A;  5FB1 A;  4YYJ A;  4TZ8 A;  5DW2 A;  5F60 A;  5KO4 A;  5E9V A;  5FBX A;  5FE1 A;  3MQM A;  5I89 A;  5ENH A;  2RNX A;  1WUM A;  5ACY A;  4MR4 A;  3SVF A;  3U5N A;  3S91 A;  5BT5 A;  4QY4 A;  3UVD A;  4WHU A;  4YYI A;  5E9M A;  4C67 A;  4YY4 A;  5LVR A;  5CUB A;  4QSP A;  5F36 A;  5IG6 A;  4F3I A;  4MR6 A;  4CUT A;  3O36 A;  4HBW A;  5DY7 A;  5CZG A;  2R0V A;  4IOO A;  5LKX A;  4LYI A;  5F5Z A;  4A9O A;  2N9G A;  5CQ6 A;  5CQ5 A;  4UYG A;  5HEN A;  4NR7 A;  4O74 A;  4TTE A;  5EP7 A;  3K2J A;  4QYL A;  2YEK A;  4X2I A;  5H85 A;  4HBY A;  5D3L A;  5KTU A;  4Q0N A;  4TT2 A;  4IR4 A;  2YEM A;  4YYH A;  3P1D A;  2R0S A;  5IBN A;  4GPJ A;  5A85 A;  3UVX A;  3UV4 A;  4NRC A;  5BT4 A;  5D3J A;  3DAI A;  2YEL A;  5F1H A;  5JWM A;  5LUU A;  5CUE A;  5HQ6 A;  4A9F A;  5HFQ A;  5HEM A;  3QZS A;  2E7O A;  4QSU A;  4Q0O A;  4YBM A;  4LZR A;  2I7K A;  4O78 A;  2YDW A;  5FE9 A;  5E3G A;  5FE0 A;  3HMF A;  5EWD A;  5DKH A;  3NXB A;  4PY6 A;  5A83 A;  5DX4 A;  5HRV A;  3P1C A;  5F3A A;  3U5L A;  5HJC A;  1ZS5 A;  2NXB A;  4PS5 A;  5FH8 A;  3SVG A;  4O7A A;  2H60 A;  5EIS A;  5FE6 A;  3S92 A;  3UV5 A;  2YQD A;  5TB6 A;  3LJW A;  4NXJ A;  4O71 A;  5KU3 A;  5EPS A;  5I1Q A;  5L99 A;  5CUC A;  2DKW A;  3JVK A;  4N4G A;  5E74 A;  5C7N A;  5CQT A;  4Z6I A;  4QSW A;  3P1F A;  4NYW A;  3U5P A;  4QEV A;  5EWV A;  5DYA A;  5CPE A;  4CL9 A;  5EI4 A;  4CFL A;  2L5E A;  4QC1 A;  4XUB A;  5CP5 A;  5DFD A;  2WP2 A;  4UYE A;  5E9L A;  5L97 A;  4NR4 A;  5FH6 A;  5J0D A;  4O7B A;  5A7C A;  1N72 A;  4O77 A;  4YBS A;  5L98 A;  4NRB A;  4YYN A;  3G0L A;  4J0R A;  5CQA A;  5IGK A;  5H1V A;  2RNY A;  4J1P A;  5LJ2 A;  5II2 A;  3Q2E A;  2KTB B;  4KCX A;  5A5S A;  5HQ5 A;  4N4H A;  4Z1Q A;  2FSA A;  4PTB A;  4NYX A;  4A9M A;  5A82 A;  5DYC A;  5EU1 A;  5F25 A;  5KHM A;  5FE2 A;  5G4S A;  3AQA A;  4NQN A;  4HXP A;  5LKU A;  4CUS A;  3U5M A;  5AD2 A;  3SVH A;  4HXS A;  4YYM A;  1E6I A;  4QZS A;  4O75 A;  4IR5 A;  5D3T A;  4ALH A;  3G0J A;  5DFB A;  1F68 A;  2LSP B;  4O7F A;  4NR6 A;  5F2P A;  5FG5 A;  4NS5 A;  2DVR A;  5FE3 A;  4NQM A;  4O7C A;  4QSX A;  4LR6 A;  5C89 A;  5CTL A;  4CFK A;  4NUC A;  2L84 A;  2E3K A;  5DBM A;  4IR6 A;  4IR3 A;  3DWY A;  5HM0 A;  5E73 A;  4NRA A;  4J3I A;  5F63 A;  4A9N A;  3JVL A;  4NYV A;  5A5R A;  5I83 A;  4NUD A;  3HME A;  3QZV A;  5C4Q A;  4QUT A;  5ENB A;  4UIV A;  5CQ4 A;  5CRZ A;  2RFJ A;  5EGU A;  5CS8 A;  4QR3 A;  4QUU A;  4ZC9 A;  5A81 A;  4MR3 A;  3LQJ A;  4J0S A;  4PCI A;  5CGP A;  4TYL A;  2DVV A;  3MXF A;  5D26 A;  4TT6 A;  2D82 A;  4HXK A;  5FFY A;  5EWH A;  5F1L A;  5EVA A;  5IGM A;  4ALG A;  5EIC A;  4WHW A;  5ENG A;  3LQI A;  1EQF A;  4TU4 A;  1WUG A;  2YW5 A;  3P5O A;  2RNW A;  4WIV A;  5C8G A;  5L96 A;  4A9I A;  4MR5 A;  3O37 A;  5E9I A;  2E7N A;  5ENC A;  5G4R A;  4LYS A;  5A5Q A;  4XYA A;  5HEL A;  5DYU A;  4BHW A;  5E9Y A;  5FH7 A;  4C66 A;  4BJX A;  5A5O A;  4Z6H A;  5CQ3 A;  4MEQ A;  4UYD A;  4A9H A;  3IU5 A;  2D9E A;  5CU8 A;  2DVQ A;  5D24 A;  5EM3 A;  4LRG A;  4KV4 A;  4QST A;  4N4F A;  4KV1 A;  4BW1 A;  4A9J A;  4IOR A;  4HBV A;  4OGJ A;  3HMH A;  4DON A;  5COI A;  3UVY A;  4AKN A;  4RVR A;  3JVM A;  5FG6 A;  5IGL A;  4UYH A;  4NR9 A;  4LYW A;  5HQ7 A;  4A9E A;  4CLB A;  4QSQ A;  4YAX A;  2RI7 A;  3JVJ A;  4HXR A;  4NUE A;  5LKZ A;  3U5K A;  5DYX A;  5L8T A;  2OUO A;  2YYN A;  2DWW A;  5HRX A;  5C85 A;  4HXN A;  5FFV A;  3O34 A;  5L8U A;  5H1U A;  3LXJ A;  3FKM X;  2WP1 A;  3MUL A;  5I29 A;  5KTW A;  4UYF A;  5EA1 A;  5DLZ A;  5CQ8 A;  1JM4 B;  3IU6 A;  2L85 A;  3P1E A;  4ZQL A;  3QZT A;  3ONI A;  4YY6 A;  5FE4 A;  5ENJ A;  5I88 A;  5FB0 A;  4UIT A;  5FFW A;  5I7X A;  5D25 A;  4QSR A;  5CQ7 A;  3MB3 A;  5A5N A;  2DAT A;  3AAD A;  2R0Y A;  4QBM A;  4O72 A;  4XY9 A;  5II1 A;  5DKD A;  2G4A A;  5ETD A;  4BW3 A;  5EK9 A;  5JI8 A;  4QB3 A;  3LQH A;  4TS8 A;  3TLP A;  4PCE A;  5H1T A;  4QSV A;  5D3P A;  4UIU A;  5FG4 A;  4Z1S A;  3UW9 A;  5DW1 A;  4YC9 A;  5D3R A;  5AME A;  1JSP B;  4QSS A;  5I7Y A;  5TCM A;  3RCW A;  4BW2 A;  5E7D A;  2R10 A;  3UV2 A;  5CUD A;  2F6N A;  4OGI A;  3Q2F A;  4CUR A;  5CFW A;  5IGN A;  4CUP A;  4XUA A;  5EPR A;  2F6J A;  5CUA A;  2I8N A;  3GG3 A;  4HXL A;  4UYF B;  5DLX A;  5EPB A;  4QR5 A;  5LKT A;  5CUG A;  5FDZ A;  4UIX A;  4YH3 A;  5K29 A;  4QC3 A;  5DFC A;  5BT3 A;  5I40 A;  2OO1 A;  4Y03 A;  1X0J A;  4N3W A;  4YYK A;  5I86 A;  5D3S A;  5FE8 A;  3MUK A;  4YBT A;  5C87 A;  4TQN A;  5D7X A;  4LDF A;  5LJ0 A;  5EQ1 A;  4QR4 A;  4LC2 A;  2RO1 A;  5DKC A;  4E96 A;  5ENF A;  4MEN A;  4UIY A;  2MJV B;  4YAT A;  5FE7 A;  5E3D A;  4CUQ A;  3O33 A;  4YYD A;  5HCL A;  4HXO A;  4A9K A;  4QYD A;  4UIZ A;  4NR5 A;  4QEU A;  5CY9 A;  5IID A;  5ENI A;  5EWW A;  3I3J A;  4N4I A;  4TT4 A;  5ETB A;  5FE5 A;  4UIW A;  4YAB A;  4LZ2 A;  4TZ2 A;  5D3N A;  5CRM A;  5KTX A;  5E9K A;  4IOQ A;  4YAD A;  4YK0 A;  4HXM A;  5D0C A;  4FLP A;  4O70 A;  4O76 A;  4QNS A;  2RS9 B;  5F62 A;  4OUF A;  4XY8 A;  4NR8 A;  5HLS A;  4CUU A;  4TU6 A;  5ENE A; 
#chains in the Genus database with same CATH topology
 3U5J A;  4LZS A;  5I80 A;  4BW4 A;  4Z93 A;  2OSS A;  4QEW A;  3D7C A;  5A5P A;  5LVQ A;  4MEO A;  3UVW A;  4A9L A;  3U5O A;  4O7E A;  5AD3 A;  5AMF A;  2DVS A;  5HFR A;  5E0R A;  5EV9 A;  4YYG A;  4HBX A;  3MB4 A;  3ZYU A;  5LJ1 A;  4YH4 A;  5D3H A;  4MEP A;  4PKL A;  4ZW1 A;  5F61 A;  2GRC A;  5HRW A;  5EWC A;  3O35 A;  5FB1 A;  4YYJ A;  4TZ8 A;  5DW2 A;  5F60 A;  5KO4 A;  5E9V A;  5FBX A;  5FE1 A;  3MQM A;  5I89 A;  5ENH A;  2RNX A;  1WUM A;  5ACY A;  4MR4 A;  3SVF A;  3U5N A;  3S91 A;  5BT5 A;  4QY4 A;  3UVD A;  4WHU A;  4YYI A;  5E9M A;  4C67 A;  4YY4 A;  5LVR A;  5CUB A;  4QSP A;  5F36 A;  5IG6 A;  4F3I A;  4MR6 A;  4CUT A;  3O36 A;  4HBW A;  5DY7 A;  5CZG A;  2R0V A;  4IOO A;  5LKX A;  4LYI A;  5F5Z A;  4A9O A;  2N9G A;  5CQ6 A;  5CQ5 A;  4UYG A;  5HEN A;  4NR7 A;  4O74 A;  4TTE A;  5EP7 A;  3K2J A;  4QYL A;  2YEK A;  4X2I A;  5H85 A;  4HBY A;  5D3L A;  5KTU A;  4Q0N A;  4TT2 A;  4IR4 A;  2YEM A;  4YYH A;  3P1D A;  2R0S A;  5IBN A;  4GPJ A;  5A85 A;  4AKG A;  3UVX A;  3UV4 A;  4NRC A;  5BT4 A;  5D3J A;  3DAI A;  2YEL A;  5F1H A;  5JWM A;  5LUU A;  5CUE A;  5HQ6 A;  4A9F A;  5HFQ A;  5HEM A;  3QZS A;  2E7O A;  4QSU A;  4Q0O A;  4YBM A;  4LZR A;  2I7K A;  4O78 A;  2YDW A;  5FE9 A;  5E3G A;  5FE0 A;  3HMF A;  5EWD A;  5DKH A;  3NXB A;  4PY6 A;  5A83 A;  5DX4 A;  5HRV A;  3P1C A;  5F3A A;  3U5L A;  5HJC A;  1ZS5 A;  2NXB A;  4PS5 A;  5FH8 A;  3SVG A;  4O7A A;  2H60 A;  5EIS A;  5FE6 A;  3S92 A;  3UV5 A;  2YQD A;  5TB6 A;  3LJW A;  4NXJ A;  4O71 A;  5KU3 A;  5EPS A;  4AKH A;  5I1Q A;  5L99 A;  5CUC A;  2DKW A;  3JVK A;  4N4G A;  5E74 A;  5C7N A;  5CQT A;  4Z6I A;  4QSW A;  3P1F A;  4NYW A;  3U5P A;  4QEV A;  5EWV A;  5DYA A;  5CPE A;  4CL9 A;  5EI4 A;  4CFL A;  2L5E A;  4QC1 A;  4XUB A;  5CP5 A;  5DFD A;  2WP2 A;  4UYE A;  5E9L A;  5L97 A;  4NR4 A;  5FH6 A;  5J0D A;  4O7B A;  5A7C A;  1N72 A;  4O77 A;  4YBS A;  5L98 A;  4NRB A;  4YYN A;  3G0L A;  4J0R A;  5CQA A;  5IGK A;  5H1V A;  2RNY A;  4J1P A;  5LJ2 A;  5II2 A;  3Q2E A;  2KTB B;  4KCX A;  3VKH A;  5A5S A;  5HQ5 A;  4N4H A;  3VKG A;  4Z1Q A;  2FSA A;  4PTB A;  4NYX A;  4A9M A;  5A82 A;  5DYC A;  5EU1 A;  5F25 A;  5KHM A;  5FE2 A;  5G4S A;  3AQA A;  4NQN A;  3D1B A;  4HXP A;  5LKU A;  4CUS A;  3U5M A;  5AD2 A;  3SVH A;  4HXS A;  4YYM A;  1E6I A;  4QZS A;  4O75 A;  4IR5 A;  5D3T A;  4ALH A;  3G0J A;  5DFB A;  1F68 A;  2LSP B;  4O7F A;  4NR6 A;  5F2P A;  5FG5 A;  2EJN A;  4NS5 A;  2DVR A;  5FE3 A;  4NQM A;  4O7C A;  4QSX A;  4LR6 A;  5C89 A;  5CTL A;  4CFK A;  4NUC A;  2L84 A;  2E3K A;  5DBM A;  4IR6 A;  4IR3 A;  3DWY A;  5HM0 A;  5E73 A;  4NRA A;  4J3I A;  5F63 A;  4A9N A;  3JVL A;  4NYV A;  5A5R A;  5I83 A;  4NUD A;  3HME A;  3QZV A;  5C4Q A;  4QUT A;  5ENB A;  4UIV A;  5CQ4 A;  5CRZ A;  2RFJ A;  5EGU A;  5CS8 A;  4QR3 A;  4QUU A;  4ZC9 A;  5A81 A;  4AKI A;  4MR3 A;  3LQJ A;  4J0S A;  4PCI A;  5CGP A;  4TYL A;  2DVV A;  3MXF A;  5D26 A;  4TT6 A;  2D82 A;  4HXK A;  5FFY A;  5EWH A;  5F1L A;  5EVA A;  5IGM A;  4ALG A;  5EIC A;  4WHW A;  5ENG A;  3LQI A;  1EQF A;  4TU4 A;  1WUG A;  2YW5 A;  3P5O A;  2RNW A;  4WIV A;  5C8G A;  5L96 A;  4A9I A;  4MR5 A;  3O37 A;  5E9I A;  2E7N A;  5ENC A;  5G4R A;  4LYS A;  5A5Q A;  4XYA A;  5HEL A;  5DYU A;  4BHW A;  5E9Y A;  5FH7 A;  4C66 A;  4BJX A;  5A5O A;  4Z6H A;  5CQ3 A;  4MEQ A;  4UYD A;  4A9H A;  3IU5 A;  2D9E A;  5CU8 A;  2DVQ A;  5D24 A;  5EM3 A;  4LRG A;  4KV4 A;  4QST A;  4N4F A;  1ZKR A;  4KV1 A;  4BW1 A;  4A9J A;  4IOR A;  4HBV A;  4OGJ A;  4AI6 A;  3HMH A;  4DON A;  5COI A;  3UVY A;  4AKN A;  4RVR A;  3JVM A;  5FG6 A;  5IGL A;  4UYH A;  4NR9 A;  4LYW A;  5HQ7 A;  4A9E A;  4CLB A;  4QSQ A;  4YAX A;  2RI7 A;  3JVJ A;  4HXR A;  4NUE A;  5LKZ A;  3U5K A;  5DYX A;  5L8T A;  2OUO A;  2YYN A;  2DWW A;  5HRX A;  5C85 A;  4HXN A;  5FFV A;  3O34 A;  5L8U A;  5H1U A;  3LXJ A;  3FKM X;  2WP1 A;  3MUL A;  5I29 A;  5KTW A;  4UYF A;  5EA1 A;  5DLZ A;  5CQ8 A;  1JM4 B;  3IU6 A;  2L85 A;  3P1E A;  4ZQL A;  3QZT A;  3ONI A;  4YY6 A;  5FE4 A;  5ENJ A;  5I88 A;  5FB0 A;  4UIT A;  5FFW A;  5I7X A;  5D25 A;  4QSR A;  5CQ7 A;  3MB3 A;  5A5N A;  2DAT A;  3AAD A;  2R0Y A;  4QBM A;  4O72 A;  4XY9 A;  5II1 A;  5DKD A;  2G4A A;  5ETD A;  4BW3 A;  5EK9 A;  5JI8 A;  4QB3 A;  3LQH A;  4TS8 A;  3TLP A;  4PCE A;  5H1T A;  4QSV A;  5D3P A;  4UIU A;  5FG4 A;  4Z1S A;  3UW9 A;  5DW1 A;  3D1D A;  4YC9 A;  5D3R A;  5AME A;  1JSP B;  4QSS A;  5I7Y A;  5TCM A;  3RCW A;  4BW2 A;  5E7D A;  2R10 A;  3UV2 A;  5CUD A;  2F6N A;  4OGI A;  3Q2F A;  4CUR A;  5CFW A;  5IGN A;  4CUP A;  4XUA A;  5EPR A;  2F6J A;  5CUA A;  2I8N A;  3GG3 A;  4HXL A;  4UYF B;  5DLX A;  5EPB A;  4QR5 A;  5LKT A;  5CUG A;  5FDZ A;  4UIX A;  4YH3 A;  5K29 A;  4QC3 A;  5DFC A;  5BT3 A;  5I40 A;  2OO1 A;  4Y03 A;  1X0J A;  4N3W A;  4YYK A;  5I86 A;  5D3S A;  5FE8 A;  3MUK A;  4YBT A;  5C87 A;  4TQN A;  5D7X A;  4LDF A;  5LJ0 A;  5EQ1 A;  4QR4 A;  4LC2 A;  2RO1 A;  5DKC A;  4E96 A;  3ERR A;  5ENF A;  4MEN A;  4UIY A;  2MJV B;  4YAT A;  5FE7 A;  5E3D A;  4CUQ A;  3O33 A;  4YYD A;  5HCL A;  4HXO A;  4A9K A;  4QYD A;  4UIZ A;  4NR5 A;  4QEU A;  5CY9 A;  5IID A;  5ENI A;  5EWW A;  3I3J A;  4N4I A;  4TT4 A;  5ETB A;  5FE5 A;  4UIW A;  4YAB A;  4LZ2 A;  4TZ2 A;  5D3N A;  5CRM A;  5KTX A;  5E9K A;  4IOQ A;  4YAD A;  4YK0 A;  4HXM A;  5D0C A;  4FLP A;  4O70 A;  4O76 A;  4QNS A;  2RS9 B;  5F62 A;  1PUO A;  4OUF A;  4XY8 A;  4NR8 A;  5HLS A;  4CUU A;  4TU6 A;  5ENE A; 
#chains in the Genus database with same CATH homology
 3U5J A;  4LZS A;  5I80 A;  4BW4 A;  4Z93 A;  2OSS A;  4QEW A;  3D7C A;  5A5P A;  5LVQ A;  4MEO A;  3UVW A;  4A9L A;  3U5O A;  4O7E A;  5AD3 A;  5AMF A;  2DVS A;  5HFR A;  5E0R A;  5EV9 A;  4YYG A;  4HBX A;  3MB4 A;  3ZYU A;  5LJ1 A;  4YH4 A;  5D3H A;  4MEP A;  4PKL A;  4ZW1 A;  5F61 A;  2GRC A;  5HRW A;  5EWC A;  3O35 A;  5FB1 A;  4YYJ A;  4TZ8 A;  5DW2 A;  5F60 A;  5KO4 A;  5E9V A;  5FBX A;  5FE1 A;  3MQM A;  5I89 A;  5ENH A;  2RNX A;  1WUM A;  5ACY A;  4MR4 A;  3SVF A;  3U5N A;  3S91 A;  5BT5 A;  4QY4 A;  3UVD A;  4WHU A;  4YYI A;  5E9M A;  4C67 A;  4YY4 A;  5LVR A;  5CUB A;  4QSP A;  5F36 A;  5IG6 A;  4F3I A;  4MR6 A;  4CUT A;  3O36 A;  4HBW A;  5DY7 A;  5CZG A;  2R0V A;  4IOO A;  5LKX A;  4LYI A;  5F5Z A;  4A9O A;  2N9G A;  5CQ6 A;  5CQ5 A;  4UYG A;  5HEN A;  4NR7 A;  4O74 A;  4TTE A;  5EP7 A;  3K2J A;  4QYL A;  2YEK A;  4X2I A;  5H85 A;  4HBY A;  5D3L A;  5KTU A;  4Q0N A;  4TT2 A;  4IR4 A;  2YEM A;  4YYH A;  3P1D A;  2R0S A;  5IBN A;  4GPJ A;  5A85 A;  3UVX A;  3UV4 A;  4NRC A;  5BT4 A;  5D3J A;  3DAI A;  2YEL A;  5F1H A;  5JWM A;  5LUU A;  5CUE A;  5HQ6 A;  4A9F A;  5HFQ A;  5HEM A;  3QZS A;  2E7O A;  4QSU A;  4Q0O A;  4YBM A;  4LZR A;  2I7K A;  4O78 A;  2YDW A;  5FE9 A;  5E3G A;  5FE0 A;  3HMF A;  5EWD A;  5DKH A;  3NXB A;  4PY6 A;  5A83 A;  5DX4 A;  5HRV A;  3P1C A;  5F3A A;  3U5L A;  5HJC A;  1ZS5 A;  2NXB A;  4PS5 A;  5FH8 A;  3SVG A;  4O7A A;  2H60 A;  5EIS A;  5FE6 A;  3S92 A;  3UV5 A;  2YQD A;  5TB6 A;  3LJW A;  4NXJ A;  4O71 A;  5KU3 A;  5EPS A;  5I1Q A;  5L99 A;  5CUC A;  2DKW A;  3JVK A;  4N4G A;  5E74 A;  5C7N A;  5CQT A;  4Z6I A;  4QSW A;  3P1F A;  4NYW A;  3U5P A;  4QEV A;  5EWV A;  5DYA A;  5CPE A;  4CL9 A;  5EI4 A;  4CFL A;  2L5E A;  4QC1 A;  4XUB A;  5CP5 A;  5DFD A;  2WP2 A;  4UYE A;  5E9L A;  5L97 A;  4NR4 A;  5FH6 A;  5J0D A;  4O7B A;  5A7C A;  1N72 A;  4O77 A;  4YBS A;  5L98 A;  4NRB A;  4YYN A;  3G0L A;  4J0R A;  5CQA A;  5IGK A;  5H1V A;  2RNY A;  4J1P A;  5LJ2 A;  5II2 A;  3Q2E A;  2KTB B;  4KCX A;  5A5S A;  5HQ5 A;  4N4H A;  4Z1Q A;  2FSA A;  4PTB A;  4NYX A;  4A9M A;  5A82 A;  5DYC A;  5EU1 A;  5F25 A;  5KHM A;  5FE2 A;  5G4S A;  3AQA A;  4NQN A;  4HXP A;  5LKU A;  4CUS A;  3U5M A;  5AD2 A;  3SVH A;  4HXS A;  4YYM A;  1E6I A;  4QZS A;  4O75 A;  4IR5 A;  5D3T A;  4ALH A;  3G0J A;  5DFB A;  1F68 A;  2LSP B;  4O7F A;  4NR6 A;  5F2P A;  5FG5 A;  4NS5 A;  2DVR A;  5FE3 A;  4NQM A;  4O7C A;  4QSX A;  4LR6 A;  5C89 A;  5CTL A;  4CFK A;  4NUC A;  2L84 A;  2E3K A;  5DBM A;  4IR6 A;  4IR3 A;  3DWY A;  5HM0 A;  5E73 A;  4NRA A;  4J3I A;  5F63 A;  4A9N A;  3JVL A;  4NYV A;  5A5R A;  5I83 A;  4NUD A;  3HME A;  3QZV A;  5C4Q A;  4QUT A;  5ENB A;  4UIV A;  5CQ4 A;  5CRZ A;  2RFJ A;  5EGU A;  5CS8 A;  4QR3 A;  4QUU A;  4ZC9 A;  5A81 A;  4MR3 A;  3LQJ A;  4J0S A;  4PCI A;  5CGP A;  4TYL A;  2DVV A;  3MXF A;  5D26 A;  4TT6 A;  2D82 A;  4HXK A;  5FFY A;  5EWH A;  5F1L A;  5EVA A;  5IGM A;  4ALG A;  5EIC A;  4WHW A;  5ENG A;  3LQI A;  1EQF A;  4TU4 A;  1WUG A;  2YW5 A;  3P5O A;  2RNW A;  4WIV A;  5C8G A;  5L96 A;  4A9I A;  4MR5 A;  3O37 A;  5E9I A;  2E7N A;  5ENC A;  5G4R A;  4LYS A;  5A5Q A;  4XYA A;  5HEL A;  5DYU A;  4BHW A;  5E9Y A;  5FH7 A;  4C66 A;  4BJX A;  5A5O A;  4Z6H A;  5CQ3 A;  4MEQ A;  4UYD A;  4A9H A;  3IU5 A;  2D9E A;  5CU8 A;  2DVQ A;  5D24 A;  5EM3 A;  4LRG A;  4KV4 A;  4QST A;  4N4F A;  4KV1 A;  4BW1 A;  4A9J A;  4IOR A;  4HBV A;  4OGJ A;  3HMH A;  4DON A;  5COI A;  3UVY A;  4AKN A;  4RVR A;  3JVM A;  5FG6 A;  5IGL A;  4UYH A;  4NR9 A;  4LYW A;  5HQ7 A;  4A9E A;  4CLB A;  4QSQ A;  4YAX A;  2RI7 A;  3JVJ A;  4HXR A;  4NUE A;  5LKZ A;  3U5K A;  5DYX A;  5L8T A;  2OUO A;  2YYN A;  2DWW A;  5HRX A;  5C85 A;  4HXN A;  5FFV A;  3O34 A;  5L8U A;  5H1U A;  3LXJ A;  3FKM X;  2WP1 A;  3MUL A;  5I29 A;  5KTW A;  4UYF A;  5EA1 A;  5DLZ A;  5CQ8 A;  1JM4 B;  3IU6 A;  2L85 A;  3P1E A;  4ZQL A;  3QZT A;  3ONI A;  4YY6 A;  5FE4 A;  5ENJ A;  5I88 A;  5FB0 A;  4UIT A;  5FFW A;  5I7X A;  5D25 A;  4QSR A;  5CQ7 A;  3MB3 A;  5A5N A;  2DAT A;  3AAD A;  2R0Y A;  4QBM A;  4O72 A;  4XY9 A;  5II1 A;  5DKD A;  2G4A A;  5ETD A;  4BW3 A;  5EK9 A;  5JI8 A;  4QB3 A;  3LQH A;  4TS8 A;  3TLP A;  4PCE A;  5H1T A;  4QSV A;  5D3P A;  4UIU A;  5FG4 A;  4Z1S A;  3UW9 A;  5DW1 A;  4YC9 A;  5D3R A;  5AME A;  1JSP B;  4QSS A;  5I7Y A;  5TCM A;  3RCW A;  4BW2 A;  5E7D A;  2R10 A;  3UV2 A;  5CUD A;  2F6N A;  4OGI A;  3Q2F A;  4CUR A;  5CFW A;  5IGN A;  4CUP A;  4XUA A;  5EPR A;  2F6J A;  5CUA A;  2I8N A;  3GG3 A;  4HXL A;  4UYF B;  5DLX A;  5EPB A;  4QR5 A;  5LKT A;  5CUG A;  5FDZ A;  4UIX A;  4YH3 A;  5K29 A;  4QC3 A;  5DFC A;  5BT3 A;  5I40 A;  2OO1 A;  4Y03 A;  1X0J A;  4N3W A;  4YYK A;  5I86 A;  5D3S A;  5FE8 A;  3MUK A;  4YBT A;  5C87 A;  4TQN A;  5D7X A;  4LDF A;  5LJ0 A;  5EQ1 A;  4QR4 A;  4LC2 A;  2RO1 A;  5DKC A;  4E96 A;  5ENF A;  4MEN A;  4UIY A;  2MJV B;  4YAT A;  5FE7 A;  5E3D A;  4CUQ A;  3O33 A;  4YYD A;  5HCL A;  4HXO A;  4A9K A;  4QYD A;  4UIZ A;  4NR5 A;  4QEU A;  5CY9 A;  5IID A;  5ENI A;  5EWW A;  3I3J A;  4N4I A;  4TT4 A;  5ETB A;  5FE5 A;  4UIW A;  4YAB A;  4LZ2 A;  4TZ2 A;  5D3N A;  5CRM A;  5KTX A;  5E9K A;  4IOQ A;  4YAD A;  4YK0 A;  4HXM A;  5D0C A;  4FLP A;  4O70 A;  4O76 A;  4QNS A;  2RS9 B;  5F62 A;  4OUF A;  4XY8 A;  4NR8 A;  5HLS A;  4CUU A;  4TU6 A;  5ENE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...