5BT3A

Crystal structure of ep300 bromodomain in complex with sgc-cbp30 chemical probe
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
114
structure length
114
Chain Sequence
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of EP300 bromodomain in complex with a 3,5-dimethylisoxazol ligand
rcsb
molecule keywords Histone acetyltransferase p300
molecule tags Transcription
source organism Homo sapiens
total genus 43
structure length 114
sequence length 114
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5bt3A00
4IR3A 5FE5A 4QUUA 5HLSA 3NXBA 5I7YA 5ENEA 4NR7A 5FE8A 5LJ2A 4QSPA 5F63A 5DKCA 4A9IA 4NXJA 4XYAA 3U5LA 5II1A 4BJXA 4IOQA 4HXOA 5HQ5A 5D3HA 4YYDA 3IU6A 2NXBA 4O78A 3QZTA 4OUFA 5CQTA 5FE4A 2F6JA 4LDFA 5EP7A 5D3NA 5D3LA 5I89A 5FE3A 5EVAA 5H85A 2RNYA 3LJWA 5CPEA 5EWCA 5FDZA 4QSRA 2YEKA 4NYXA 5EWWA 3Q2EA 4NR5A 5DW2A 5EA1A 3P1DA 5D3TA 4TU6A 5D25A 4NR8A 5LKUA 5AD3A 3Q2FA 4QR5A 3GG3A 4NR4A 5C4QA 5HCLA 4O7FA 4NRCA 4CUQA 2DATA 4BW2A 5HFQA 5K29A 5CP5A 1N72A 3HMEA 5L98A 4CUSA 5F25A 4WHUA 4LYSA 3TLPA 4J3IA 4NQNA 4O7EA 3UVXA 5EK9A 2E7OA 4J0SA 5FB0A 5KTWA 5F36A 5HQ7A 3ONIA 4Z93A 2L84A 5TCMA 2L85A 2FSAA 4MR3A 5ENFA 5HJCA 5DKHA 4NUDA 5CQ6A 4PY6A 5FB1A 4QZSA 5LKXA 1E6IA 4TT6A 4TT2A 5A85A 5C89A 3P5OA 4QUTA 4XUBA 5E9VA 4NRAA 5E3DA 5F1LA 5E9KA 4MEQA 4QSUA 4A9EA 4XUAA 5EICA 5F5ZA 2RNWA 4QBMA 4IR5A 5IGMA 4IORA 5E74A 5C87A 3MULA 4UIUA 4O74A 4J1PA 5CUEA 4PKLA 2H60A 4NUCA 2YDWA 4ALGA 4AKNA 5EWVA 4YYKA 4Z1SA 5BT3A 5HRXA 2D82A 4OGIA 5ENCA 4IOOA 4QSXA 5DLXA 5IG6A 4PCEA 5LKTA 5ETDA 2R0SA 4O71A 5CQAA 4HBYA 5ENIA 5D24A 3O35A 5DYXA 4FLPA 5D3SA 5FE0A 5L8UA 2E7NA 5D3PA 4CFLA 5A5SA 5H1UA 5E0RA 4YYGA 4HXRA 4QSWA 3IU5A 2N9GA 1JM4B 5FBXA 4HXSA 4CURA 5F3AA 4YYNA 4WHWA 1WUMA 3MXFA 4N4IA 3DAIA 3P1CA 4UIYA 5FFWA 5IIDA 2YYNA 5CQ4A 5D3JA 4QYLA 5II2A 4UYDA 4BW3A 4CUPA 4MR6A 2RS9B 4QSQA 4XY9A 4UIXA 5E9IA 4A9KA 4CL9A 4Z6HA 5F62A 4HXNA 4QC3A 5L8TA 5EISA 4YABA 2YEMA 3UVYA 4O70A 3MB3A 5DBMA 4A9OA 5CQ7A 4A9LA 5A5OA 5HRWA 5FH8A 5HENA 5FFYA 5FE2A 3SVFA 3JVKA 5J0DA 1JSPB 4WIVA 5EQ1A 5A5NA 5H1VA 5D26A 1F68A 5A5QA 5F60A 5DKDA 4IR4A 5CRMA 5LJ0A 4YYMA 4LZSA 4O7CA 2RO1A 4MR4A 5CTLA 3ZYUA 4QEWA 5A5PA 3U5PA 5CUGA 4YY6A 4TTEA 4BW1A 5EWDA 5ENGA 4A9NA 4O75A 2RFJA 5AMEA 2OO1A 5CS8A 5IBNA 5E3GA 3QZSA 4CUTA 2OSSA 2D9EA 5EGUA 5HQ6A 5F2PA 5DYCA 5CQ3A 5C7NA 5FE7A 4HBXA 3O37A 3JVMA 5CZGA 5HFRA 5LVQA 5I7XA 3O36A 5KU3A 5I29A 4YYJA 1X0JA 3D7CA 4J0RA 3JVLA 5A7CA 4YADA 5TB6A 4LYIA 4ZC9A 2WP1A 5FFVA 5HEMA 4MEPA 5F61A 4ZQLA 3S92A 5C8GA 5E9LA 5FG4A 4LC2A 3O33A 5I80A 5E9YA 4TU4A 4PCIA 3AADA 4YC9A 3UV4A 2L5EA 5LUUA 5D0CA 4CFKA 5IGNA 5I88A 4N4FA 4IR6A 4Q0NA 4HXLA 5EI4A 5ENJA 4TZ8A 4N4GA 5ETBA 3G0LA 4TZ2A 5DFCA 5FE9A 5G4RA 3S91A 5ACYA 4UIVA 4Y03A 5L97A 4QNSA 3HMHA 5IGLA 5LKZA 5CUCA 4PS5A 3U5NA 2KTBB 4HXMA 4QSSA 2E3KA 5F1HA 2R0YA 4TT4A 4UYHA 2OUOA 3LQHA 4TYLA 3K2JA 5CRZA 4O76A 4QSVA 4Z1QA 5CY9A 5EPSA 4Z6IA 3UV5A 2YW5A 5L99A 3MB4A 2G4AA 5A5RA 4NRBA 2DVRA 4A9FA 4YYHA 4KCXA 5FH7A 4YATA 5JWMA 5CQ8A 5D7XA 3P1FA 2DWWA 2GRCA 4QR3A 5ENBA 5AD2A 4UYEA 4QYDA 4LR6A 5FE1A 2WP2A 4C67A 5ENHA 4GPJA 5I86A 5CUBA 5HRVA 4CUUA 2RI7A 4BHWA 4UYGA 4QEVA 5CGPA 4QEUA 4C66A 4YBTA 4HBVA 5L96A 5DYUA 4TQNA 5H1TA 4YK0A 2RNXA 4UIWA 4E96A 4HBWA 5CUDA 3U5KA 5JI8A 3LQJA 5LVRA 3UVDA 3P1EA 3HMFA 4HXPA 4PTBA 3SVGA 5EWHA 5C85A 5FH6A 4YAXA 5KTXA 5KTUA 3JVJA 1WUGA 2DKWA 4O77A 5KHMA 4YH4A 4MEOA 4UYFB 4NQMA 4UYFA 5A83A 4QY4A 5FG5A 2YELA 4NYWA 5HM0A 4YBMA 4LRGA 2MJVB 4NS5A 5CFWA 5CU8A 4QB3A 3UVWA 4O72A 5LJ1A 5A81A 1EQFA 4A9HA 2LSPB 5E9MA 2YQDA 5COIA 5BT5A 5EPRA 5FG6A 4RVRA 4A9JA 3LQIA 4O7BA 3G0JA 5I83A 4YH3A 2DVVA 4YBSA 4NR6A 4ALHA 2I7KA 5D3RA 5BT4A 5DYAA 5I1QA 5CUAA 3DWYA 5IGKA 4XY8A 3O34A 5EPBA 5E7DA 2DVSA 5DFBA 3I3JA 4YY4A 2DVQA 4O7AA 4N3WA 5DX4A 4BW4A 1ZS5A 4UIZA 4NYVA 4MENA 5DFDA 4X2IA 2R0VA 4LYWA 3FKMX 4CLBA 4LZ2A 5I40A 4QSTA 3LXJA 5EV9A 4ZW1A 4LZRA 5DLZA 4QC1A 4Q0OA 5E73A 2R10A 5DY7A 2F6NA 5AMFA 3AQAA 4F3IA 4NR9A 4TS8A 4MR5A 5KO4A 3SVHA 4A9MA 4KV1A 2I8NA 3MUKA 4OGJA 5A82A 3U5JA 3QZVA 4HXKA 3U5MA 3UV2A 3U5OA 5EU1A 4UITA 5EM3A 4YYIA 5DW1A 4NUEA 4KV4A 3MQMA 4DONA 5HELA 3UW9A 5G4SA 5CQ5A 3RCWA 4QR4A 4N4HA 5FE6A
chains in the Genus database with same CATH superfamily
4IR3A 5FE5A 4QUUA 5HLSA 3NXBA 5I7YA 5ENEA 4NR7A 5FE8A 5LJ2A 4QSPA 5F63A 5DKCA 4A9IA 4NXJA 4XYAA 3U5LA 5II1A 4BJXA 4IOQA 4HXOA 5HQ5A 5D3HA 4YYDA 3IU6A 2NXBA 4O78A 3QZTA 4OUFA 5CQTA 5FE4A 2F6JA 4LDFA 5EP7A 5D3NA 5D3LA 5I89A 5FE3A 5EVAA 5H85A 2RNYA 3LJWA 5CPEA 5EWCA 5FDZA 4QSRA 2YEKA 4NYXA 5EWWA 3Q2EA 4NR5A 5DW2A 5EA1A 3P1DA 5D3TA 4TU6A 5D25A 4NR8A 5LKUA 3D1DA 5AD3A 3Q2FA 4QR5A 3GG3A 4NR4A 5C4QA 5HCLA 4O7FA 4NRCA 4CUQA 2DATA 3VKHA 1ZKRA 4BW2A 5HFQA 5K29A 5CP5A 1N72A 3HMEA 5L98A 4CUSA 5F25A 4WHUA 4LYSA 3TLPA 4J3IA 4NQNA 4O7EA 3UVXA 5EK9A 2E7OA 4J0SA 5FB0A 5KTWA 5F36A 5HQ7A 3ONIA 4Z93A 2L84A 5TCMA 2L85A 2FSAA 4MR3A 5ENFA 5HJCA 5DKHA 4NUDA 5CQ6A 4PY6A 5FB1A 4QZSA 5LKXA 1E6IA 4TT6A 4TT2A 5A85A 5C89A 3P5OA 4QUTA 4XUBA 5E9VA 4NRAA 5E3DA 5F1LA 5E9KA 4MEQA 4QSUA 4A9EA 4XUAA 5EICA 5F5ZA 2RNWA 4QBMA 4IR5A 5IGMA 4IORA 5E74A 5C87A 3MULA 4UIUA 4O74A 4J1PA 5CUEA 4PKLA 2H60A 4NUCA 2YDWA 4ALGA 4AKNA 5EWVA 4YYKA 4Z1SA 5BT3A 5HRXA 1PUOA 2D82A 4OGIA 5ENCA 4IOOA 4QSXA 5DLXA 5IG6A 4PCEA 5LKTA 5ETDA 2R0SA 4O71A 5CQAA 4HBYA 3VKGA 5ENIA 5D24A 3O35A 5DYXA 4FLPA 5D3SA 5FE0A 5L8UA 2E7NA 5D3PA 4CFLA 5A5SA 5H1UA 5E0RA 4YYGA 4HXRA 4QSWA 3IU5A 2N9GA 1JM4B 5FBXA 4HXSA 4CURA 5F3AA 4YYNA 4WHWA 1WUMA 2EJNA 3MXFA 4N4IA 3DAIA 3P1CA 4UIYA 5FFWA 5IIDA 2YYNA 5CQ4A 5D3JA 4QYLA 5II2A 4UYDA 4BW3A 4CUPA 4MR6A 2RS9B 4QSQA 4XY9A 4UIXA 5E9IA 4A9KA 4CL9A 4Z6HA 5F62A 4HXNA 4QC3A 5L8TA 5EISA 4YABA 2YEMA 3UVYA 4O70A 3MB3A 5DBMA 4A9OA 5CQ7A 4A9LA 5A5OA 5HRWA 5FH8A 5HENA 5FFYA 5FE2A 3SVFA 3JVKA 5J0DA 1JSPB 4WIVA 5EQ1A 5A5NA 5H1VA 4AKHA 5D26A 1F68A 5A5QA 5F60A 5DKDA 4IR4A 5CRMA 5LJ0A 4YYMA 4LZSA 4O7CA 2RO1A 4MR4A 5CTLA 3ZYUA 4QEWA 5A5PA 3U5PA 5CUGA 4YY6A 4TTEA 4BW1A 5EWDA 5ENGA 4A9NA 4O75A 2RFJA 5AMEA 2OO1A 5CS8A 5IBNA 5E3GA 3QZSA 4CUTA 2OSSA 2D9EA 5EGUA 5HQ6A 5F2PA 5DYCA 5CQ3A 3ERRA 5C7NA 5FE7A 4HBXA 3O37A 3JVMA 5CZGA 5HFRA 5LVQA 5I7XA 3O36A 5KU3A 5I29A 4YYJA 1X0JA 3D7CA 4J0RA 3JVLA 5A7CA 4YADA 5TB6A 4LYIA 4ZC9A 2WP1A 5FFVA 5HEMA 4MEPA 5F61A 4ZQLA 3S92A 5C8GA 5E9LA 5FG4A 4LC2A 3O33A 5I80A 5E9YA 4TU4A 4AKGA 4PCIA 3AADA 4YC9A 3UV4A 2L5EA 5LUUA 5D0CA 4CFKA 5IGNA 5I88A 4N4FA 4IR6A 4Q0NA 4HXLA 5EI4A 5ENJA 4TZ8A 4N4GA 5ETBA 3G0LA 4TZ2A 5DFCA 5FE9A 5G4RA 3S91A 5ACYA 4UIVA 4Y03A 5L97A 4QNSA 3HMHA 5IGLA 5LKZA 5CUCA 4PS5A 3U5NA 2KTBB 4HXMA 4QSSA 4AKIA 2E3KA 5F1HA 2R0YA 4TT4A 4UYHA 2OUOA 3LQHA 4TYLA 3K2JA 5CRZA 4O76A 4QSVA 4Z1QA 5CY9A 5EPSA 4Z6IA 3UV5A 2YW5A 5L99A 3MB4A 2G4AA 5A5RA 4NRBA 2DVRA 4A9FA 4YYHA 4KCXA 5FH7A 4YATA 5JWMA 5CQ8A 5D7XA 3P1FA 2DWWA 2GRCA 4QR3A 5ENBA 5AD2A 4UYEA 4QYDA 4LR6A 5FE1A 2WP2A 4C67A 5ENHA 4GPJA 5I86A 5CUBA 5HRVA 4CUUA 2RI7A 4BHWA 4UYGA 4QEVA 5CGPA 4QEUA 4C66A 4YBTA 4HBVA 5L96A 5DYUA 4TQNA 5H1TA 4YK0A 2RNXA 4UIWA 4E96A 4HBWA 5CUDA 3U5KA 5JI8A 3LQJA 5LVRA 3UVDA 3P1EA 3HMFA 4HXPA 4PTBA 3SVGA 5EWHA 5C85A 5FH6A 4YAXA 5KTXA 5KTUA 3JVJA 1WUGA 2DKWA 4O77A 5KHMA 4YH4A 4MEOA 4UYFB 4NQMA 4UYFA 5A83A 4QY4A 5FG5A 2YELA 4NYWA 5HM0A 4YBMA 4LRGA 2MJVB 4NS5A 5CFWA 5CU8A 4QB3A 3UVWA 4O72A 5LJ1A 5A81A 1EQFA 4A9HA 2LSPB 4AI6A 5E9MA 2YQDA 5COIA 5BT5A 5EPRA 5FG6A 4RVRA 4A9JA 3LQIA 4O7BA 3G0JA 5I83A 4YH3A 2DVVA 4YBSA 4NR6A 4ALHA 2I7KA 5D3RA 5BT4A 5DYAA 5I1QA 5CUAA 3DWYA 5IGKA 4XY8A 3O34A 5EPBA 5E7DA 2DVSA 5DFBA 3I3JA 4YY4A 2DVQA 4O7AA 4N3WA 5DX4A 4BW4A 1ZS5A 4UIZA 4NYVA 4MENA 5DFDA 4X2IA 2R0VA 4LYWA 3FKMX 4CLBA 4LZ2A 5I40A 4QSTA 3LXJA 5EV9A 4ZW1A 4LZRA 5DLZA 4QC1A 4Q0OA 5E73A 2R10A 5DY7A 2F6NA 5AMFA 3AQAA 4F3IA 4NR9A 4TS8A 4MR5A 3D1BA 5KO4A 3SVHA 4A9MA 4KV1A 2I8NA 3MUKA 4OGJA 5A82A 3U5JA 3QZVA 4HXKA 3U5MA 3UV2A 3U5OA 5EU1A 4UITA 5EM3A 4YYIA 5DW1A 4NUEA 4KV4A 3MQMA 4DONA 5HELA 3UW9A 5G4SA 5CQ5A 3RCWA 4QR4A 4N4HA 5FE6A
chains in the Genus database with same CATH topology
4IR3A 5FE5A 4QUUA 5HLSA 3NXBA 5I7YA 5ENEA 4NR7A 5FE8A 5LJ2A 4QSPA 5F63A 5DKCA 4A9IA 4NXJA 4XYAA 3U5LA 5II1A 4BJXA 4IOQA 4HXOA 5HQ5A 5D3HA 4YYDA 3IU6A 2NXBA 4O78A 3QZTA 4OUFA 5CQTA 5FE4A 2F6JA 4LDFA 5EP7A 5D3NA 5D3LA 5I89A 5FE3A 5EVAA 5H85A 2RNYA 3LJWA 5CPEA 5EWCA 5FDZA 4QSRA 2YEKA 4NYXA 5EWWA 3Q2EA 4NR5A 5DW2A 5EA1A 3P1DA 5D3TA 4TU6A 5D25A 4NR8A 5LKUA 5AD3A 3Q2FA 4QR5A 3GG3A 4NR4A 5C4QA 5HCLA 4O7FA 4NRCA 4CUQA 2DATA 4BW2A 5HFQA 5K29A 5CP5A 1N72A 3HMEA 5L98A 4CUSA 5F25A 4WHUA 4LYSA 3TLPA 4J3IA 4NQNA 4O7EA 3UVXA 5EK9A 2E7OA 4J0SA 5FB0A 5KTWA 5F36A 5HQ7A 3ONIA 4Z93A 2L84A 5TCMA 2L85A 2FSAA 4MR3A 5ENFA 5HJCA 5DKHA 4NUDA 5CQ6A 4PY6A 5FB1A 4QZSA 5LKXA 1E6IA 4TT6A 4TT2A 5A85A 5C89A 3P5OA 4QUTA 4XUBA 5E9VA 4NRAA 5E3DA 5F1LA 5E9KA 4MEQA 4QSUA 4A9EA 4XUAA 5EICA 5F5ZA 2RNWA 4QBMA 4IR5A 5IGMA 4IORA 5E74A 5C87A 3MULA 4UIUA 4O74A 4J1PA 5CUEA 4PKLA 2H60A 4NUCA 2YDWA 4ALGA 4AKNA 5EWVA 4YYKA 4Z1SA 5BT3A 5HRXA 2D82A 4OGIA 5ENCA 4IOOA 4QSXA 5DLXA 5IG6A 4PCEA 5LKTA 5ETDA 2R0SA 4O71A 5CQAA 4HBYA 5ENIA 5D24A 3O35A 5DYXA 4FLPA 5D3SA 5FE0A 5L8UA 2E7NA 5D3PA 4CFLA 5A5SA 5H1UA 5E0RA 4YYGA 4HXRA 4QSWA 3IU5A 2N9GA 1JM4B 5FBXA 4HXSA 4CURA 5F3AA 4YYNA 4WHWA 1WUMA 3MXFA 4N4IA 3DAIA 3P1CA 4UIYA 5FFWA 5IIDA 2YYNA 5CQ4A 5D3JA 4QYLA 5II2A 4UYDA 4BW3A 4CUPA 4MR6A 2RS9B 4QSQA 4XY9A 4UIXA 5E9IA 4A9KA 4CL9A 4Z6HA 5F62A 4HXNA 4QC3A 5L8TA 5EISA 4YABA 2YEMA 3UVYA 4O70A 3MB3A 5DBMA 4A9OA 5CQ7A 4A9LA 5A5OA 5HRWA 5FH8A 5HENA 5FFYA 5FE2A 3SVFA 3JVKA 5J0DA 1JSPB 4WIVA 5EQ1A 5A5NA 5H1VA 5D26A 1F68A 5A5QA 5F60A 5DKDA 4IR4A 5CRMA 5LJ0A 4YYMA 4LZSA 4O7CA 2RO1A 4MR4A 5CTLA 3ZYUA 4QEWA 5A5PA 3U5PA 5CUGA 4YY6A 4TTEA 4BW1A 5EWDA 5ENGA 4A9NA 4O75A 2RFJA 5AMEA 2OO1A 5CS8A 5IBNA 5E3GA 3QZSA 4CUTA 2OSSA 2D9EA 5EGUA 5HQ6A 5F2PA 5DYCA 5CQ3A 5C7NA 5FE7A 4HBXA 3O37A 3JVMA 5CZGA 5HFRA 5LVQA 5I7XA 3O36A 5KU3A 5I29A 4YYJA 1X0JA 3D7CA 4J0RA 3JVLA 5A7CA 4YADA 5TB6A 4LYIA 4ZC9A 2WP1A 5FFVA 5HEMA 4MEPA 5F61A 4ZQLA 3S92A 5C8GA 5E9LA 5FG4A 4LC2A 3O33A 5I80A 5E9YA 4TU4A 4PCIA 3AADA 4YC9A 3UV4A 2L5EA 5LUUA 5D0CA 4CFKA 5IGNA 5I88A 4N4FA 4IR6A 4Q0NA 4HXLA 5EI4A 5ENJA 4TZ8A 4N4GA 5ETBA 3G0LA 4TZ2A 5DFCA 5FE9A 5G4RA 3S91A 5ACYA 4UIVA 4Y03A 5L97A 4QNSA 3HMHA 5IGLA 5LKZA 5CUCA 4PS5A 3U5NA 2KTBB 4HXMA 4QSSA 2E3KA 5F1HA 2R0YA 4TT4A 4UYHA 2OUOA 3LQHA 4TYLA 3K2JA 5CRZA 4O76A 4QSVA 4Z1QA 5CY9A 5EPSA 4Z6IA 3UV5A 2YW5A 5L99A 3MB4A 2G4AA 5A5RA 4NRBA 2DVRA 4A9FA 4YYHA 4KCXA 5FH7A 4YATA 5JWMA 5CQ8A 5D7XA 3P1FA 2DWWA 2GRCA 4QR3A 5ENBA 5AD2A 4UYEA 4QYDA 4LR6A 5FE1A 2WP2A 4C67A 5ENHA 4GPJA 5I86A 5CUBA 5HRVA 4CUUA 2RI7A 4BHWA 4UYGA 4QEVA 5CGPA 4QEUA 4C66A 4YBTA 4HBVA 5L96A 5DYUA 4TQNA 5H1TA 4YK0A 2RNXA 4UIWA 4E96A 4HBWA 5CUDA 3U5KA 5JI8A 3LQJA 5LVRA 3UVDA 3P1EA 3HMFA 4HXPA 4PTBA 3SVGA 5EWHA 5C85A 5FH6A 4YAXA 5KTXA 5KTUA 3JVJA 1WUGA 2DKWA 4O77A 5KHMA 4YH4A 4MEOA 4UYFB 4NQMA 4UYFA 5A83A 4QY4A 5FG5A 2YELA 4NYWA 5HM0A 4YBMA 4LRGA 2MJVB 4NS5A 5CFWA 5CU8A 4QB3A 3UVWA 4O72A 5LJ1A 5A81A 1EQFA 4A9HA 2LSPB 5E9MA 2YQDA 5COIA 5BT5A 5EPRA 5FG6A 4RVRA 4A9JA 3LQIA 4O7BA 3G0JA 5I83A 4YH3A 2DVVA 4YBSA 4NR6A 4ALHA 2I7KA 5D3RA 5BT4A 5DYAA 5I1QA 5CUAA 3DWYA 5IGKA 4XY8A 3O34A 5EPBA 5E7DA 2DVSA 5DFBA 3I3JA 4YY4A 2DVQA 4O7AA 4N3WA 5DX4A 4BW4A 1ZS5A 4UIZA 4NYVA 4MENA 5DFDA 4X2IA 2R0VA 4LYWA 3FKMX 4CLBA 4LZ2A 5I40A 4QSTA 3LXJA 5EV9A 4ZW1A 4LZRA 5DLZA 4QC1A 4Q0OA 5E73A 2R10A 5DY7A 2F6NA 5AMFA 3AQAA 4F3IA 4NR9A 4TS8A 4MR5A 5KO4A 3SVHA 4A9MA 4KV1A 2I8NA 3MUKA 4OGJA 5A82A 3U5JA 3QZVA 4HXKA 3U5MA 3UV2A 3U5OA 5EU1A 4UITA 5EM3A 4YYIA 5DW1A 4NUEA 4KV4A 3MQMA 4DONA 5HELA 3UW9A 5G4SA 5CQ5A 3RCWA 4QR4A 4N4HA 5FE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IR3 A;  5FE5 A;  4QUU A;  5HLS A;  3NXB A;  5I7Y A;  5ENE A;  4NR7 A;  5FE8 A;  5LJ2 A;  4QSP A;  5F63 A;  5DKC A;  4A9I A;  4NXJ A;  4XYA A;  3U5L A;  5II1 A;  4BJX A;  4IOQ A;  4HXO A;  5HQ5 A;  5D3H A;  4YYD A;  3IU6 A;  2NXB A;  4O78 A;  3QZT A;  4OUF A;  5CQT A;  5FE4 A;  2F6J A;  4LDF A;  5EP7 A;  5D3N A;  5D3L A;  5I89 A;  5FE3 A;  5EVA A;  5H85 A;  2RNY A;  3LJW A;  5CPE A;  5EWC A;  5FDZ A;  4QSR A;  2YEK A;  4NYX A;  5EWW A;  3Q2E A;  4NR5 A;  5DW2 A;  5EA1 A;  3P1D A;  5D3T A;  4TU6 A;  5D25 A;  4NR8 A;  5LKU A;  5AD3 A;  3Q2F A;  4QR5 A;  3GG3 A;  4NR4 A;  5C4Q A;  5HCL A;  4O7F A;  4NRC A;  4CUQ A;  2DAT A;  4BW2 A;  5HFQ A;  5K29 A;  5CP5 A;  1N72 A;  3HME A;  5L98 A;  4CUS A;  5F25 A;  4WHU A;  4LYS A;  3TLP A;  4J3I A;  4NQN A;  4O7E A;  3UVX A;  5EK9 A;  2E7O A;  4J0S A;  5FB0 A;  5KTW A;  5F36 A;  5HQ7 A;  3ONI A;  4Z93 A;  2L84 A;  5TCM A;  2L85 A;  2FSA A;  4MR3 A;  5ENF A;  5HJC A;  5DKH A;  4NUD A;  5CQ6 A;  4PY6 A;  5FB1 A;  4QZS A;  5LKX A;  1E6I A;  4TT6 A;  4TT2 A;  5A85 A;  5C89 A;  3P5O A;  4QUT A;  4XUB A;  5E9V A;  4NRA A;  5E3D A;  5F1L A;  5E9K A;  4MEQ A;  4QSU A;  4A9E A;  4XUA A;  5EIC A;  5F5Z A;  2RNW A;  4QBM A;  4IR5 A;  5IGM A;  4IOR A;  5E74 A;  5C87 A;  3MUL A;  4UIU A;  4O74 A;  4J1P A;  5CUE A;  4PKL A;  2H60 A;  4NUC A;  2YDW A;  4ALG A;  4AKN A;  5EWV A;  4YYK A;  4Z1S A;  5BT3 A;  5HRX A;  2D82 A;  4OGI A;  5ENC A;  4IOO A;  4QSX A;  5DLX A;  5IG6 A;  4PCE A;  5LKT A;  5ETD A;  2R0S A;  4O71 A;  5CQA A;  4HBY A;  5ENI A;  5D24 A;  3O35 A;  5DYX A;  4FLP A;  5D3S A;  5FE0 A;  5L8U A;  2E7N A;  5D3P A;  4CFL A;  5A5S A;  5H1U A;  5E0R A;  4YYG A;  4HXR A;  4QSW A;  3IU5 A;  2N9G A;  1JM4 B;  5FBX A;  4HXS A;  4CUR A;  5F3A A;  4YYN A;  4WHW A;  1WUM A;  3MXF A;  4N4I A;  3DAI A;  3P1C A;  4UIY A;  5FFW A;  5IID A;  2YYN A;  5CQ4 A;  5D3J A;  4QYL A;  5II2 A;  4UYD A;  4BW3 A;  4CUP A;  4MR6 A;  2RS9 B;  4QSQ A;  4XY9 A;  4UIX A;  5E9I A;  4A9K A;  4CL9 A;  4Z6H A;  5F62 A;  4HXN A;  4QC3 A;  5L8T A;  5EIS A;  4YAB A;  2YEM A;  3UVY A;  4O70 A;  3MB3 A;  5DBM A;  4A9O A;  5CQ7 A;  4A9L A;  5A5O A;  5HRW A;  5FH8 A;  5HEN A;  5FFY A;  5FE2 A;  3SVF A;  3JVK A;  5J0D A;  1JSP B;  4WIV A;  5EQ1 A;  5A5N A;  5H1V A;  5D26 A;  1F68 A;  5A5Q A;  5F60 A;  5DKD A;  4IR4 A;  5CRM A;  5LJ0 A;  4YYM A;  4LZS A;  4O7C A;  2RO1 A;  4MR4 A;  5CTL A;  3ZYU A;  4QEW A;  5A5P A;  3U5P A;  5CUG A;  4YY6 A;  4TTE A;  4BW1 A;  5EWD A;  5ENG A;  4A9N A;  4O75 A;  2RFJ A;  5AME A;  2OO1 A;  5CS8 A;  5IBN A;  5E3G A;  3QZS A;  4CUT A;  2OSS A;  2D9E A;  5EGU A;  5HQ6 A;  5F2P A;  5DYC A;  5CQ3 A;  5C7N A;  5FE7 A;  4HBX A;  3O37 A;  3JVM A;  5CZG A;  5HFR A;  5LVQ A;  5I7X A;  3O36 A;  5KU3 A;  5I29 A;  4YYJ A;  1X0J A;  3D7C A;  4J0R A;  3JVL A;  5A7C A;  4YAD A;  5TB6 A;  4LYI A;  4ZC9 A;  2WP1 A;  5FFV A;  5HEM A;  4MEP A;  5F61 A;  4ZQL A;  3S92 A;  5C8G A;  5E9L A;  5FG4 A;  4LC2 A;  3O33 A;  5I80 A;  5E9Y A;  4TU4 A;  4PCI A;  3AAD A;  4YC9 A;  3UV4 A;  2L5E A;  5LUU A;  5D0C A;  4CFK A;  5IGN A;  5I88 A;  4N4F A;  4IR6 A;  4Q0N A;  4HXL A;  5EI4 A;  5ENJ A;  4TZ8 A;  4N4G A;  5ETB A;  3G0L A;  4TZ2 A;  5DFC A;  5FE9 A;  5G4R A;  3S91 A;  5ACY A;  4UIV A;  4Y03 A;  5L97 A;  4QNS A;  3HMH A;  5IGL A;  5LKZ A;  5CUC A;  4PS5 A;  3U5N A;  2KTB B;  4HXM A;  4QSS A;  2E3K A;  5F1H A;  2R0Y A;  4TT4 A;  4UYH A;  2OUO A;  3LQH A;  4TYL A;  3K2J A;  5CRZ A;  4O76 A;  4QSV A;  4Z1Q A;  5CY9 A;  5EPS A;  4Z6I A;  3UV5 A;  2YW5 A;  5L99 A;  3MB4 A;  2G4A A;  5A5R A;  4NRB A;  2DVR A;  4A9F A;  4YYH A;  4KCX A;  5FH7 A;  4YAT A;  5JWM A;  5CQ8 A;  5D7X A;  3P1F A;  2DWW A;  2GRC A;  4QR3 A;  5ENB A;  5AD2 A;  4UYE A;  4QYD A;  4LR6 A;  5FE1 A;  2WP2 A;  4C67 A;  5ENH A;  4GPJ A;  5I86 A;  5CUB A;  5HRV A;  4CUU A;  2RI7 A;  4BHW A;  4UYG A;  4QEV A;  5CGP A;  4QEU A;  4C66 A;  4YBT A;  4HBV A;  5L96 A;  5DYU A;  4TQN A;  5H1T A;  4YK0 A;  2RNX A;  4UIW A;  4E96 A;  4HBW A;  5CUD A;  3U5K A;  5JI8 A;  3LQJ A;  5LVR A;  3UVD A;  3P1E A;  3HMF A;  4HXP A;  4PTB A;  3SVG A;  5EWH A;  5C85 A;  5FH6 A;  4YAX A;  5KTX A;  5KTU A;  3JVJ A;  1WUG A;  2DKW A;  4O77 A;  5KHM A;  4YH4 A;  4MEO A;  4UYF B;  4NQM A;  4UYF A;  5A83 A;  4QY4 A;  5FG5 A;  2YEL A;  4NYW A;  5HM0 A;  4YBM A;  4LRG A;  2MJV B;  4NS5 A;  5CFW A;  5CU8 A;  4QB3 A;  3UVW A;  4O72 A;  5LJ1 A;  5A81 A;  1EQF A;  4A9H A;  2LSP B;  5E9M A;  2YQD A;  5COI A;  5BT5 A;  5EPR A;  5FG6 A;  4RVR A;  4A9J A;  3LQI A;  4O7B A;  3G0J A;  5I83 A;  4YH3 A;  2DVV A;  4YBS A;  4NR6 A;  4ALH A;  2I7K A;  5D3R A;  5BT4 A;  5DYA A;  5I1Q A;  5CUA A;  3DWY A;  5IGK A;  4XY8 A;  3O34 A;  5EPB A;  5E7D A;  2DVS A;  5DFB A;  3I3J A;  4YY4 A;  2DVQ A;  4O7A A;  4N3W A;  5DX4 A;  4BW4 A;  1ZS5 A;  4UIZ A;  4NYV A;  4MEN A;  5DFD A;  4X2I A;  2R0V A;  4LYW A;  3FKM X;  4CLB A;  4LZ2 A;  5I40 A;  4QST A;  3LXJ A;  5EV9 A;  4ZW1 A;  4LZR A;  5DLZ A;  4QC1 A;  4Q0O A;  5E73 A;  2R10 A;  5DY7 A;  2F6N A;  5AMF A;  3AQA A;  4F3I A;  4NR9 A;  4TS8 A;  4MR5 A;  5KO4 A;  3SVH A;  4A9M A;  4KV1 A;  2I8N A;  3MUK A;  4OGJ A;  5A82 A;  3U5J A;  3QZV A;  4HXK A;  3U5M A;  3UV2 A;  3U5O A;  5EU1 A;  4UIT A;  5EM3 A;  4YYI A;  5DW1 A;  4NUE A;  4KV4 A;  3MQM A;  4DON A;  5HEL A;  3UW9 A;  5G4S A;  5CQ5 A;  3RCW A;  4QR4 A;  4N4H A;  5FE6 A; 
#chains in the Genus database with same CATH topology
 4IR3 A;  5FE5 A;  4QUU A;  5HLS A;  3NXB A;  5I7Y A;  5ENE A;  4NR7 A;  5FE8 A;  5LJ2 A;  4QSP A;  5F63 A;  5DKC A;  4A9I A;  4NXJ A;  4XYA A;  3U5L A;  5II1 A;  4BJX A;  4IOQ A;  4HXO A;  5HQ5 A;  5D3H A;  4YYD A;  3IU6 A;  2NXB A;  4O78 A;  3QZT A;  4OUF A;  5CQT A;  5FE4 A;  2F6J A;  4LDF A;  5EP7 A;  5D3N A;  5D3L A;  5I89 A;  5FE3 A;  5EVA A;  5H85 A;  2RNY A;  3LJW A;  5CPE A;  5EWC A;  5FDZ A;  4QSR A;  2YEK A;  4NYX A;  5EWW A;  3Q2E A;  4NR5 A;  5DW2 A;  5EA1 A;  3P1D A;  5D3T A;  4TU6 A;  5D25 A;  4NR8 A;  5LKU A;  3D1D A;  5AD3 A;  3Q2F A;  4QR5 A;  3GG3 A;  4NR4 A;  5C4Q A;  5HCL A;  4O7F A;  4NRC A;  4CUQ A;  2DAT A;  3VKH A;  1ZKR A;  4BW2 A;  5HFQ A;  5K29 A;  5CP5 A;  1N72 A;  3HME A;  5L98 A;  4CUS A;  5F25 A;  4WHU A;  4LYS A;  3TLP A;  4J3I A;  4NQN A;  4O7E A;  3UVX A;  5EK9 A;  2E7O A;  4J0S A;  5FB0 A;  5KTW A;  5F36 A;  5HQ7 A;  3ONI A;  4Z93 A;  2L84 A;  5TCM A;  2L85 A;  2FSA A;  4MR3 A;  5ENF A;  5HJC A;  5DKH A;  4NUD A;  5CQ6 A;  4PY6 A;  5FB1 A;  4QZS A;  5LKX A;  1E6I A;  4TT6 A;  4TT2 A;  5A85 A;  5C89 A;  3P5O A;  4QUT A;  4XUB A;  5E9V A;  4NRA A;  5E3D A;  5F1L A;  5E9K A;  4MEQ A;  4QSU A;  4A9E A;  4XUA A;  5EIC A;  5F5Z A;  2RNW A;  4QBM A;  4IR5 A;  5IGM A;  4IOR A;  5E74 A;  5C87 A;  3MUL A;  4UIU A;  4O74 A;  4J1P A;  5CUE A;  4PKL A;  2H60 A;  4NUC A;  2YDW A;  4ALG A;  4AKN A;  5EWV A;  4YYK A;  4Z1S A;  5BT3 A;  5HRX A;  1PUO A;  2D82 A;  4OGI A;  5ENC A;  4IOO A;  4QSX A;  5DLX A;  5IG6 A;  4PCE A;  5LKT A;  5ETD A;  2R0S A;  4O71 A;  5CQA A;  4HBY A;  3VKG A;  5ENI A;  5D24 A;  3O35 A;  5DYX A;  4FLP A;  5D3S A;  5FE0 A;  5L8U A;  2E7N A;  5D3P A;  4CFL A;  5A5S A;  5H1U A;  5E0R A;  4YYG A;  4HXR A;  4QSW A;  3IU5 A;  2N9G A;  1JM4 B;  5FBX A;  4HXS A;  4CUR A;  5F3A A;  4YYN A;  4WHW A;  1WUM A;  2EJN A;  3MXF A;  4N4I A;  3DAI A;  3P1C A;  4UIY A;  5FFW A;  5IID A;  2YYN A;  5CQ4 A;  5D3J A;  4QYL A;  5II2 A;  4UYD A;  4BW3 A;  4CUP A;  4MR6 A;  2RS9 B;  4QSQ A;  4XY9 A;  4UIX A;  5E9I A;  4A9K A;  4CL9 A;  4Z6H A;  5F62 A;  4HXN A;  4QC3 A;  5L8T A;  5EIS A;  4YAB A;  2YEM A;  3UVY A;  4O70 A;  3MB3 A;  5DBM A;  4A9O A;  5CQ7 A;  4A9L A;  5A5O A;  5HRW A;  5FH8 A;  5HEN A;  5FFY A;  5FE2 A;  3SVF A;  3JVK A;  5J0D A;  1JSP B;  4WIV A;  5EQ1 A;  5A5N A;  5H1V A;  4AKH A;  5D26 A;  1F68 A;  5A5Q A;  5F60 A;  5DKD A;  4IR4 A;  5CRM A;  5LJ0 A;  4YYM A;  4LZS A;  4O7C A;  2RO1 A;  4MR4 A;  5CTL A;  3ZYU A;  4QEW A;  5A5P A;  3U5P A;  5CUG A;  4YY6 A;  4TTE A;  4BW1 A;  5EWD A;  5ENG A;  4A9N A;  4O75 A;  2RFJ A;  5AME A;  2OO1 A;  5CS8 A;  5IBN A;  5E3G A;  3QZS A;  4CUT A;  2OSS A;  2D9E A;  5EGU A;  5HQ6 A;  5F2P A;  5DYC A;  5CQ3 A;  3ERR A;  5C7N A;  5FE7 A;  4HBX A;  3O37 A;  3JVM A;  5CZG A;  5HFR A;  5LVQ A;  5I7X A;  3O36 A;  5KU3 A;  5I29 A;  4YYJ A;  1X0J A;  3D7C A;  4J0R A;  3JVL A;  5A7C A;  4YAD A;  5TB6 A;  4LYI A;  4ZC9 A;  2WP1 A;  5FFV A;  5HEM A;  4MEP A;  5F61 A;  4ZQL A;  3S92 A;  5C8G A;  5E9L A;  5FG4 A;  4LC2 A;  3O33 A;  5I80 A;  5E9Y A;  4TU4 A;  4AKG A;  4PCI A;  3AAD A;  4YC9 A;  3UV4 A;  2L5E A;  5LUU A;  5D0C A;  4CFK A;  5IGN A;  5I88 A;  4N4F A;  4IR6 A;  4Q0N A;  4HXL A;  5EI4 A;  5ENJ A;  4TZ8 A;  4N4G A;  5ETB A;  3G0L A;  4TZ2 A;  5DFC A;  5FE9 A;  5G4R A;  3S91 A;  5ACY A;  4UIV A;  4Y03 A;  5L97 A;  4QNS A;  3HMH A;  5IGL A;  5LKZ A;  5CUC A;  4PS5 A;  3U5N A;  2KTB B;  4HXM A;  4QSS A;  4AKI A;  2E3K A;  5F1H A;  2R0Y A;  4TT4 A;  4UYH A;  2OUO A;  3LQH A;  4TYL A;  3K2J A;  5CRZ A;  4O76 A;  4QSV A;  4Z1Q A;  5CY9 A;  5EPS A;  4Z6I A;  3UV5 A;  2YW5 A;  5L99 A;  3MB4 A;  2G4A A;  5A5R A;  4NRB A;  2DVR A;  4A9F A;  4YYH A;  4KCX A;  5FH7 A;  4YAT A;  5JWM A;  5CQ8 A;  5D7X A;  3P1F A;  2DWW A;  2GRC A;  4QR3 A;  5ENB A;  5AD2 A;  4UYE A;  4QYD A;  4LR6 A;  5FE1 A;  2WP2 A;  4C67 A;  5ENH A;  4GPJ A;  5I86 A;  5CUB A;  5HRV A;  4CUU A;  2RI7 A;  4BHW A;  4UYG A;  4QEV A;  5CGP A;  4QEU A;  4C66 A;  4YBT A;  4HBV A;  5L96 A;  5DYU A;  4TQN A;  5H1T A;  4YK0 A;  2RNX A;  4UIW A;  4E96 A;  4HBW A;  5CUD A;  3U5K A;  5JI8 A;  3LQJ A;  5LVR A;  3UVD A;  3P1E A;  3HMF A;  4HXP A;  4PTB A;  3SVG A;  5EWH A;  5C85 A;  5FH6 A;  4YAX A;  5KTX A;  5KTU A;  3JVJ A;  1WUG A;  2DKW A;  4O77 A;  5KHM A;  4YH4 A;  4MEO A;  4UYF B;  4NQM A;  4UYF A;  5A83 A;  4QY4 A;  5FG5 A;  2YEL A;  4NYW A;  5HM0 A;  4YBM A;  4LRG A;  2MJV B;  4NS5 A;  5CFW A;  5CU8 A;  4QB3 A;  3UVW A;  4O72 A;  5LJ1 A;  5A81 A;  1EQF A;  4A9H A;  2LSP B;  4AI6 A;  5E9M A;  2YQD A;  5COI A;  5BT5 A;  5EPR A;  5FG6 A;  4RVR A;  4A9J A;  3LQI A;  4O7B A;  3G0J A;  5I83 A;  4YH3 A;  2DVV A;  4YBS A;  4NR6 A;  4ALH A;  2I7K A;  5D3R A;  5BT4 A;  5DYA A;  5I1Q A;  5CUA A;  3DWY A;  5IGK A;  4XY8 A;  3O34 A;  5EPB A;  5E7D A;  2DVS A;  5DFB A;  3I3J A;  4YY4 A;  2DVQ A;  4O7A A;  4N3W A;  5DX4 A;  4BW4 A;  1ZS5 A;  4UIZ A;  4NYV A;  4MEN A;  5DFD A;  4X2I A;  2R0V A;  4LYW A;  3FKM X;  4CLB A;  4LZ2 A;  5I40 A;  4QST A;  3LXJ A;  5EV9 A;  4ZW1 A;  4LZR A;  5DLZ A;  4QC1 A;  4Q0O A;  5E73 A;  2R10 A;  5DY7 A;  2F6N A;  5AMF A;  3AQA A;  4F3I A;  4NR9 A;  4TS8 A;  4MR5 A;  3D1B A;  5KO4 A;  3SVH A;  4A9M A;  4KV1 A;  2I8N A;  3MUK A;  4OGJ A;  5A82 A;  3U5J A;  3QZV A;  4HXK A;  3U5M A;  3UV2 A;  3U5O A;  5EU1 A;  4UIT A;  5EM3 A;  4YYI A;  5DW1 A;  4NUE A;  4KV4 A;  3MQM A;  4DON A;  5HEL A;  3UW9 A;  5G4S A;  5CQ5 A;  3RCW A;  4QR4 A;  4N4H A;  5FE6 A; 
#chains in the Genus database with same CATH homology
 4IR3 A;  5FE5 A;  4QUU A;  5HLS A;  3NXB A;  5I7Y A;  5ENE A;  4NR7 A;  5FE8 A;  5LJ2 A;  4QSP A;  5F63 A;  5DKC A;  4A9I A;  4NXJ A;  4XYA A;  3U5L A;  5II1 A;  4BJX A;  4IOQ A;  4HXO A;  5HQ5 A;  5D3H A;  4YYD A;  3IU6 A;  2NXB A;  4O78 A;  3QZT A;  4OUF A;  5CQT A;  5FE4 A;  2F6J A;  4LDF A;  5EP7 A;  5D3N A;  5D3L A;  5I89 A;  5FE3 A;  5EVA A;  5H85 A;  2RNY A;  3LJW A;  5CPE A;  5EWC A;  5FDZ A;  4QSR A;  2YEK A;  4NYX A;  5EWW A;  3Q2E A;  4NR5 A;  5DW2 A;  5EA1 A;  3P1D A;  5D3T A;  4TU6 A;  5D25 A;  4NR8 A;  5LKU A;  5AD3 A;  3Q2F A;  4QR5 A;  3GG3 A;  4NR4 A;  5C4Q A;  5HCL A;  4O7F A;  4NRC A;  4CUQ A;  2DAT A;  4BW2 A;  5HFQ A;  5K29 A;  5CP5 A;  1N72 A;  3HME A;  5L98 A;  4CUS A;  5F25 A;  4WHU A;  4LYS A;  3TLP A;  4J3I A;  4NQN A;  4O7E A;  3UVX A;  5EK9 A;  2E7O A;  4J0S A;  5FB0 A;  5KTW A;  5F36 A;  5HQ7 A;  3ONI A;  4Z93 A;  2L84 A;  5TCM A;  2L85 A;  2FSA A;  4MR3 A;  5ENF A;  5HJC A;  5DKH A;  4NUD A;  5CQ6 A;  4PY6 A;  5FB1 A;  4QZS A;  5LKX A;  1E6I A;  4TT6 A;  4TT2 A;  5A85 A;  5C89 A;  3P5O A;  4QUT A;  4XUB A;  5E9V A;  4NRA A;  5E3D A;  5F1L A;  5E9K A;  4MEQ A;  4QSU A;  4A9E A;  4XUA A;  5EIC A;  5F5Z A;  2RNW A;  4QBM A;  4IR5 A;  5IGM A;  4IOR A;  5E74 A;  5C87 A;  3MUL A;  4UIU A;  4O74 A;  4J1P A;  5CUE A;  4PKL A;  2H60 A;  4NUC A;  2YDW A;  4ALG A;  4AKN A;  5EWV A;  4YYK A;  4Z1S A;  5BT3 A;  5HRX A;  2D82 A;  4OGI A;  5ENC A;  4IOO A;  4QSX A;  5DLX A;  5IG6 A;  4PCE A;  5LKT A;  5ETD A;  2R0S A;  4O71 A;  5CQA A;  4HBY A;  5ENI A;  5D24 A;  3O35 A;  5DYX A;  4FLP A;  5D3S A;  5FE0 A;  5L8U A;  2E7N A;  5D3P A;  4CFL A;  5A5S A;  5H1U A;  5E0R A;  4YYG A;  4HXR A;  4QSW A;  3IU5 A;  2N9G A;  1JM4 B;  5FBX A;  4HXS A;  4CUR A;  5F3A A;  4YYN A;  4WHW A;  1WUM A;  3MXF A;  4N4I A;  3DAI A;  3P1C A;  4UIY A;  5FFW A;  5IID A;  2YYN A;  5CQ4 A;  5D3J A;  4QYL A;  5II2 A;  4UYD A;  4BW3 A;  4CUP A;  4MR6 A;  2RS9 B;  4QSQ A;  4XY9 A;  4UIX A;  5E9I A;  4A9K A;  4CL9 A;  4Z6H A;  5F62 A;  4HXN A;  4QC3 A;  5L8T A;  5EIS A;  4YAB A;  2YEM A;  3UVY A;  4O70 A;  3MB3 A;  5DBM A;  4A9O A;  5CQ7 A;  4A9L A;  5A5O A;  5HRW A;  5FH8 A;  5HEN A;  5FFY A;  5FE2 A;  3SVF A;  3JVK A;  5J0D A;  1JSP B;  4WIV A;  5EQ1 A;  5A5N A;  5H1V A;  5D26 A;  1F68 A;  5A5Q A;  5F60 A;  5DKD A;  4IR4 A;  5CRM A;  5LJ0 A;  4YYM A;  4LZS A;  4O7C A;  2RO1 A;  4MR4 A;  5CTL A;  3ZYU A;  4QEW A;  5A5P A;  3U5P A;  5CUG A;  4YY6 A;  4TTE A;  4BW1 A;  5EWD A;  5ENG A;  4A9N A;  4O75 A;  2RFJ A;  5AME A;  2OO1 A;  5CS8 A;  5IBN A;  5E3G A;  3QZS A;  4CUT A;  2OSS A;  2D9E A;  5EGU A;  5HQ6 A;  5F2P A;  5DYC A;  5CQ3 A;  5C7N A;  5FE7 A;  4HBX A;  3O37 A;  3JVM A;  5CZG A;  5HFR A;  5LVQ A;  5I7X A;  3O36 A;  5KU3 A;  5I29 A;  4YYJ A;  1X0J A;  3D7C A;  4J0R A;  3JVL A;  5A7C A;  4YAD A;  5TB6 A;  4LYI A;  4ZC9 A;  2WP1 A;  5FFV A;  5HEM A;  4MEP A;  5F61 A;  4ZQL A;  3S92 A;  5C8G A;  5E9L A;  5FG4 A;  4LC2 A;  3O33 A;  5I80 A;  5E9Y A;  4TU4 A;  4PCI A;  3AAD A;  4YC9 A;  3UV4 A;  2L5E A;  5LUU A;  5D0C A;  4CFK A;  5IGN A;  5I88 A;  4N4F A;  4IR6 A;  4Q0N A;  4HXL A;  5EI4 A;  5ENJ A;  4TZ8 A;  4N4G A;  5ETB A;  3G0L A;  4TZ2 A;  5DFC A;  5FE9 A;  5G4R A;  3S91 A;  5ACY A;  4UIV A;  4Y03 A;  5L97 A;  4QNS A;  3HMH A;  5IGL A;  5LKZ A;  5CUC A;  4PS5 A;  3U5N A;  2KTB B;  4HXM A;  4QSS A;  2E3K A;  5F1H A;  2R0Y A;  4TT4 A;  4UYH A;  2OUO A;  3LQH A;  4TYL A;  3K2J A;  5CRZ A;  4O76 A;  4QSV A;  4Z1Q A;  5CY9 A;  5EPS A;  4Z6I A;  3UV5 A;  2YW5 A;  5L99 A;  3MB4 A;  2G4A A;  5A5R A;  4NRB A;  2DVR A;  4A9F A;  4YYH A;  4KCX A;  5FH7 A;  4YAT A;  5JWM A;  5CQ8 A;  5D7X A;  3P1F A;  2DWW A;  2GRC A;  4QR3 A;  5ENB A;  5AD2 A;  4UYE A;  4QYD A;  4LR6 A;  5FE1 A;  2WP2 A;  4C67 A;  5ENH A;  4GPJ A;  5I86 A;  5CUB A;  5HRV A;  4CUU A;  2RI7 A;  4BHW A;  4UYG A;  4QEV A;  5CGP A;  4QEU A;  4C66 A;  4YBT A;  4HBV A;  5L96 A;  5DYU A;  4TQN A;  5H1T A;  4YK0 A;  2RNX A;  4UIW A;  4E96 A;  4HBW A;  5CUD A;  3U5K A;  5JI8 A;  3LQJ A;  5LVR A;  3UVD A;  3P1E A;  3HMF A;  4HXP A;  4PTB A;  3SVG A;  5EWH A;  5C85 A;  5FH6 A;  4YAX A;  5KTX A;  5KTU A;  3JVJ A;  1WUG A;  2DKW A;  4O77 A;  5KHM A;  4YH4 A;  4MEO A;  4UYF B;  4NQM A;  4UYF A;  5A83 A;  4QY4 A;  5FG5 A;  2YEL A;  4NYW A;  5HM0 A;  4YBM A;  4LRG A;  2MJV B;  4NS5 A;  5CFW A;  5CU8 A;  4QB3 A;  3UVW A;  4O72 A;  5LJ1 A;  5A81 A;  1EQF A;  4A9H A;  2LSP B;  5E9M A;  2YQD A;  5COI A;  5BT5 A;  5EPR A;  5FG6 A;  4RVR A;  4A9J A;  3LQI A;  4O7B A;  3G0J A;  5I83 A;  4YH3 A;  2DVV A;  4YBS A;  4NR6 A;  4ALH A;  2I7K A;  5D3R A;  5BT4 A;  5DYA A;  5I1Q A;  5CUA A;  3DWY A;  5IGK A;  4XY8 A;  3O34 A;  5EPB A;  5E7D A;  2DVS A;  5DFB A;  3I3J A;  4YY4 A;  2DVQ A;  4O7A A;  4N3W A;  5DX4 A;  4BW4 A;  1ZS5 A;  4UIZ A;  4NYV A;  4MEN A;  5DFD A;  4X2I A;  2R0V A;  4LYW A;  3FKM X;  4CLB A;  4LZ2 A;  5I40 A;  4QST A;  3LXJ A;  5EV9 A;  4ZW1 A;  4LZR A;  5DLZ A;  4QC1 A;  4Q0O A;  5E73 A;  2R10 A;  5DY7 A;  2F6N A;  5AMF A;  3AQA A;  4F3I A;  4NR9 A;  4TS8 A;  4MR5 A;  5KO4 A;  3SVH A;  4A9M A;  4KV1 A;  2I8N A;  3MUK A;  4OGJ A;  5A82 A;  3U5J A;  3QZV A;  4HXK A;  3U5M A;  3UV2 A;  3U5O A;  5EU1 A;  4UIT A;  5EM3 A;  4YYI A;  5DW1 A;  4NUE A;  4KV4 A;  3MQM A;  4DON A;  5HEL A;  3UW9 A;  5G4S A;  5CQ5 A;  3RCW A;  4QR4 A;  4N4H A;  5FE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...