5C85A

Crystal structure of the human brpf1 bromodomain in complex with seed1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
molecule keywords Peregrin
molecule tags Dna binding protein
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c85A00
4CUTA 5L8UA 2GRCA 2YDWA 5I86A 5L99A 5CQ4A 5CZGA 4HXRA 5CY9A 3I3JA 4A9HA 4IR3A 4O78A 3ZYUA 5A5PA 2H60A 3MB4A 5CRMA 2R0YA 5C89A 2OUOA 4NUEA 5KTXA 5E7DA 4E96A 2E3KA 5LJ2A 5F63A 4YYMA 4QSVA 5FE2A 3HMHA 5EWWA 4LRGA 2N9GA 4AKNA 5JWMA 1X0JA 2WP1A 3S91A 5AD3A 4MENA 4J3IA 4OGJA 4NYVA 5ENEA 4HXOA 5I7YA 4MEPA 4A9IA 5C8GA 4UYFB 5DW1A 5L8TA 4BJXA 4HBXA 4MR4A 5CUDA 4QYLA 2KTBB 4QEVA 3LQJA 2RO1A 5COIA 4LC2A 4A9KA 5FG5A 5C87A 5LKTA 5FB0A 5ACYA 5AMEA 5D25A 5DW2A 5EI4A 4IR6A 5HLSA 3U5OA 4TYLA 4C66A 4A9LA 4UIVA 3U5PA 4N4GA 4IOOA 5J0DA 5F61A 4RVRA 4YYJA 5ENBA 5EM3A 5F1LA 5DX4A 4KCXA 4UYEA 5ENCA 3Q2FA 4WHUA 4YC9A 4NXJA 5D3JA 3U5KA 2L5EA 4UIWA 4NYWA 4PY6A 2OO1A 3RCWA 2YELA 2RS9B 5EK9A 4CL9A 1WUMA 3ONIA 4TT2A 4NUDA 5IG6A 4WHWA 4QSWA 5DLXA 5LKUA 3O37A 2FSAA 4HXKA 5CP5A 4ZQLA 5HELA 5D0CA 5C4QA 5EV9A 4QSTA 5EP7A 4ZC9A 4O70A 4N4HA 4BW1A 4CFKA 5I83A 4YYDA 5FE1A 5FG6A 4NQNA 5EQ1A 4ZW1A 3Q2EA 4YY6A 4QC1A 5LJ1A 3U5MA 3JVJA 3P1CA 5E0RA 4NYXA 4HXPA 5AD2A 5FE4A 4KV4A 5EPRA 4QEWA 4TT4A 4CFLA 4Z1SA 5CQAA 5II1A 5A82A 5HM0A 5LKZA 4LZSA 4NR7A 2RNXA 5CPEA 3O35A 4LYIA 4NUCA 4NS5A 3GG3A 2F6JA 4UYGA 2I7KA 5EPSA 4QUTA 4CUSA 5A5NA 2DVVA 5CU8A 5EPBA 5D7XA 5KO4A 5ENFA 3SVFA 2RNYA 4NRCA 4QY4A 4UIXA 5L97A 5CFWA 3U5JA 4KV1A 5BT4A 5DKDA 2I8NA 4Z6IA 4O72A 5HRVA 4A9FA 5ENJA 4QEUA 5D3PA 5E9YA 5KU3A 4IOQA 4QSSA 4YYGA 5I80A 3SVGA 4CLBA 5FH6A 5DFCA 5FE9A 2RFJA 5E9MA 3MXFA 2YQDA 5DY7A 5HQ6A 2RI7A 5BT3A 3UVYA 1EQFA 4QSRA 4X2IA 5AMFA 5LKXA 4LDFA 5ENGA 5A81A 5HFQA 4PTBA 5LUUA 4LZRA 5A5RA 3U5NA 5CQ3A 4HXSA 5FFVA 5FE8A 5DYAA 5FBXA 3K2JA 5IIDA 5D3RA 4J0RA 4TU6A 5EWVA 4J0SA 3HMFA 4TU4A 1JM4B 4XYAA 2LSPB 5HQ5A 4QBMA 4UIYA 3QZVA 5HFRA 2YW5A 5HEMA 5FG4A 4YYKA 4TTEA 5ENIA 4YBTA 5D3SA 4QR4A 3FKMX 3MB3A 2F6NA 5CUGA 5CUAA 2D82A 5FDZA 3P1EA 4O77A 5G4SA 3P1DA 5A5QA 4YATA 5D3HA 5F5ZA 4YADA 4A9EA 3IU5A 5F60A 5CS8A 4QNSA 5HENA 5KTWA 4UYDA 5DKHA 4O7AA 2OSSA 4N4FA 4YBMA 5E9IA 3JVMA 5IBNA 5TCMA 5C7NA 5CQ7A 4QB3A 5F2PA 2L85A 4XY9A 4NR8A 5IGNA 5DBMA 4UYFA 1WUGA 4TS8A 4QUUA 2DVQA 4A9MA 2R10A 4HBWA 5I7XA 4O74A 3LQIA 5E9LA 4YK0A 5F25A 1ZS5A 5I89A 3MQMA 4O7FA 3LQHA 5E74A 4N4IA 4HXNA 4OUFA 3DWYA 4MR5A 4BW3A 5IGLA 4O76A 4HXLA 4QR3A 5FE0A 4J1PA 5DYXA 5DKCA 3U5LA 5FE7A 5HCLA 5D24A 2YYNA 5EICA 5D26A 4QSQA 5FFWA 5A83A 4O75A 4NRBA 5H85A 3MULA 5E73A 5K29A 4PKLA 2DVRA 4UIZA 5ENHA 5ETBA 4HXMA 5CQ8A 4LYSA 5E9VA 4YYHA 3UVWA 5A5SA 4QR5A 5CRZA 5H1UA 5CQ6A 5FB1A 4MR6A 4MR3A 4NR6A 5A7CA 2E7OA 3JVLA 5F62A 3UVDA 2DVSA 4YYNA 4QSUA 4NR5A 3O33A 5DFBA 4NRAA 3IU6A 4CUPA 3S92A 5EWDA 5CQ5A 5KTUA 4DONA 2R0VA 5L98A 4O7BA 4YABA 4YH3A 5HJCA 2DATA 4YBSA 5FE6A 3P1FA 5EISA 2L84A 4GPJA 4TZ2A 5EGUA 4XY8A 5F36A 5LVRA 5DFDA 2D9EA 2R0SA 5HRWA 4HBVA 5JI8A 4O7EA 4QC3A 4XUBA 5E3GA 3LJWA 5KHMA 3HMEA 4Z93A 4TQNA 5C85A 4UITA 4C67A 3O36A 4ALGA 4IORA 5EA1A 5ETDA 4UYHA 4CUQA 4O71A 5A85A 5EWCA 5H1VA 5E9KA 2MJVB 4YH4A 3AQAA 2G4AA 4ALHA 4Q0NA 5I40A 2E7NA 4IR5A 3UW9A 5FE5A 2DWWA 5FE3A 4Z6HA 5EVAA 4YAXA 4NR9A 4FLPA 5DLZA 3MUKA 2NXBA 4TT6A 4YY4A 3QZSA 5CGPA 4IR4A 4QSXA 5FFYA 2WP2A 3O34A 4TZ8A 4Q0OA 5CUBA 5TB6A 4NQMA 4LYWA 3G0LA 4PS5A 5CQTA 5CUEA 2YEMA 5FH7A 5D3LA 4MEOA 4N3WA 3QZTA 3DAIA 3D7CA 5EWHA 4PCIA 2RNWA 3AADA 4LR6A 5FH8A 5CUCA 5H1TA 4MEQA 4QYDA 5F3AA 5LVQA 4WIVA 5L96A 4A9OA 4NR4A 1F68A 1E6IA 3UV5A 5LJ0A 3TLPA 4UIUA 3NXBA 4A9NA 4LZ2A 5D3TA 5G4RA 3UV2A 4CUUA 5DYCA 5HRXA 3SVHA 4BHWA 5IGKA 4YYIA 2YEKA 3LXJA 3UVXA 5A5OA 4XUAA 5F1HA 5I1QA 4O7CA 5I88A 5IGMA 4QSPA 5DYUA 2DKWA 4QZSA 5CTLA 5HQ7A 4BW4A 3UV4A 4OGIA 1JSPB 3G0JA 4HBYA 5I29A 3P5OA 4CURA 4BW2A 5E3DA 4PCEA 1N72A 5EU1A 5D3NA 3JVKA 4A9JA 4Z1QA 5BT5A 4Y03A 4F3IA 5II2A
chains in the Genus database with same CATH superfamily
4CUTA 5L8UA 2GRCA 2YDWA 5I86A 5L99A 5CQ4A 5CZGA 4HXRA 5CY9A 3I3JA 4A9HA 4IR3A 4O78A 3ZYUA 5A5PA 2H60A 3MB4A 5CRMA 2R0YA 5C89A 2OUOA 4NUEA 5KTXA 5E7DA 4E96A 2E3KA 5LJ2A 5F63A 4YYMA 4QSVA 5FE2A 3HMHA 5EWWA 4LRGA 2N9GA 4AKNA 5JWMA 1X0JA 2WP1A 3S91A 5AD3A 4MENA 4J3IA 4OGJA 4NYVA 5ENEA 4HXOA 5I7YA 4MEPA 4A9IA 5C8GA 4UYFB 5DW1A 5L8TA 4BJXA 4HBXA 4MR4A 5CUDA 4QYLA 2KTBB 4QEVA 3LQJA 2RO1A 5COIA 4LC2A 4A9KA 5FG5A 5C87A 5LKTA 3VKGA 5FB0A 5ACYA 5AMEA 5D25A 5DW2A 5EI4A 4IR6A 5HLSA 3U5OA 4TYLA 4C66A 4A9LA 4UIVA 3U5PA 4N4GA 4IOOA 5J0DA 5F61A 4RVRA 4YYJA 5ENBA 5EM3A 5F1LA 5DX4A 4KCXA 4UYEA 5ENCA 3Q2FA 4WHUA 4YC9A 4NXJA 5D3JA 3U5KA 2L5EA 4UIWA 4NYWA 4PY6A 2OO1A 3RCWA 2YELA 2RS9B 5EK9A 4CL9A 1WUMA 3ONIA 4TT2A 4NUDA 5IG6A 4WHWA 4QSWA 5DLXA 5LKUA 3O37A 2FSAA 4HXKA 5CP5A 4ZQLA 5HELA 5D0CA 5C4QA 5EV9A 4QSTA 5EP7A 4ZC9A 4O70A 4N4HA 4BW1A 4CFKA 5I83A 4YYDA 5FE1A 5FG6A 4NQNA 5EQ1A 4ZW1A 3Q2EA 4YY6A 4QC1A 5LJ1A 3U5MA 3JVJA 3P1CA 5E0RA 4NYXA 4HXPA 5AD2A 4AKHA 5FE4A 4KV4A 5EPRA 4QEWA 4TT4A 4CFLA 4Z1SA 5CQAA 5II1A 5A82A 5HM0A 5LKZA 4LZSA 4NR7A 2RNXA 5CPEA 3O35A 4LYIA 4NUCA 4NS5A 3GG3A 2F6JA 4UYGA 2I7KA 5EPSA 4QUTA 4CUSA 5A5NA 2DVVA 5CU8A 5EPBA 5D7XA 5KO4A 5ENFA 3SVFA 2RNYA 4NRCA 4QY4A 4UIXA 5L97A 5CFWA 3U5JA 4KV1A 5BT4A 5DKDA 2I8NA 4Z6IA 4O72A 5HRVA 4A9FA 3VKHA 5ENJA 4QEUA 5D3PA 1ZKRA 5E9YA 5KU3A 4IOQA 4QSSA 4YYGA 5I80A 3SVGA 4CLBA 5FH6A 5DFCA 5FE9A 2RFJA 5E9MA 3MXFA 2YQDA 5DY7A 5HQ6A 2RI7A 4AKIA 5BT3A 3UVYA 1EQFA 4QSRA 4X2IA 5AMFA 5LKXA 4LDFA 5ENGA 5A81A 5HFQA 4PTBA 5LUUA 4LZRA 5A5RA 3U5NA 5CQ3A 4HXSA 5FFVA 5FE8A 5DYAA 5FBXA 3K2JA 5IIDA 5D3RA 4J0RA 4TU6A 5EWVA 4J0SA 3HMFA 4TU4A 1JM4B 4XYAA 2LSPB 3D1BA 5HQ5A 4QBMA 4UIYA 3QZVA 5HFRA 2YW5A 5HEMA 5FG4A 4YYKA 4TTEA 5ENIA 4YBTA 5D3SA 4QR4A 3FKMX 3MB3A 2F6NA 5CUGA 5CUAA 2D82A 5FDZA 3P1EA 4O77A 5G4SA 3P1DA 5A5QA 4YATA 5D3HA 5F5ZA 4YADA 4A9EA 3IU5A 5F60A 5CS8A 4QNSA 5HENA 5KTWA 4UYDA 5DKHA 4O7AA 2OSSA 4N4FA 4YBMA 5E9IA 3JVMA 5IBNA 5TCMA 5C7NA 5CQ7A 4QB3A 5F2PA 2L85A 4XY9A 4NR8A 5IGNA 5DBMA 4UYFA 1WUGA 4TS8A 4QUUA 2DVQA 4A9MA 2R10A 4HBWA 5I7XA 4O74A 3LQIA 5E9LA 4YK0A 5F25A 1ZS5A 5I89A 3MQMA 4O7FA 3LQHA 5E74A 4N4IA 4HXNA 4OUFA 3DWYA 4MR5A 4BW3A 5IGLA 4O76A 4HXLA 4QR3A 5FE0A 2EJNA 4J1PA 5DYXA 5DKCA 3U5LA 5FE7A 5HCLA 5D24A 2YYNA 5EICA 5D26A 4QSQA 5FFWA 5A83A 4O75A 4NRBA 5H85A 3MULA 5E73A 5K29A 4PKLA 2DVRA 4UIZA 5ENHA 5ETBA 4HXMA 5CQ8A 4LYSA 5E9VA 4YYHA 3UVWA 5A5SA 4QR5A 5CRZA 5H1UA 5CQ6A 5FB1A 4MR6A 4MR3A 4NR6A 5A7CA 2E7OA 3JVLA 5F62A 3UVDA 2DVSA 4YYNA 4QSUA 4AKGA 4NR5A 3O33A 5DFBA 4NRAA 3IU6A 4CUPA 3S92A 5EWDA 5CQ5A 5KTUA 4DONA 2R0VA 5L98A 4O7BA 4YABA 4YH3A 5HJCA 2DATA 4YBSA 5FE6A 3P1FA 5EISA 2L84A 4GPJA 4AI6A 4TZ2A 5EGUA 4XY8A 5F36A 5LVRA 5DFDA 2D9EA 2R0SA 5HRWA 4HBVA 5JI8A 4O7EA 4QC3A 4XUBA 5E3GA 3LJWA 5KHMA 3HMEA 4Z93A 4TQNA 5C85A 4UITA 4C67A 3O36A 4ALGA 4IORA 5EA1A 5ETDA 4UYHA 4CUQA 4O71A 5A85A 5EWCA 5H1VA 5E9KA 2MJVB 4YH4A 3AQAA 2G4AA 4ALHA 4Q0NA 5I40A 2E7NA 4IR5A 3UW9A 5FE5A 2DWWA 5FE3A 4Z6HA 5EVAA 4YAXA 4NR9A 4FLPA 5DLZA 3MUKA 2NXBA 4TT6A 4YY4A 3QZSA 5CGPA 4IR4A 3D1DA 4QSXA 5FFYA 2WP2A 3O34A 1PUOA 4TZ8A 4Q0OA 5CUBA 5TB6A 4NQMA 4LYWA 3G0LA 4PS5A 5CQTA 5CUEA 2YEMA 5FH7A 5D3LA 4MEOA 4N3WA 3QZTA 3DAIA 3D7CA 5EWHA 4PCIA 2RNWA 3AADA 4LR6A 5FH8A 5CUCA 5H1TA 4MEQA 4QYDA 5F3AA 5LVQA 4WIVA 5L96A 4A9OA 4NR4A 1F68A 1E6IA 3UV5A 3ERRA 5LJ0A 3TLPA 4UIUA 3NXBA 4A9NA 4LZ2A 5D3TA 5G4RA 3UV2A 4CUUA 5DYCA 5HRXA 3SVHA 4BHWA 5IGKA 4YYIA 2YEKA 3LXJA 3UVXA 5A5OA 4XUAA 5F1HA 5I1QA 4O7CA 5I88A 5IGMA 4QSPA 5DYUA 2DKWA 4QZSA 5CTLA 5HQ7A 4BW4A 3UV4A 4OGIA 1JSPB 3G0JA 4HBYA 5I29A 3P5OA 4CURA 4BW2A 5E3DA 4PCEA 1N72A 5EU1A 5D3NA 3JVKA 4A9JA 4Z1QA 5BT5A 4Y03A 4F3IA 5II2A
chains in the Genus database with same CATH topology
4CUTA 5L8UA 2GRCA 2YDWA 5I86A 5L99A 5CQ4A 5CZGA 4HXRA 5CY9A 3I3JA 4A9HA 4IR3A 4O78A 3ZYUA 5A5PA 2H60A 3MB4A 5CRMA 2R0YA 5C89A 2OUOA 4NUEA 5KTXA 5E7DA 4E96A 2E3KA 5LJ2A 5F63A 4YYMA 4QSVA 5FE2A 3HMHA 5EWWA 4LRGA 2N9GA 4AKNA 5JWMA 1X0JA 2WP1A 3S91A 5AD3A 4MENA 4J3IA 4OGJA 4NYVA 5ENEA 4HXOA 5I7YA 4MEPA 4A9IA 5C8GA 4UYFB 5DW1A 5L8TA 4BJXA 4HBXA 4MR4A 5CUDA 4QYLA 2KTBB 4QEVA 3LQJA 2RO1A 5COIA 4LC2A 4A9KA 5FG5A 5C87A 5LKTA 5FB0A 5ACYA 5AMEA 5D25A 5DW2A 5EI4A 4IR6A 5HLSA 3U5OA 4TYLA 4C66A 4A9LA 4UIVA 3U5PA 4N4GA 4IOOA 5J0DA 5F61A 4RVRA 4YYJA 5ENBA 5EM3A 5F1LA 5DX4A 4KCXA 4UYEA 5ENCA 3Q2FA 4WHUA 4YC9A 4NXJA 5D3JA 3U5KA 2L5EA 4UIWA 4NYWA 4PY6A 2OO1A 3RCWA 2YELA 2RS9B 5EK9A 4CL9A 1WUMA 3ONIA 4TT2A 4NUDA 5IG6A 4WHWA 4QSWA 5DLXA 5LKUA 3O37A 2FSAA 4HXKA 5CP5A 4ZQLA 5HELA 5D0CA 5C4QA 5EV9A 4QSTA 5EP7A 4ZC9A 4O70A 4N4HA 4BW1A 4CFKA 5I83A 4YYDA 5FE1A 5FG6A 4NQNA 5EQ1A 4ZW1A 3Q2EA 4YY6A 4QC1A 5LJ1A 3U5MA 3JVJA 3P1CA 5E0RA 4NYXA 4HXPA 5AD2A 5FE4A 4KV4A 5EPRA 4QEWA 4TT4A 4CFLA 4Z1SA 5CQAA 5II1A 5A82A 5HM0A 5LKZA 4LZSA 4NR7A 2RNXA 5CPEA 3O35A 4LYIA 4NUCA 4NS5A 3GG3A 2F6JA 4UYGA 2I7KA 5EPSA 4QUTA 4CUSA 5A5NA 2DVVA 5CU8A 5EPBA 5D7XA 5KO4A 5ENFA 3SVFA 2RNYA 4NRCA 4QY4A 4UIXA 5L97A 5CFWA 3U5JA 4KV1A 5BT4A 5DKDA 2I8NA 4Z6IA 4O72A 5HRVA 4A9FA 5ENJA 4QEUA 5D3PA 5E9YA 5KU3A 4IOQA 4QSSA 4YYGA 5I80A 3SVGA 4CLBA 5FH6A 5DFCA 5FE9A 2RFJA 5E9MA 3MXFA 2YQDA 5DY7A 5HQ6A 2RI7A 5BT3A 3UVYA 1EQFA 4QSRA 4X2IA 5AMFA 5LKXA 4LDFA 5ENGA 5A81A 5HFQA 4PTBA 5LUUA 4LZRA 5A5RA 3U5NA 5CQ3A 4HXSA 5FFVA 5FE8A 5DYAA 5FBXA 3K2JA 5IIDA 5D3RA 4J0RA 4TU6A 5EWVA 4J0SA 3HMFA 4TU4A 1JM4B 4XYAA 2LSPB 5HQ5A 4QBMA 4UIYA 3QZVA 5HFRA 2YW5A 5HEMA 5FG4A 4YYKA 4TTEA 5ENIA 4YBTA 5D3SA 4QR4A 3FKMX 3MB3A 2F6NA 5CUGA 5CUAA 2D82A 5FDZA 3P1EA 4O77A 5G4SA 3P1DA 5A5QA 4YATA 5D3HA 5F5ZA 4YADA 4A9EA 3IU5A 5F60A 5CS8A 4QNSA 5HENA 5KTWA 4UYDA 5DKHA 4O7AA 2OSSA 4N4FA 4YBMA 5E9IA 3JVMA 5IBNA 5TCMA 5C7NA 5CQ7A 4QB3A 5F2PA 2L85A 4XY9A 4NR8A 5IGNA 5DBMA 4UYFA 1WUGA 4TS8A 4QUUA 2DVQA 4A9MA 2R10A 4HBWA 5I7XA 4O74A 3LQIA 5E9LA 4YK0A 5F25A 1ZS5A 5I89A 3MQMA 4O7FA 3LQHA 5E74A 4N4IA 4HXNA 4OUFA 3DWYA 4MR5A 4BW3A 5IGLA 4O76A 4HXLA 4QR3A 5FE0A 4J1PA 5DYXA 5DKCA 3U5LA 5FE7A 5HCLA 5D24A 2YYNA 5EICA 5D26A 4QSQA 5FFWA 5A83A 4O75A 4NRBA 5H85A 3MULA 5E73A 5K29A 4PKLA 2DVRA 4UIZA 5ENHA 5ETBA 4HXMA 5CQ8A 4LYSA 5E9VA 4YYHA 3UVWA 5A5SA 4QR5A 5CRZA 5H1UA 5CQ6A 5FB1A 4MR6A 4MR3A 4NR6A 5A7CA 2E7OA 3JVLA 5F62A 3UVDA 2DVSA 4YYNA 4QSUA 4NR5A 3O33A 5DFBA 4NRAA 3IU6A 4CUPA 3S92A 5EWDA 5CQ5A 5KTUA 4DONA 2R0VA 5L98A 4O7BA 4YABA 4YH3A 5HJCA 2DATA 4YBSA 5FE6A 3P1FA 5EISA 2L84A 4GPJA 4TZ2A 5EGUA 4XY8A 5F36A 5LVRA 5DFDA 2D9EA 2R0SA 5HRWA 4HBVA 5JI8A 4O7EA 4QC3A 4XUBA 5E3GA 3LJWA 5KHMA 3HMEA 4Z93A 4TQNA 5C85A 4UITA 4C67A 3O36A 4ALGA 4IORA 5EA1A 5ETDA 4UYHA 4CUQA 4O71A 5A85A 5EWCA 5H1VA 5E9KA 2MJVB 4YH4A 3AQAA 2G4AA 4ALHA 4Q0NA 5I40A 2E7NA 4IR5A 3UW9A 5FE5A 2DWWA 5FE3A 4Z6HA 5EVAA 4YAXA 4NR9A 4FLPA 5DLZA 3MUKA 2NXBA 4TT6A 4YY4A 3QZSA 5CGPA 4IR4A 4QSXA 5FFYA 2WP2A 3O34A 4TZ8A 4Q0OA 5CUBA 5TB6A 4NQMA 4LYWA 3G0LA 4PS5A 5CQTA 5CUEA 2YEMA 5FH7A 5D3LA 4MEOA 4N3WA 3QZTA 3DAIA 3D7CA 5EWHA 4PCIA 2RNWA 3AADA 4LR6A 5FH8A 5CUCA 5H1TA 4MEQA 4QYDA 5F3AA 5LVQA 4WIVA 5L96A 4A9OA 4NR4A 1F68A 1E6IA 3UV5A 5LJ0A 3TLPA 4UIUA 3NXBA 4A9NA 4LZ2A 5D3TA 5G4RA 3UV2A 4CUUA 5DYCA 5HRXA 3SVHA 4BHWA 5IGKA 4YYIA 2YEKA 3LXJA 3UVXA 5A5OA 4XUAA 5F1HA 5I1QA 4O7CA 5I88A 5IGMA 4QSPA 5DYUA 2DKWA 4QZSA 5CTLA 5HQ7A 4BW4A 3UV4A 4OGIA 1JSPB 3G0JA 4HBYA 5I29A 3P5OA 4CURA 4BW2A 5E3DA 4PCEA 1N72A 5EU1A 5D3NA 3JVKA 4A9JA 4Z1QA 5BT5A 4Y03A 4F3IA 5II2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUT A;  5L8U A;  2GRC A;  2YDW A;  5I86 A;  5L99 A;  5CQ4 A;  5CZG A;  4HXR A;  5CY9 A;  3I3J A;  4A9H A;  4IR3 A;  4O78 A;  3ZYU A;  5A5P A;  2H60 A;  3MB4 A;  5CRM A;  2R0Y A;  5C89 A;  2OUO A;  4NUE A;  5KTX A;  5E7D A;  4E96 A;  2E3K A;  5LJ2 A;  5F63 A;  4YYM A;  4QSV A;  5FE2 A;  3HMH A;  5EWW A;  4LRG A;  2N9G A;  4AKN A;  5JWM A;  1X0J A;  2WP1 A;  3S91 A;  5AD3 A;  4MEN A;  4J3I A;  4OGJ A;  4NYV A;  5ENE A;  4HXO A;  5I7Y A;  4MEP A;  4A9I A;  5C8G A;  4UYF B;  5DW1 A;  5L8T A;  4BJX A;  4HBX A;  4MR4 A;  5CUD A;  4QYL A;  2KTB B;  4QEV A;  3LQJ A;  2RO1 A;  5COI A;  4LC2 A;  4A9K A;  5FG5 A;  5C87 A;  5LKT A;  5FB0 A;  5ACY A;  5AME A;  5D25 A;  5DW2 A;  5EI4 A;  4IR6 A;  5HLS A;  3U5O A;  4TYL A;  4C66 A;  4A9L A;  4UIV A;  3U5P A;  4N4G A;  4IOO A;  5J0D A;  5F61 A;  4RVR A;  4YYJ A;  5ENB A;  5EM3 A;  5F1L A;  5DX4 A;  4KCX A;  4UYE A;  5ENC A;  3Q2F A;  4WHU A;  4YC9 A;  4NXJ A;  5D3J A;  3U5K A;  2L5E A;  4UIW A;  4NYW A;  4PY6 A;  2OO1 A;  3RCW A;  2YEL A;  2RS9 B;  5EK9 A;  4CL9 A;  1WUM A;  3ONI A;  4TT2 A;  4NUD A;  5IG6 A;  4WHW A;  4QSW A;  5DLX A;  5LKU A;  3O37 A;  2FSA A;  4HXK A;  5CP5 A;  4ZQL A;  5HEL A;  5D0C A;  5C4Q A;  5EV9 A;  4QST A;  5EP7 A;  4ZC9 A;  4O70 A;  4N4H A;  4BW1 A;  4CFK A;  5I83 A;  4YYD A;  5FE1 A;  5FG6 A;  4NQN A;  5EQ1 A;  4ZW1 A;  3Q2E A;  4YY6 A;  4QC1 A;  5LJ1 A;  3U5M A;  3JVJ A;  3P1C A;  5E0R A;  4NYX A;  4HXP A;  5AD2 A;  5FE4 A;  4KV4 A;  5EPR A;  4QEW A;  4TT4 A;  4CFL A;  4Z1S A;  5CQA A;  5II1 A;  5A82 A;  5HM0 A;  5LKZ A;  4LZS A;  4NR7 A;  2RNX A;  5CPE A;  3O35 A;  4LYI A;  4NUC A;  4NS5 A;  3GG3 A;  2F6J A;  4UYG A;  2I7K A;  5EPS A;  4QUT A;  4CUS A;  5A5N A;  2DVV A;  5CU8 A;  5EPB A;  5D7X A;  5KO4 A;  5ENF A;  3SVF A;  2RNY A;  4NRC A;  4QY4 A;  4UIX A;  5L97 A;  5CFW A;  3U5J A;  4KV1 A;  5BT4 A;  5DKD A;  2I8N A;  4Z6I A;  4O72 A;  5HRV A;  4A9F A;  5ENJ A;  4QEU A;  5D3P A;  5E9Y A;  5KU3 A;  4IOQ A;  4QSS A;  4YYG A;  5I80 A;  3SVG A;  4CLB A;  5FH6 A;  5DFC A;  5FE9 A;  2RFJ A;  5E9M A;  3MXF A;  2YQD A;  5DY7 A;  5HQ6 A;  2RI7 A;  5BT3 A;  3UVY A;  1EQF A;  4QSR A;  4X2I A;  5AMF A;  5LKX A;  4LDF A;  5ENG A;  5A81 A;  5HFQ A;  4PTB A;  5LUU A;  4LZR A;  5A5R A;  3U5N A;  5CQ3 A;  4HXS A;  5FFV A;  5FE8 A;  5DYA A;  5FBX A;  3K2J A;  5IID A;  5D3R A;  4J0R A;  4TU6 A;  5EWV A;  4J0S A;  3HMF A;  4TU4 A;  1JM4 B;  4XYA A;  2LSP B;  5HQ5 A;  4QBM A;  4UIY A;  3QZV A;  5HFR A;  2YW5 A;  5HEM A;  5FG4 A;  4YYK A;  4TTE A;  5ENI A;  4YBT A;  5D3S A;  4QR4 A;  3FKM X;  3MB3 A;  2F6N A;  5CUG A;  5CUA A;  2D82 A;  5FDZ A;  3P1E A;  4O77 A;  5G4S A;  3P1D A;  5A5Q A;  4YAT A;  5D3H A;  5F5Z A;  4YAD A;  4A9E A;  3IU5 A;  5F60 A;  5CS8 A;  4QNS A;  5HEN A;  5KTW A;  4UYD A;  5DKH A;  4O7A A;  2OSS A;  4N4F A;  4YBM A;  5E9I A;  3JVM A;  5IBN A;  5TCM A;  5C7N A;  5CQ7 A;  4QB3 A;  5F2P A;  2L85 A;  4XY9 A;  4NR8 A;  5IGN A;  5DBM A;  4UYF A;  1WUG A;  4TS8 A;  4QUU A;  2DVQ A;  4A9M A;  2R10 A;  4HBW A;  5I7X A;  4O74 A;  3LQI A;  5E9L A;  4YK0 A;  5F25 A;  1ZS5 A;  5I89 A;  3MQM A;  4O7F A;  3LQH A;  5E74 A;  4N4I A;  4HXN A;  4OUF A;  3DWY A;  4MR5 A;  4BW3 A;  5IGL A;  4O76 A;  4HXL A;  4QR3 A;  5FE0 A;  4J1P A;  5DYX A;  5DKC A;  3U5L A;  5FE7 A;  5HCL A;  5D24 A;  2YYN A;  5EIC A;  5D26 A;  4QSQ A;  5FFW A;  5A83 A;  4O75 A;  4NRB A;  5H85 A;  3MUL A;  5E73 A;  5K29 A;  4PKL A;  2DVR A;  4UIZ A;  5ENH A;  5ETB A;  4HXM A;  5CQ8 A;  4LYS A;  5E9V A;  4YYH A;  3UVW A;  5A5S A;  4QR5 A;  5CRZ A;  5H1U A;  5CQ6 A;  5FB1 A;  4MR6 A;  4MR3 A;  4NR6 A;  5A7C A;  2E7O A;  3JVL A;  5F62 A;  3UVD A;  2DVS A;  4YYN A;  4QSU A;  4NR5 A;  3O33 A;  5DFB A;  4NRA A;  3IU6 A;  4CUP A;  3S92 A;  5EWD A;  5CQ5 A;  5KTU A;  4DON A;  2R0V A;  5L98 A;  4O7B A;  4YAB A;  4YH3 A;  5HJC A;  2DAT A;  4YBS A;  5FE6 A;  3P1F A;  5EIS A;  2L84 A;  4GPJ A;  4TZ2 A;  5EGU A;  4XY8 A;  5F36 A;  5LVR A;  5DFD A;  2D9E A;  2R0S A;  5HRW A;  4HBV A;  5JI8 A;  4O7E A;  4QC3 A;  4XUB A;  5E3G A;  3LJW A;  5KHM A;  3HME A;  4Z93 A;  4TQN A;  5C85 A;  4UIT A;  4C67 A;  3O36 A;  4ALG A;  4IOR A;  5EA1 A;  5ETD A;  4UYH A;  4CUQ A;  4O71 A;  5A85 A;  5EWC A;  5H1V A;  5E9K A;  2MJV B;  4YH4 A;  3AQA A;  2G4A A;  4ALH A;  4Q0N A;  5I40 A;  2E7N A;  4IR5 A;  3UW9 A;  5FE5 A;  2DWW A;  5FE3 A;  4Z6H A;  5EVA A;  4YAX A;  4NR9 A;  4FLP A;  5DLZ A;  3MUK A;  2NXB A;  4TT6 A;  4YY4 A;  3QZS A;  5CGP A;  4IR4 A;  4QSX A;  5FFY A;  2WP2 A;  3O34 A;  4TZ8 A;  4Q0O A;  5CUB A;  5TB6 A;  4NQM A;  4LYW A;  3G0L A;  4PS5 A;  5CQT A;  5CUE A;  2YEM A;  5FH7 A;  5D3L A;  4MEO A;  4N3W A;  3QZT A;  3DAI A;  3D7C A;  5EWH A;  4PCI A;  2RNW A;  3AAD A;  4LR6 A;  5FH8 A;  5CUC A;  5H1T A;  4MEQ A;  4QYD A;  5F3A A;  5LVQ A;  4WIV A;  5L96 A;  4A9O A;  4NR4 A;  1F68 A;  1E6I A;  3UV5 A;  5LJ0 A;  3TLP A;  4UIU A;  3NXB A;  4A9N A;  4LZ2 A;  5D3T A;  5G4R A;  3UV2 A;  4CUU A;  5DYC A;  5HRX A;  3SVH A;  4BHW A;  5IGK A;  4YYI A;  2YEK A;  3LXJ A;  3UVX A;  5A5O A;  4XUA A;  5F1H A;  5I1Q A;  4O7C A;  5I88 A;  5IGM A;  4QSP A;  5DYU A;  2DKW A;  4QZS A;  5CTL A;  5HQ7 A;  4BW4 A;  3UV4 A;  4OGI A;  1JSP B;  3G0J A;  4HBY A;  5I29 A;  3P5O A;  4CUR A;  4BW2 A;  5E3D A;  4PCE A;  1N72 A;  5EU1 A;  5D3N A;  3JVK A;  4A9J A;  4Z1Q A;  5BT5 A;  4Y03 A;  4F3I A;  5II2 A; 
#chains in the Genus database with same CATH topology
 4CUT A;  5L8U A;  2GRC A;  2YDW A;  5I86 A;  5L99 A;  5CQ4 A;  5CZG A;  4HXR A;  5CY9 A;  3I3J A;  4A9H A;  4IR3 A;  4O78 A;  3ZYU A;  5A5P A;  2H60 A;  3MB4 A;  5CRM A;  2R0Y A;  5C89 A;  2OUO A;  4NUE A;  5KTX A;  5E7D A;  4E96 A;  2E3K A;  5LJ2 A;  5F63 A;  4YYM A;  4QSV A;  5FE2 A;  3HMH A;  5EWW A;  4LRG A;  2N9G A;  4AKN A;  5JWM A;  1X0J A;  2WP1 A;  3S91 A;  5AD3 A;  4MEN A;  4J3I A;  4OGJ A;  4NYV A;  5ENE A;  4HXO A;  5I7Y A;  4MEP A;  4A9I A;  5C8G A;  4UYF B;  5DW1 A;  5L8T A;  4BJX A;  4HBX A;  4MR4 A;  5CUD A;  4QYL A;  2KTB B;  4QEV A;  3LQJ A;  2RO1 A;  5COI A;  4LC2 A;  4A9K A;  5FG5 A;  5C87 A;  5LKT A;  3VKG A;  5FB0 A;  5ACY A;  5AME A;  5D25 A;  5DW2 A;  5EI4 A;  4IR6 A;  5HLS A;  3U5O A;  4TYL A;  4C66 A;  4A9L A;  4UIV A;  3U5P A;  4N4G A;  4IOO A;  5J0D A;  5F61 A;  4RVR A;  4YYJ A;  5ENB A;  5EM3 A;  5F1L A;  5DX4 A;  4KCX A;  4UYE A;  5ENC A;  3Q2F A;  4WHU A;  4YC9 A;  4NXJ A;  5D3J A;  3U5K A;  2L5E A;  4UIW A;  4NYW A;  4PY6 A;  2OO1 A;  3RCW A;  2YEL A;  2RS9 B;  5EK9 A;  4CL9 A;  1WUM A;  3ONI A;  4TT2 A;  4NUD A;  5IG6 A;  4WHW A;  4QSW A;  5DLX A;  5LKU A;  3O37 A;  2FSA A;  4HXK A;  5CP5 A;  4ZQL A;  5HEL A;  5D0C A;  5C4Q A;  5EV9 A;  4QST A;  5EP7 A;  4ZC9 A;  4O70 A;  4N4H A;  4BW1 A;  4CFK A;  5I83 A;  4YYD A;  5FE1 A;  5FG6 A;  4NQN A;  5EQ1 A;  4ZW1 A;  3Q2E A;  4YY6 A;  4QC1 A;  5LJ1 A;  3U5M A;  3JVJ A;  3P1C A;  5E0R A;  4NYX A;  4HXP A;  5AD2 A;  4AKH A;  5FE4 A;  4KV4 A;  5EPR A;  4QEW A;  4TT4 A;  4CFL A;  4Z1S A;  5CQA A;  5II1 A;  5A82 A;  5HM0 A;  5LKZ A;  4LZS A;  4NR7 A;  2RNX A;  5CPE A;  3O35 A;  4LYI A;  4NUC A;  4NS5 A;  3GG3 A;  2F6J A;  4UYG A;  2I7K A;  5EPS A;  4QUT A;  4CUS A;  5A5N A;  2DVV A;  5CU8 A;  5EPB A;  5D7X A;  5KO4 A;  5ENF A;  3SVF A;  2RNY A;  4NRC A;  4QY4 A;  4UIX A;  5L97 A;  5CFW A;  3U5J A;  4KV1 A;  5BT4 A;  5DKD A;  2I8N A;  4Z6I A;  4O72 A;  5HRV A;  4A9F A;  3VKH A;  5ENJ A;  4QEU A;  5D3P A;  1ZKR A;  5E9Y A;  5KU3 A;  4IOQ A;  4QSS A;  4YYG A;  5I80 A;  3SVG A;  4CLB A;  5FH6 A;  5DFC A;  5FE9 A;  2RFJ A;  5E9M A;  3MXF A;  2YQD A;  5DY7 A;  5HQ6 A;  2RI7 A;  4AKI A;  5BT3 A;  3UVY A;  1EQF A;  4QSR A;  4X2I A;  5AMF A;  5LKX A;  4LDF A;  5ENG A;  5A81 A;  5HFQ A;  4PTB A;  5LUU A;  4LZR A;  5A5R A;  3U5N A;  5CQ3 A;  4HXS A;  5FFV A;  5FE8 A;  5DYA A;  5FBX A;  3K2J A;  5IID A;  5D3R A;  4J0R A;  4TU6 A;  5EWV A;  4J0S A;  3HMF A;  4TU4 A;  1JM4 B;  4XYA A;  2LSP B;  3D1B A;  5HQ5 A;  4QBM A;  4UIY A;  3QZV A;  5HFR A;  2YW5 A;  5HEM A;  5FG4 A;  4YYK A;  4TTE A;  5ENI A;  4YBT A;  5D3S A;  4QR4 A;  3FKM X;  3MB3 A;  2F6N A;  5CUG A;  5CUA A;  2D82 A;  5FDZ A;  3P1E A;  4O77 A;  5G4S A;  3P1D A;  5A5Q A;  4YAT A;  5D3H A;  5F5Z A;  4YAD A;  4A9E A;  3IU5 A;  5F60 A;  5CS8 A;  4QNS A;  5HEN A;  5KTW A;  4UYD A;  5DKH A;  4O7A A;  2OSS A;  4N4F A;  4YBM A;  5E9I A;  3JVM A;  5IBN A;  5TCM A;  5C7N A;  5CQ7 A;  4QB3 A;  5F2P A;  2L85 A;  4XY9 A;  4NR8 A;  5IGN A;  5DBM A;  4UYF A;  1WUG A;  4TS8 A;  4QUU A;  2DVQ A;  4A9M A;  2R10 A;  4HBW A;  5I7X A;  4O74 A;  3LQI A;  5E9L A;  4YK0 A;  5F25 A;  1ZS5 A;  5I89 A;  3MQM A;  4O7F A;  3LQH A;  5E74 A;  4N4I A;  4HXN A;  4OUF A;  3DWY A;  4MR5 A;  4BW3 A;  5IGL A;  4O76 A;  4HXL A;  4QR3 A;  5FE0 A;  2EJN A;  4J1P A;  5DYX A;  5DKC A;  3U5L A;  5FE7 A;  5HCL A;  5D24 A;  2YYN A;  5EIC A;  5D26 A;  4QSQ A;  5FFW A;  5A83 A;  4O75 A;  4NRB A;  5H85 A;  3MUL A;  5E73 A;  5K29 A;  4PKL A;  2DVR A;  4UIZ A;  5ENH A;  5ETB A;  4HXM A;  5CQ8 A;  4LYS A;  5E9V A;  4YYH A;  3UVW A;  5A5S A;  4QR5 A;  5CRZ A;  5H1U A;  5CQ6 A;  5FB1 A;  4MR6 A;  4MR3 A;  4NR6 A;  5A7C A;  2E7O A;  3JVL A;  5F62 A;  3UVD A;  2DVS A;  4YYN A;  4QSU A;  4AKG A;  4NR5 A;  3O33 A;  5DFB A;  4NRA A;  3IU6 A;  4CUP A;  3S92 A;  5EWD A;  5CQ5 A;  5KTU A;  4DON A;  2R0V A;  5L98 A;  4O7B A;  4YAB A;  4YH3 A;  5HJC A;  2DAT A;  4YBS A;  5FE6 A;  3P1F A;  5EIS A;  2L84 A;  4GPJ A;  4AI6 A;  4TZ2 A;  5EGU A;  4XY8 A;  5F36 A;  5LVR A;  5DFD A;  2D9E A;  2R0S A;  5HRW A;  4HBV A;  5JI8 A;  4O7E A;  4QC3 A;  4XUB A;  5E3G A;  3LJW A;  5KHM A;  3HME A;  4Z93 A;  4TQN A;  5C85 A;  4UIT A;  4C67 A;  3O36 A;  4ALG A;  4IOR A;  5EA1 A;  5ETD A;  4UYH A;  4CUQ A;  4O71 A;  5A85 A;  5EWC A;  5H1V A;  5E9K A;  2MJV B;  4YH4 A;  3AQA A;  2G4A A;  4ALH A;  4Q0N A;  5I40 A;  2E7N A;  4IR5 A;  3UW9 A;  5FE5 A;  2DWW A;  5FE3 A;  4Z6H A;  5EVA A;  4YAX A;  4NR9 A;  4FLP A;  5DLZ A;  3MUK A;  2NXB A;  4TT6 A;  4YY4 A;  3QZS A;  5CGP A;  4IR4 A;  3D1D A;  4QSX A;  5FFY A;  2WP2 A;  3O34 A;  1PUO A;  4TZ8 A;  4Q0O A;  5CUB A;  5TB6 A;  4NQM A;  4LYW A;  3G0L A;  4PS5 A;  5CQT A;  5CUE A;  2YEM A;  5FH7 A;  5D3L A;  4MEO A;  4N3W A;  3QZT A;  3DAI A;  3D7C A;  5EWH A;  4PCI A;  2RNW A;  3AAD A;  4LR6 A;  5FH8 A;  5CUC A;  5H1T A;  4MEQ A;  4QYD A;  5F3A A;  5LVQ A;  4WIV A;  5L96 A;  4A9O A;  4NR4 A;  1F68 A;  1E6I A;  3UV5 A;  3ERR A;  5LJ0 A;  3TLP A;  4UIU A;  3NXB A;  4A9N A;  4LZ2 A;  5D3T A;  5G4R A;  3UV2 A;  4CUU A;  5DYC A;  5HRX A;  3SVH A;  4BHW A;  5IGK A;  4YYI A;  2YEK A;  3LXJ A;  3UVX A;  5A5O A;  4XUA A;  5F1H A;  5I1Q A;  4O7C A;  5I88 A;  5IGM A;  4QSP A;  5DYU A;  2DKW A;  4QZS A;  5CTL A;  5HQ7 A;  4BW4 A;  3UV4 A;  4OGI A;  1JSP B;  3G0J A;  4HBY A;  5I29 A;  3P5O A;  4CUR A;  4BW2 A;  5E3D A;  4PCE A;  1N72 A;  5EU1 A;  5D3N A;  3JVK A;  4A9J A;  4Z1Q A;  5BT5 A;  4Y03 A;  4F3I A;  5II2 A; 
#chains in the Genus database with same CATH homology
 4CUT A;  5L8U A;  2GRC A;  2YDW A;  5I86 A;  5L99 A;  5CQ4 A;  5CZG A;  4HXR A;  5CY9 A;  3I3J A;  4A9H A;  4IR3 A;  4O78 A;  3ZYU A;  5A5P A;  2H60 A;  3MB4 A;  5CRM A;  2R0Y A;  5C89 A;  2OUO A;  4NUE A;  5KTX A;  5E7D A;  4E96 A;  2E3K A;  5LJ2 A;  5F63 A;  4YYM A;  4QSV A;  5FE2 A;  3HMH A;  5EWW A;  4LRG A;  2N9G A;  4AKN A;  5JWM A;  1X0J A;  2WP1 A;  3S91 A;  5AD3 A;  4MEN A;  4J3I A;  4OGJ A;  4NYV A;  5ENE A;  4HXO A;  5I7Y A;  4MEP A;  4A9I A;  5C8G A;  4UYF B;  5DW1 A;  5L8T A;  4BJX A;  4HBX A;  4MR4 A;  5CUD A;  4QYL A;  2KTB B;  4QEV A;  3LQJ A;  2RO1 A;  5COI A;  4LC2 A;  4A9K A;  5FG5 A;  5C87 A;  5LKT A;  5FB0 A;  5ACY A;  5AME A;  5D25 A;  5DW2 A;  5EI4 A;  4IR6 A;  5HLS A;  3U5O A;  4TYL A;  4C66 A;  4A9L A;  4UIV A;  3U5P A;  4N4G A;  4IOO A;  5J0D A;  5F61 A;  4RVR A;  4YYJ A;  5ENB A;  5EM3 A;  5F1L A;  5DX4 A;  4KCX A;  4UYE A;  5ENC A;  3Q2F A;  4WHU A;  4YC9 A;  4NXJ A;  5D3J A;  3U5K A;  2L5E A;  4UIW A;  4NYW A;  4PY6 A;  2OO1 A;  3RCW A;  2YEL A;  2RS9 B;  5EK9 A;  4CL9 A;  1WUM A;  3ONI A;  4TT2 A;  4NUD A;  5IG6 A;  4WHW A;  4QSW A;  5DLX A;  5LKU A;  3O37 A;  2FSA A;  4HXK A;  5CP5 A;  4ZQL A;  5HEL A;  5D0C A;  5C4Q A;  5EV9 A;  4QST A;  5EP7 A;  4ZC9 A;  4O70 A;  4N4H A;  4BW1 A;  4CFK A;  5I83 A;  4YYD A;  5FE1 A;  5FG6 A;  4NQN A;  5EQ1 A;  4ZW1 A;  3Q2E A;  4YY6 A;  4QC1 A;  5LJ1 A;  3U5M A;  3JVJ A;  3P1C A;  5E0R A;  4NYX A;  4HXP A;  5AD2 A;  5FE4 A;  4KV4 A;  5EPR A;  4QEW A;  4TT4 A;  4CFL A;  4Z1S A;  5CQA A;  5II1 A;  5A82 A;  5HM0 A;  5LKZ A;  4LZS A;  4NR7 A;  2RNX A;  5CPE A;  3O35 A;  4LYI A;  4NUC A;  4NS5 A;  3GG3 A;  2F6J A;  4UYG A;  2I7K A;  5EPS A;  4QUT A;  4CUS A;  5A5N A;  2DVV A;  5CU8 A;  5EPB A;  5D7X A;  5KO4 A;  5ENF A;  3SVF A;  2RNY A;  4NRC A;  4QY4 A;  4UIX A;  5L97 A;  5CFW A;  3U5J A;  4KV1 A;  5BT4 A;  5DKD A;  2I8N A;  4Z6I A;  4O72 A;  5HRV A;  4A9F A;  5ENJ A;  4QEU A;  5D3P A;  5E9Y A;  5KU3 A;  4IOQ A;  4QSS A;  4YYG A;  5I80 A;  3SVG A;  4CLB A;  5FH6 A;  5DFC A;  5FE9 A;  2RFJ A;  5E9M A;  3MXF A;  2YQD A;  5DY7 A;  5HQ6 A;  2RI7 A;  5BT3 A;  3UVY A;  1EQF A;  4QSR A;  4X2I A;  5AMF A;  5LKX A;  4LDF A;  5ENG A;  5A81 A;  5HFQ A;  4PTB A;  5LUU A;  4LZR A;  5A5R A;  3U5N A;  5CQ3 A;  4HXS A;  5FFV A;  5FE8 A;  5DYA A;  5FBX A;  3K2J A;  5IID A;  5D3R A;  4J0R A;  4TU6 A;  5EWV A;  4J0S A;  3HMF A;  4TU4 A;  1JM4 B;  4XYA A;  2LSP B;  5HQ5 A;  4QBM A;  4UIY A;  3QZV A;  5HFR A;  2YW5 A;  5HEM A;  5FG4 A;  4YYK A;  4TTE A;  5ENI A;  4YBT A;  5D3S A;  4QR4 A;  3FKM X;  3MB3 A;  2F6N A;  5CUG A;  5CUA A;  2D82 A;  5FDZ A;  3P1E A;  4O77 A;  5G4S A;  3P1D A;  5A5Q A;  4YAT A;  5D3H A;  5F5Z A;  4YAD A;  4A9E A;  3IU5 A;  5F60 A;  5CS8 A;  4QNS A;  5HEN A;  5KTW A;  4UYD A;  5DKH A;  4O7A A;  2OSS A;  4N4F A;  4YBM A;  5E9I A;  3JVM A;  5IBN A;  5TCM A;  5C7N A;  5CQ7 A;  4QB3 A;  5F2P A;  2L85 A;  4XY9 A;  4NR8 A;  5IGN A;  5DBM A;  4UYF A;  1WUG A;  4TS8 A;  4QUU A;  2DVQ A;  4A9M A;  2R10 A;  4HBW A;  5I7X A;  4O74 A;  3LQI A;  5E9L A;  4YK0 A;  5F25 A;  1ZS5 A;  5I89 A;  3MQM A;  4O7F A;  3LQH A;  5E74 A;  4N4I A;  4HXN A;  4OUF A;  3DWY A;  4MR5 A;  4BW3 A;  5IGL A;  4O76 A;  4HXL A;  4QR3 A;  5FE0 A;  4J1P A;  5DYX A;  5DKC A;  3U5L A;  5FE7 A;  5HCL A;  5D24 A;  2YYN A;  5EIC A;  5D26 A;  4QSQ A;  5FFW A;  5A83 A;  4O75 A;  4NRB A;  5H85 A;  3MUL A;  5E73 A;  5K29 A;  4PKL A;  2DVR A;  4UIZ A;  5ENH A;  5ETB A;  4HXM A;  5CQ8 A;  4LYS A;  5E9V A;  4YYH A;  3UVW A;  5A5S A;  4QR5 A;  5CRZ A;  5H1U A;  5CQ6 A;  5FB1 A;  4MR6 A;  4MR3 A;  4NR6 A;  5A7C A;  2E7O A;  3JVL A;  5F62 A;  3UVD A;  2DVS A;  4YYN A;  4QSU A;  4NR5 A;  3O33 A;  5DFB A;  4NRA A;  3IU6 A;  4CUP A;  3S92 A;  5EWD A;  5CQ5 A;  5KTU A;  4DON A;  2R0V A;  5L98 A;  4O7B A;  4YAB A;  4YH3 A;  5HJC A;  2DAT A;  4YBS A;  5FE6 A;  3P1F A;  5EIS A;  2L84 A;  4GPJ A;  4TZ2 A;  5EGU A;  4XY8 A;  5F36 A;  5LVR A;  5DFD A;  2D9E A;  2R0S A;  5HRW A;  4HBV A;  5JI8 A;  4O7E A;  4QC3 A;  4XUB A;  5E3G A;  3LJW A;  5KHM A;  3HME A;  4Z93 A;  4TQN A;  5C85 A;  4UIT A;  4C67 A;  3O36 A;  4ALG A;  4IOR A;  5EA1 A;  5ETD A;  4UYH A;  4CUQ A;  4O71 A;  5A85 A;  5EWC A;  5H1V A;  5E9K A;  2MJV B;  4YH4 A;  3AQA A;  2G4A A;  4ALH A;  4Q0N A;  5I40 A;  2E7N A;  4IR5 A;  3UW9 A;  5FE5 A;  2DWW A;  5FE3 A;  4Z6H A;  5EVA A;  4YAX A;  4NR9 A;  4FLP A;  5DLZ A;  3MUK A;  2NXB A;  4TT6 A;  4YY4 A;  3QZS A;  5CGP A;  4IR4 A;  4QSX A;  5FFY A;  2WP2 A;  3O34 A;  4TZ8 A;  4Q0O A;  5CUB A;  5TB6 A;  4NQM A;  4LYW A;  3G0L A;  4PS5 A;  5CQT A;  5CUE A;  2YEM A;  5FH7 A;  5D3L A;  4MEO A;  4N3W A;  3QZT A;  3DAI A;  3D7C A;  5EWH A;  4PCI A;  2RNW A;  3AAD A;  4LR6 A;  5FH8 A;  5CUC A;  5H1T A;  4MEQ A;  4QYD A;  5F3A A;  5LVQ A;  4WIV A;  5L96 A;  4A9O A;  4NR4 A;  1F68 A;  1E6I A;  3UV5 A;  5LJ0 A;  3TLP A;  4UIU A;  3NXB A;  4A9N A;  4LZ2 A;  5D3T A;  5G4R A;  3UV2 A;  4CUU A;  5DYC A;  5HRX A;  3SVH A;  4BHW A;  5IGK A;  4YYI A;  2YEK A;  3LXJ A;  3UVX A;  5A5O A;  4XUA A;  5F1H A;  5I1Q A;  4O7C A;  5I88 A;  5IGM A;  4QSP A;  5DYU A;  2DKW A;  4QZS A;  5CTL A;  5HQ7 A;  4BW4 A;  3UV4 A;  4OGI A;  1JSP B;  3G0J A;  4HBY A;  5I29 A;  3P5O A;  4CUR A;  4BW2 A;  5E3D A;  4PCE A;  1N72 A;  5EU1 A;  5D3N A;  3JVK A;  4A9J A;  4Z1Q A;  5BT5 A;  4Y03 A;  4F3I A;  5II2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...