5C87A

Crystal structure of the human brpf1 bromodomain in complex with seed2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
molecule keywords Peregrin
molecule tags Dna binding protein
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c87A00
5EPSA 5CU8A 5E9KA 5FH7A 4Z6IA 2YELA 3I3JA 2F6JA 5A5SA 3G0LA 4IOQA 4LZRA 4HXOA 4J0SA 3UW9A 2GRCA 4LZSA 4QY4A 4NYWA 5KU3A 4UIZA 5ENCA 3MUKA 4OGIA 5D0CA 5H1VA 4HXKA 2D82A 5HFQA 3MB3A 4UIVA 5F62A 5L96A 4RVRA 4NYXA 4J1PA 3HMHA 5F36A 4ALGA 5EGUA 4YYJA 5D3TA 4MENA 1F68A 4TU6A 5DKDA 5FFYA 5I89A 5DY7A 4F3IA 5K29A 5D3JA 2OUOA 5E9MA 5ETBA 5I80A 5DX4A 4NR8A 4MEPA 3P1DA 5CUCA 5C7NA 5CQ4A 4CUPA 2DATA 5ETDA 4LYSA 5LJ1A 3D7CA 5F5ZA 2RNXA 3ONIA 5EWCA 3LJWA 4YYDA 3JVLA 4TTEA 5DBMA 5E9LA 4BW2A 5FE4A 3QZSA 4O7EA 4NRCA 3LQJA 3JVJA 3IU5A 5LKUA 4QR5A 5CQ6A 4QC1A 2DVRA 3DAIA 4UIYA 4O78A 5ENHA 4UYFA 5FG5A 4IOOA 4YK0A 3S92A 5DFCA 3O35A 4Q0OA 3O34A 4QR4A 5CFWA 2DVSA 4HXPA 5ENFA 1WUGA 5A5QA 3UV2A 5DW1A 5IGNA 5C8GA 3P5OA 5DYAA 4LZ2A 4NRAA 5D25A 5E74A 4CURA 2L85A 4NYVA 5FFVA 5A5RA 5CUAA 5FH6A 5I40A 5E9IA 3K2JA 5LKXA 4YBTA 3Q2FA 4O72A 4N4FA 4ALHA 5L97A 2WP1A 5CTLA 5LVRA 2R0YA 5IG6A 4Z6HA 3UVDA 5A83A 5A82A 4HXLA 4J0RA 5CUDA 2R10A 4O77A 5D3HA 5A5PA 5D26A 5HM0A 1ZS5A 4UYHA 4CFKA 4QB3A 2WP2A 4PCIA 1X0JA 5AD3A 4WHWA 4YH4A 4MEQA 4Z93A 4NUEA 3QZTA 4QC3A 4PKLA 3LQHA 4A9KA 2I7KA 5I83A 4YYGA 3LXJA 5I29A 2E7NA 3NXBA 5LKTA 4UIXA 5L99A 2YYNA 5IGMA 4AKNA 5FE9A 5ENJA 5CGPA 5EI4A 4CLBA 4O71A 4YADA 4A9IA 4IORA 5FBXA 4PY6A 5I1QA 4NR6A 5EP7A 4A9OA 5CY9A 5KTUA 4ZC9A 2OO1A 5IBNA 3DWYA 4CUUA 5CUGA 5CQ3A 4CFLA 3P1EA 4NR9A 4Z1SA 5KO4A 4NQMA 2I8NA 5F3AA 5FH8A 5BT4A 4J3IA 5L8TA 3AADA 4A9LA 5DLZA 5D3SA 5L98A 5ENBA 4QSUA 4QYLA 5HQ7A 4Y03A 5CRMA 3U5OA 4O7AA 5A81A 4DONA 5EVAA 5CUBA 4MR6A 4A9MA 4TZ8A 4C66A 1N72A 5FE1A 4LRGA 2RNWA 2N9GA 4A9EA 5JWMA 4TQNA 5FDZA 5HJCA 4GPJA 3AQAA 5EWVA 2E3KA 4HBVA 3HMFA 4QSVA 4OGJA 3UVXA 4A9HA 5DFBA 4BW1A 4HBXA 5C85A 5EWHA 4Z1QA 5HFRA 4YYKA 4UYFB 4Q0NA 5E3GA 5KTWA 4WHUA 4C67A 2FSAA 5DYUA 4O75A 4XUAA 5IIDA 4UIUA 5FE6A 3SVHA 4MR4A 5I7YA 4IR6A 5F63A 5D3PA 5D24A 5DFDA 4A9FA 5E7DA 4MR3A 4HXRA 5FE0A 4LDFA 4QSWA 4XY8A 3UV5A 2R0VA 5F2PA 5FE8A 4NUDA 4UITA 3U5LA 5CQ8A 2RFJA 5AMEA 4IR5A 5EA1A 2LSPB 5H1UA 4KV1A 5D3NA 5EPRA 4NRBA 4QSQA 4TU4A 4YY6A 5LJ2A 5CUEA 4HXMA 4NS5A 3MQMA 3IU6A 3JVKA 5EWDA 5CQTA 4CL9A 4BW3A 4QBMA 4TYLA 5II1A 1E6IA 5FG4A 4UYDA 5DKHA 3UV4A 4HXNA 5F60A 4MEOA 4YBMA 4NXJA 2F6NA 4IR4A 4XUBA 4CUSA 4UYEA 4CUTA 3O33A 4ZW1A 4N3WA 4QSRA 5I88A 3MB4A 5LKZA 5A85A 2H60A 4PS5A 3JVMA 4NR4A 5CRZA 5E9VA 4TT6A 5FE3A 5EM3A 4YY4A 5HQ5A 3UVYA 5HELA 5A7CA 5EV9A 3QZVA 5CQ7A 2DKWA 4PTBA 5CPEA 4QSPA 5D7XA 3MXFA 5ENGA 5BT5A 1JSPB 5FB0A 5C4QA 5LJ0A 3LQIA 2G4AA 5EK9A 5ENIA 4QZSA 4LYWA 4KCXA 4A9NA 5FE5A 3P1FA 4A9JA 5EISA 2E7OA 5II2A 1WUMA 5H1TA 5CP5A 2D9EA 4QEUA 4QR3A 4QUTA 5C89A 5DKCA 2L84A 5EQ1A 5C87A 5EICA 4NR7A 3O37A 4QUUA 5BT3A 4O74A 5HENA 2YDWA 3GG3A 2YEKA 4WIVA 2DVQA 5EPBA 4N4GA 2RI7A 5FE2A 5E73A 4O7BA 4TT2A 4TS8A 4O76A 4YBSA 5AMFA 5HEMA 5AD2A 4LYIA 4LR6A 4O7CA 2DVVA 3S91A 4XY9A 5CQAA 3SVFA 3U5JA 4NQNA 4N4IA 2RO1A 4E96A 2DWWA 4MR5A 5I7XA 2OSSA 2RNYA 4TT4A 3HMEA 1EQFA 5COIA 4O7FA 4OUFA 3U5MA 2YQDA 5HRWA 4QEWA 4PCEA 5FFWA 5JI8A 5G4RA 4ZQLA 4XYAA 4FLPA 4YYMA 4QEVA 2KTBB 5E9YA 5KHMA 5L8UA 3MULA 5HLSA 5E0RA 5DLXA 5LVQA 5HQ6A 4YYNA 5F1LA 4QNSA 2RS9B 5TB6A 2YW5A 5IGKA 5TCMA 5CS8A 3U5KA 4BW4A 4YABA 5HCLA 3TLPA 4QYDA 5J0DA 5KTXA 4HBYA 3P1CA 4O70A 4QSSA 5ACYA 4CUQA 5H85A 1JM4B 5FE7A 5G4SA 5D3RA 5E3DA 5DW2A 4YC9A 3RCWA 3FKMX 5A5OA 5HRXA 5LUUA 5HRVA 5D3LA 4TZ2A 3G0JA 2L5EA 4X2IA 4NR5A 5DYCA 4YATA 5FB1A 3SVGA 4BJXA 5CQ5A 3Q2EA 4N4HA 2MJVB 4YYHA 3O36A 4YAXA 5EU1A 4HXSA 3UVWA 5F25A 2YEMA 4LC2A 3U5NA 5IGLA 5ENEA 4YYIA 4BHWA 3ZYUA 4QSTA 4HBWA 4KV4A 5EWWA 5DYXA 5F1HA 4IR3A 4UIWA 5F61A 4YH3A 2R0SA 4UYGA 5I86A 5CZGA 2NXBA 4QSXA 5A5NA 5FG6A 4NUCA 3U5PA
chains in the Genus database with same CATH superfamily
5EPSA 4AKGA 5CU8A 5E9KA 5FH7A 4Z6IA 2YELA 3I3JA 2F6JA 5A5SA 3G0LA 4IOQA 4LZRA 4HXOA 4J0SA 3UW9A 2GRCA 4LZSA 4QY4A 4NYWA 5KU3A 4UIZA 5ENCA 3MUKA 4OGIA 5D0CA 5H1VA 4HXKA 2D82A 5HFQA 3MB3A 4UIVA 5F62A 5L96A 4RVRA 4NYXA 4J1PA 3HMHA 5F36A 4ALGA 5EGUA 4YYJA 5D3TA 4MENA 1F68A 4TU6A 5DKDA 5FFYA 5I89A 4AKHA 5DY7A 4F3IA 5K29A 5D3JA 2OUOA 5E9MA 5ETBA 5I80A 5DX4A 4NR8A 4MEPA 3P1DA 5CUCA 5C7NA 5CQ4A 4CUPA 2DATA 5ETDA 4LYSA 5LJ1A 3D7CA 5F5ZA 2RNXA 3ONIA 5EWCA 3LJWA 4YYDA 3JVLA 4TTEA 5DBMA 5E9LA 4BW2A 5FE4A 3QZSA 4O7EA 4NRCA 3LQJA 3JVJA 3IU5A 5LKUA 4QR5A 5CQ6A 4QC1A 2DVRA 4AKIA 3DAIA 4UIYA 4O78A 5ENHA 4UYFA 5FG5A 4IOOA 4YK0A 3S92A 5DFCA 3O35A 4Q0OA 3O34A 4QR4A 5CFWA 2DVSA 4HXPA 5ENFA 1WUGA 5A5QA 3UV2A 5DW1A 5IGNA 5C8GA 3P5OA 5DYAA 4LZ2A 4NRAA 5D25A 5E74A 4CURA 2L85A 4NYVA 5FFVA 5A5RA 5CUAA 5FH6A 5I40A 5E9IA 3K2JA 5LKXA 4YBTA 3Q2FA 4O72A 4N4FA 4ALHA 5L97A 2WP1A 5CTLA 5LVRA 3VKHA 2R0YA 5IG6A 4Z6HA 3UVDA 5A83A 5A82A 4HXLA 4J0RA 5CUDA 2R10A 4O77A 5D3HA 5A5PA 5D26A 5HM0A 1ZS5A 4UYHA 4CFKA 4QB3A 2WP2A 4PCIA 1X0JA 5AD3A 4WHWA 4YH4A 4MEQA 4Z93A 4NUEA 3QZTA 4QC3A 4PKLA 3LQHA 4A9KA 2I7KA 5I83A 4YYGA 3LXJA 5I29A 2E7NA 3NXBA 5LKTA 4UIXA 5L99A 2YYNA 5IGMA 4AKNA 5FE9A 5ENJA 5CGPA 5EI4A 4CLBA 4O71A 4YADA 4A9IA 4IORA 5FBXA 4PY6A 5I1QA 4NR6A 5EP7A 4A9OA 5CY9A 5KTUA 4ZC9A 2OO1A 5IBNA 3DWYA 4CUUA 5CUGA 5CQ3A 4CFLA 3P1EA 4NR9A 4Z1SA 5KO4A 4NQMA 2I8NA 5F3AA 5FH8A 5BT4A 4J3IA 5L8TA 3AADA 4A9LA 5DLZA 5D3SA 5L98A 5ENBA 4QSUA 4QYLA 5HQ7A 4Y03A 5CRMA 3U5OA 4O7AA 5A81A 4DONA 5EVAA 5CUBA 4MR6A 4A9MA 4TZ8A 4C66A 1N72A 5FE1A 4LRGA 2RNWA 2N9GA 4A9EA 5JWMA 4TQNA 5FDZA 5HJCA 4GPJA 3D1BA 3AQAA 5EWVA 2E3KA 4HBVA 3HMFA 4QSVA 4OGJA 3UVXA 4A9HA 5DFBA 4BW1A 4HBXA 5C85A 5EWHA 4Z1QA 5HFRA 4YYKA 4UYFB 4Q0NA 5E3GA 5KTWA 4WHUA 4C67A 2FSAA 5DYUA 4O75A 4XUAA 5IIDA 4UIUA 5FE6A 3SVHA 4MR4A 5I7YA 4IR6A 5F63A 5D3PA 5D24A 5DFDA 4A9FA 5E7DA 4MR3A 4HXRA 5FE0A 4LDFA 4QSWA 4XY8A 3UV5A 2R0VA 5F2PA 5FE8A 4NUDA 4UITA 3U5LA 5CQ8A 2RFJA 5AMEA 4IR5A 5EA1A 2LSPB 5H1UA 4KV1A 5D3NA 5EPRA 4NRBA 4QSQA 4TU4A 4YY6A 5LJ2A 5CUEA 4HXMA 4NS5A 3MQMA 3IU6A 3JVKA 5EWDA 5CQTA 4CL9A 4BW3A 4QBMA 4TYLA 5II1A 1E6IA 5FG4A 4UYDA 5DKHA 3UV4A 4HXNA 5F60A 4MEOA 4YBMA 4NXJA 2F6NA 4IR4A 4XUBA 4CUSA 4UYEA 4CUTA 3O33A 4ZW1A 4N3WA 4QSRA 5I88A 3MB4A 5LKZA 5A85A 2H60A 4PS5A 3JVMA 4NR4A 5CRZA 5E9VA 4TT6A 5FE3A 5EM3A 4YY4A 5HQ5A 3UVYA 5HELA 5A7CA 5EV9A 3QZVA 5CQ7A 2DKWA 4PTBA 5CPEA 4QSPA 5D7XA 3MXFA 5ENGA 5BT5A 1JSPB 5FB0A 5C4QA 5LJ0A 3LQIA 2G4AA 5EK9A 5ENIA 4QZSA 4LYWA 4KCXA 4A9NA 5FE5A 3ERRA 3P1FA 4A9JA 5EISA 2E7OA 5II2A 1WUMA 5H1TA 5CP5A 2D9EA 4QEUA 4QR3A 4QUTA 5C89A 5DKCA 3VKGA 2L84A 5EQ1A 5C87A 5EICA 4NR7A 3O37A 4QUUA 5BT3A 4O74A 5HENA 2YDWA 3GG3A 2YEKA 4WIVA 2DVQA 5EPBA 4N4GA 2RI7A 5FE2A 5E73A 4O7BA 4TT2A 4TS8A 4O76A 4YBSA 5AMFA 5HEMA 5AD2A 4LYIA 4LR6A 4O7CA 2DVVA 3S91A 4XY9A 5CQAA 3SVFA 3U5JA 4NQNA 4N4IA 2RO1A 4E96A 2DWWA 4MR5A 5I7XA 2OSSA 2RNYA 4TT4A 3HMEA 1EQFA 5COIA 4O7FA 4OUFA 3U5MA 2YQDA 5HRWA 4QEWA 4PCEA 5FFWA 5JI8A 5G4RA 4ZQLA 4XYAA 4FLPA 4YYMA 4QEVA 2KTBB 5E9YA 4AI6A 5KHMA 5L8UA 3MULA 5HLSA 5E0RA 5DLXA 5LVQA 5HQ6A 4YYNA 5F1LA 4QNSA 2RS9B 5TB6A 2YW5A 5IGKA 5TCMA 5CS8A 3D1DA 3U5KA 4BW4A 4YABA 5HCLA 3TLPA 4QYDA 5J0DA 5KTXA 4HBYA 1ZKRA 3P1CA 4O70A 4QSSA 5ACYA 4CUQA 5H85A 1JM4B 5FE7A 5G4SA 5D3RA 5E3DA 5DW2A 4YC9A 3RCWA 3FKMX 5A5OA 5HRXA 5LUUA 5HRVA 5D3LA 4TZ2A 3G0JA 2L5EA 4X2IA 4NR5A 5DYCA 4YATA 5FB1A 3SVGA 4BJXA 5CQ5A 3Q2EA 4N4HA 2MJVB 4YYHA 3O36A 4YAXA 5EU1A 4HXSA 3UVWA 5F25A 2YEMA 4LC2A 3U5NA 5IGLA 5ENEA 4YYIA 4BHWA 3ZYUA 4QSTA 4HBWA 4KV4A 5EWWA 5DYXA 2EJNA 5F1HA 4IR3A 4UIWA 1PUOA 5F61A 4YH3A 2R0SA 4UYGA 5I86A 5CZGA 2NXBA 4QSXA 5A5NA 5FG6A 4NUCA 3U5PA
chains in the Genus database with same CATH topology
5EPSA 5CU8A 5E9KA 5FH7A 4Z6IA 2YELA 3I3JA 2F6JA 5A5SA 3G0LA 4IOQA 4LZRA 4HXOA 4J0SA 3UW9A 2GRCA 4LZSA 4QY4A 4NYWA 5KU3A 4UIZA 5ENCA 3MUKA 4OGIA 5D0CA 5H1VA 4HXKA 2D82A 5HFQA 3MB3A 4UIVA 5F62A 5L96A 4RVRA 4NYXA 4J1PA 3HMHA 5F36A 4ALGA 5EGUA 4YYJA 5D3TA 4MENA 1F68A 4TU6A 5DKDA 5FFYA 5I89A 5DY7A 4F3IA 5K29A 5D3JA 2OUOA 5E9MA 5ETBA 5I80A 5DX4A 4NR8A 4MEPA 3P1DA 5CUCA 5C7NA 5CQ4A 4CUPA 2DATA 5ETDA 4LYSA 5LJ1A 3D7CA 5F5ZA 2RNXA 3ONIA 5EWCA 3LJWA 4YYDA 3JVLA 4TTEA 5DBMA 5E9LA 4BW2A 5FE4A 3QZSA 4O7EA 4NRCA 3LQJA 3JVJA 3IU5A 5LKUA 4QR5A 5CQ6A 4QC1A 2DVRA 3DAIA 4UIYA 4O78A 5ENHA 4UYFA 5FG5A 4IOOA 4YK0A 3S92A 5DFCA 3O35A 4Q0OA 3O34A 4QR4A 5CFWA 2DVSA 4HXPA 5ENFA 1WUGA 5A5QA 3UV2A 5DW1A 5IGNA 5C8GA 3P5OA 5DYAA 4LZ2A 4NRAA 5D25A 5E74A 4CURA 2L85A 4NYVA 5FFVA 5A5RA 5CUAA 5FH6A 5I40A 5E9IA 3K2JA 5LKXA 4YBTA 3Q2FA 4O72A 4N4FA 4ALHA 5L97A 2WP1A 5CTLA 5LVRA 2R0YA 5IG6A 4Z6HA 3UVDA 5A83A 5A82A 4HXLA 4J0RA 5CUDA 2R10A 4O77A 5D3HA 5A5PA 5D26A 5HM0A 1ZS5A 4UYHA 4CFKA 4QB3A 2WP2A 4PCIA 1X0JA 5AD3A 4WHWA 4YH4A 4MEQA 4Z93A 4NUEA 3QZTA 4QC3A 4PKLA 3LQHA 4A9KA 2I7KA 5I83A 4YYGA 3LXJA 5I29A 2E7NA 3NXBA 5LKTA 4UIXA 5L99A 2YYNA 5IGMA 4AKNA 5FE9A 5ENJA 5CGPA 5EI4A 4CLBA 4O71A 4YADA 4A9IA 4IORA 5FBXA 4PY6A 5I1QA 4NR6A 5EP7A 4A9OA 5CY9A 5KTUA 4ZC9A 2OO1A 5IBNA 3DWYA 4CUUA 5CUGA 5CQ3A 4CFLA 3P1EA 4NR9A 4Z1SA 5KO4A 4NQMA 2I8NA 5F3AA 5FH8A 5BT4A 4J3IA 5L8TA 3AADA 4A9LA 5DLZA 5D3SA 5L98A 5ENBA 4QSUA 4QYLA 5HQ7A 4Y03A 5CRMA 3U5OA 4O7AA 5A81A 4DONA 5EVAA 5CUBA 4MR6A 4A9MA 4TZ8A 4C66A 1N72A 5FE1A 4LRGA 2RNWA 2N9GA 4A9EA 5JWMA 4TQNA 5FDZA 5HJCA 4GPJA 3AQAA 5EWVA 2E3KA 4HBVA 3HMFA 4QSVA 4OGJA 3UVXA 4A9HA 5DFBA 4BW1A 4HBXA 5C85A 5EWHA 4Z1QA 5HFRA 4YYKA 4UYFB 4Q0NA 5E3GA 5KTWA 4WHUA 4C67A 2FSAA 5DYUA 4O75A 4XUAA 5IIDA 4UIUA 5FE6A 3SVHA 4MR4A 5I7YA 4IR6A 5F63A 5D3PA 5D24A 5DFDA 4A9FA 5E7DA 4MR3A 4HXRA 5FE0A 4LDFA 4QSWA 4XY8A 3UV5A 2R0VA 5F2PA 5FE8A 4NUDA 4UITA 3U5LA 5CQ8A 2RFJA 5AMEA 4IR5A 5EA1A 2LSPB 5H1UA 4KV1A 5D3NA 5EPRA 4NRBA 4QSQA 4TU4A 4YY6A 5LJ2A 5CUEA 4HXMA 4NS5A 3MQMA 3IU6A 3JVKA 5EWDA 5CQTA 4CL9A 4BW3A 4QBMA 4TYLA 5II1A 1E6IA 5FG4A 4UYDA 5DKHA 3UV4A 4HXNA 5F60A 4MEOA 4YBMA 4NXJA 2F6NA 4IR4A 4XUBA 4CUSA 4UYEA 4CUTA 3O33A 4ZW1A 4N3WA 4QSRA 5I88A 3MB4A 5LKZA 5A85A 2H60A 4PS5A 3JVMA 4NR4A 5CRZA 5E9VA 4TT6A 5FE3A 5EM3A 4YY4A 5HQ5A 3UVYA 5HELA 5A7CA 5EV9A 3QZVA 5CQ7A 2DKWA 4PTBA 5CPEA 4QSPA 5D7XA 3MXFA 5ENGA 5BT5A 1JSPB 5FB0A 5C4QA 5LJ0A 3LQIA 2G4AA 5EK9A 5ENIA 4QZSA 4LYWA 4KCXA 4A9NA 5FE5A 3P1FA 4A9JA 5EISA 2E7OA 5II2A 1WUMA 5H1TA 5CP5A 2D9EA 4QEUA 4QR3A 4QUTA 5C89A 5DKCA 2L84A 5EQ1A 5C87A 5EICA 4NR7A 3O37A 4QUUA 5BT3A 4O74A 5HENA 2YDWA 3GG3A 2YEKA 4WIVA 2DVQA 5EPBA 4N4GA 2RI7A 5FE2A 5E73A 4O7BA 4TT2A 4TS8A 4O76A 4YBSA 5AMFA 5HEMA 5AD2A 4LYIA 4LR6A 4O7CA 2DVVA 3S91A 4XY9A 5CQAA 3SVFA 3U5JA 4NQNA 4N4IA 2RO1A 4E96A 2DWWA 4MR5A 5I7XA 2OSSA 2RNYA 4TT4A 3HMEA 1EQFA 5COIA 4O7FA 4OUFA 3U5MA 2YQDA 5HRWA 4QEWA 4PCEA 5FFWA 5JI8A 5G4RA 4ZQLA 4XYAA 4FLPA 4YYMA 4QEVA 2KTBB 5E9YA 5KHMA 5L8UA 3MULA 5HLSA 5E0RA 5DLXA 5LVQA 5HQ6A 4YYNA 5F1LA 4QNSA 2RS9B 5TB6A 2YW5A 5IGKA 5TCMA 5CS8A 3U5KA 4BW4A 4YABA 5HCLA 3TLPA 4QYDA 5J0DA 5KTXA 4HBYA 3P1CA 4O70A 4QSSA 5ACYA 4CUQA 5H85A 1JM4B 5FE7A 5G4SA 5D3RA 5E3DA 5DW2A 4YC9A 3RCWA 3FKMX 5A5OA 5HRXA 5LUUA 5HRVA 5D3LA 4TZ2A 3G0JA 2L5EA 4X2IA 4NR5A 5DYCA 4YATA 5FB1A 3SVGA 4BJXA 5CQ5A 3Q2EA 4N4HA 2MJVB 4YYHA 3O36A 4YAXA 5EU1A 4HXSA 3UVWA 5F25A 2YEMA 4LC2A 3U5NA 5IGLA 5ENEA 4YYIA 4BHWA 3ZYUA 4QSTA 4HBWA 4KV4A 5EWWA 5DYXA 5F1HA 4IR3A 4UIWA 5F61A 4YH3A 2R0SA 4UYGA 5I86A 5CZGA 2NXBA 4QSXA 5A5NA 5FG6A 4NUCA 3U5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPS A;  5CU8 A;  5E9K A;  5FH7 A;  4Z6I A;  2YEL A;  3I3J A;  2F6J A;  5A5S A;  3G0L A;  4IOQ A;  4LZR A;  4HXO A;  4J0S A;  3UW9 A;  2GRC A;  4LZS A;  4QY4 A;  4NYW A;  5KU3 A;  4UIZ A;  5ENC A;  3MUK A;  4OGI A;  5D0C A;  5H1V A;  4HXK A;  2D82 A;  5HFQ A;  3MB3 A;  4UIV A;  5F62 A;  5L96 A;  4RVR A;  4NYX A;  4J1P A;  3HMH A;  5F36 A;  4ALG A;  5EGU A;  4YYJ A;  5D3T A;  4MEN A;  1F68 A;  4TU6 A;  5DKD A;  5FFY A;  5I89 A;  5DY7 A;  4F3I A;  5K29 A;  5D3J A;  2OUO A;  5E9M A;  5ETB A;  5I80 A;  5DX4 A;  4NR8 A;  4MEP A;  3P1D A;  5CUC A;  5C7N A;  5CQ4 A;  4CUP A;  2DAT A;  5ETD A;  4LYS A;  5LJ1 A;  3D7C A;  5F5Z A;  2RNX A;  3ONI A;  5EWC A;  3LJW A;  4YYD A;  3JVL A;  4TTE A;  5DBM A;  5E9L A;  4BW2 A;  5FE4 A;  3QZS A;  4O7E A;  4NRC A;  3LQJ A;  3JVJ A;  3IU5 A;  5LKU A;  4QR5 A;  5CQ6 A;  4QC1 A;  2DVR A;  3DAI A;  4UIY A;  4O78 A;  5ENH A;  4UYF A;  5FG5 A;  4IOO A;  4YK0 A;  3S92 A;  5DFC A;  3O35 A;  4Q0O A;  3O34 A;  4QR4 A;  5CFW A;  2DVS A;  4HXP A;  5ENF A;  1WUG A;  5A5Q A;  3UV2 A;  5DW1 A;  5IGN A;  5C8G A;  3P5O A;  5DYA A;  4LZ2 A;  4NRA A;  5D25 A;  5E74 A;  4CUR A;  2L85 A;  4NYV A;  5FFV A;  5A5R A;  5CUA A;  5FH6 A;  5I40 A;  5E9I A;  3K2J A;  5LKX A;  4YBT A;  3Q2F A;  4O72 A;  4N4F A;  4ALH A;  5L97 A;  2WP1 A;  5CTL A;  5LVR A;  2R0Y A;  5IG6 A;  4Z6H A;  3UVD A;  5A83 A;  5A82 A;  4HXL A;  4J0R A;  5CUD A;  2R10 A;  4O77 A;  5D3H A;  5A5P A;  5D26 A;  5HM0 A;  1ZS5 A;  4UYH A;  4CFK A;  4QB3 A;  2WP2 A;  4PCI A;  1X0J A;  5AD3 A;  4WHW A;  4YH4 A;  4MEQ A;  4Z93 A;  4NUE A;  3QZT A;  4QC3 A;  4PKL A;  3LQH A;  4A9K A;  2I7K A;  5I83 A;  4YYG A;  3LXJ A;  5I29 A;  2E7N A;  3NXB A;  5LKT A;  4UIX A;  5L99 A;  2YYN A;  5IGM A;  4AKN A;  5FE9 A;  5ENJ A;  5CGP A;  5EI4 A;  4CLB A;  4O71 A;  4YAD A;  4A9I A;  4IOR A;  5FBX A;  4PY6 A;  5I1Q A;  4NR6 A;  5EP7 A;  4A9O A;  5CY9 A;  5KTU A;  4ZC9 A;  2OO1 A;  5IBN A;  3DWY A;  4CUU A;  5CUG A;  5CQ3 A;  4CFL A;  3P1E A;  4NR9 A;  4Z1S A;  5KO4 A;  4NQM A;  2I8N A;  5F3A A;  5FH8 A;  5BT4 A;  4J3I A;  5L8T A;  3AAD A;  4A9L A;  5DLZ A;  5D3S A;  5L98 A;  5ENB A;  4QSU A;  4QYL A;  5HQ7 A;  4Y03 A;  5CRM A;  3U5O A;  4O7A A;  5A81 A;  4DON A;  5EVA A;  5CUB A;  4MR6 A;  4A9M A;  4TZ8 A;  4C66 A;  1N72 A;  5FE1 A;  4LRG A;  2RNW A;  2N9G A;  4A9E A;  5JWM A;  4TQN A;  5FDZ A;  5HJC A;  4GPJ A;  3AQA A;  5EWV A;  2E3K A;  4HBV A;  3HMF A;  4QSV A;  4OGJ A;  3UVX A;  4A9H A;  5DFB A;  4BW1 A;  4HBX A;  5C85 A;  5EWH A;  4Z1Q A;  5HFR A;  4YYK A;  4UYF B;  4Q0N A;  5E3G A;  5KTW A;  4WHU A;  4C67 A;  2FSA A;  5DYU A;  4O75 A;  4XUA A;  5IID A;  4UIU A;  5FE6 A;  3SVH A;  4MR4 A;  5I7Y A;  4IR6 A;  5F63 A;  5D3P A;  5D24 A;  5DFD A;  4A9F A;  5E7D A;  4MR3 A;  4HXR A;  5FE0 A;  4LDF A;  4QSW A;  4XY8 A;  3UV5 A;  2R0V A;  5F2P A;  5FE8 A;  4NUD A;  4UIT A;  3U5L A;  5CQ8 A;  2RFJ A;  5AME A;  4IR5 A;  5EA1 A;  2LSP B;  5H1U A;  4KV1 A;  5D3N A;  5EPR A;  4NRB A;  4QSQ A;  4TU4 A;  4YY6 A;  5LJ2 A;  5CUE A;  4HXM A;  4NS5 A;  3MQM A;  3IU6 A;  3JVK A;  5EWD A;  5CQT A;  4CL9 A;  4BW3 A;  4QBM A;  4TYL A;  5II1 A;  1E6I A;  5FG4 A;  4UYD A;  5DKH A;  3UV4 A;  4HXN A;  5F60 A;  4MEO A;  4YBM A;  4NXJ A;  2F6N A;  4IR4 A;  4XUB A;  4CUS A;  4UYE A;  4CUT A;  3O33 A;  4ZW1 A;  4N3W A;  4QSR A;  5I88 A;  3MB4 A;  5LKZ A;  5A85 A;  2H60 A;  4PS5 A;  3JVM A;  4NR4 A;  5CRZ A;  5E9V A;  4TT6 A;  5FE3 A;  5EM3 A;  4YY4 A;  5HQ5 A;  3UVY A;  5HEL A;  5A7C A;  5EV9 A;  3QZV A;  5CQ7 A;  2DKW A;  4PTB A;  5CPE A;  4QSP A;  5D7X A;  3MXF A;  5ENG A;  5BT5 A;  1JSP B;  5FB0 A;  5C4Q A;  5LJ0 A;  3LQI A;  2G4A A;  5EK9 A;  5ENI A;  4QZS A;  4LYW A;  4KCX A;  4A9N A;  5FE5 A;  3P1F A;  4A9J A;  5EIS A;  2E7O A;  5II2 A;  1WUM A;  5H1T A;  5CP5 A;  2D9E A;  4QEU A;  4QR3 A;  4QUT A;  5C89 A;  5DKC A;  2L84 A;  5EQ1 A;  5C87 A;  5EIC A;  4NR7 A;  3O37 A;  4QUU A;  5BT3 A;  4O74 A;  5HEN A;  2YDW A;  3GG3 A;  2YEK A;  4WIV A;  2DVQ A;  5EPB A;  4N4G A;  2RI7 A;  5FE2 A;  5E73 A;  4O7B A;  4TT2 A;  4TS8 A;  4O76 A;  4YBS A;  5AMF A;  5HEM A;  5AD2 A;  4LYI A;  4LR6 A;  4O7C A;  2DVV A;  3S91 A;  4XY9 A;  5CQA A;  3SVF A;  3U5J A;  4NQN A;  4N4I A;  2RO1 A;  4E96 A;  2DWW A;  4MR5 A;  5I7X A;  2OSS A;  2RNY A;  4TT4 A;  3HME A;  1EQF A;  5COI A;  4O7F A;  4OUF A;  3U5M A;  2YQD A;  5HRW A;  4QEW A;  4PCE A;  5FFW A;  5JI8 A;  5G4R A;  4ZQL A;  4XYA A;  4FLP A;  4YYM A;  4QEV A;  2KTB B;  5E9Y A;  5KHM A;  5L8U A;  3MUL A;  5HLS A;  5E0R A;  5DLX A;  5LVQ A;  5HQ6 A;  4YYN A;  5F1L A;  4QNS A;  2RS9 B;  5TB6 A;  2YW5 A;  5IGK A;  5TCM A;  5CS8 A;  3U5K A;  4BW4 A;  4YAB A;  5HCL A;  3TLP A;  4QYD A;  5J0D A;  5KTX A;  4HBY A;  3P1C A;  4O70 A;  4QSS A;  5ACY A;  4CUQ A;  5H85 A;  1JM4 B;  5FE7 A;  5G4S A;  5D3R A;  5E3D A;  5DW2 A;  4YC9 A;  3RCW A;  3FKM X;  5A5O A;  5HRX A;  5LUU A;  5HRV A;  5D3L A;  4TZ2 A;  3G0J A;  2L5E A;  4X2I A;  4NR5 A;  5DYC A;  4YAT A;  5FB1 A;  3SVG A;  4BJX A;  5CQ5 A;  3Q2E A;  4N4H A;  2MJV B;  4YYH A;  3O36 A;  4YAX A;  5EU1 A;  4HXS A;  3UVW A;  5F25 A;  2YEM A;  4LC2 A;  3U5N A;  5IGL A;  5ENE A;  4YYI A;  4BHW A;  3ZYU A;  4QST A;  4HBW A;  4KV4 A;  5EWW A;  5DYX A;  5F1H A;  4IR3 A;  4UIW A;  5F61 A;  4YH3 A;  2R0S A;  4UYG A;  5I86 A;  5CZG A;  2NXB A;  4QSX A;  5A5N A;  5FG6 A;  4NUC A;  3U5P A; 
#chains in the Genus database with same CATH topology
 5EPS A;  4AKG A;  5CU8 A;  5E9K A;  5FH7 A;  4Z6I A;  2YEL A;  3I3J A;  2F6J A;  5A5S A;  3G0L A;  4IOQ A;  4LZR A;  4HXO A;  4J0S A;  3UW9 A;  2GRC A;  4LZS A;  4QY4 A;  4NYW A;  5KU3 A;  4UIZ A;  5ENC A;  3MUK A;  4OGI A;  5D0C A;  5H1V A;  4HXK A;  2D82 A;  5HFQ A;  3MB3 A;  4UIV A;  5F62 A;  5L96 A;  4RVR A;  4NYX A;  4J1P A;  3HMH A;  5F36 A;  4ALG A;  5EGU A;  4YYJ A;  5D3T A;  4MEN A;  1F68 A;  4TU6 A;  5DKD A;  5FFY A;  5I89 A;  4AKH A;  5DY7 A;  4F3I A;  5K29 A;  5D3J A;  2OUO A;  5E9M A;  5ETB A;  5I80 A;  5DX4 A;  4NR8 A;  4MEP A;  3P1D A;  5CUC A;  5C7N A;  5CQ4 A;  4CUP A;  2DAT A;  5ETD A;  4LYS A;  5LJ1 A;  3D7C A;  5F5Z A;  2RNX A;  3ONI A;  5EWC A;  3LJW A;  4YYD A;  3JVL A;  4TTE A;  5DBM A;  5E9L A;  4BW2 A;  5FE4 A;  3QZS A;  4O7E A;  4NRC A;  3LQJ A;  3JVJ A;  3IU5 A;  5LKU A;  4QR5 A;  5CQ6 A;  4QC1 A;  2DVR A;  4AKI A;  3DAI A;  4UIY A;  4O78 A;  5ENH A;  4UYF A;  5FG5 A;  4IOO A;  4YK0 A;  3S92 A;  5DFC A;  3O35 A;  4Q0O A;  3O34 A;  4QR4 A;  5CFW A;  2DVS A;  4HXP A;  5ENF A;  1WUG A;  5A5Q A;  3UV2 A;  5DW1 A;  5IGN A;  5C8G A;  3P5O A;  5DYA A;  4LZ2 A;  4NRA A;  5D25 A;  5E74 A;  4CUR A;  2L85 A;  4NYV A;  5FFV A;  5A5R A;  5CUA A;  5FH6 A;  5I40 A;  5E9I A;  3K2J A;  5LKX A;  4YBT A;  3Q2F A;  4O72 A;  4N4F A;  4ALH A;  5L97 A;  2WP1 A;  5CTL A;  5LVR A;  3VKH A;  2R0Y A;  5IG6 A;  4Z6H A;  3UVD A;  5A83 A;  5A82 A;  4HXL A;  4J0R A;  5CUD A;  2R10 A;  4O77 A;  5D3H A;  5A5P A;  5D26 A;  5HM0 A;  1ZS5 A;  4UYH A;  4CFK A;  4QB3 A;  2WP2 A;  4PCI A;  1X0J A;  5AD3 A;  4WHW A;  4YH4 A;  4MEQ A;  4Z93 A;  4NUE A;  3QZT A;  4QC3 A;  4PKL A;  3LQH A;  4A9K A;  2I7K A;  5I83 A;  4YYG A;  3LXJ A;  5I29 A;  2E7N A;  3NXB A;  5LKT A;  4UIX A;  5L99 A;  2YYN A;  5IGM A;  4AKN A;  5FE9 A;  5ENJ A;  5CGP A;  5EI4 A;  4CLB A;  4O71 A;  4YAD A;  4A9I A;  4IOR A;  5FBX A;  4PY6 A;  5I1Q A;  4NR6 A;  5EP7 A;  4A9O A;  5CY9 A;  5KTU A;  4ZC9 A;  2OO1 A;  5IBN A;  3DWY A;  4CUU A;  5CUG A;  5CQ3 A;  4CFL A;  3P1E A;  4NR9 A;  4Z1S A;  5KO4 A;  4NQM A;  2I8N A;  5F3A A;  5FH8 A;  5BT4 A;  4J3I A;  5L8T A;  3AAD A;  4A9L A;  5DLZ A;  5D3S A;  5L98 A;  5ENB A;  4QSU A;  4QYL A;  5HQ7 A;  4Y03 A;  5CRM A;  3U5O A;  4O7A A;  5A81 A;  4DON A;  5EVA A;  5CUB A;  4MR6 A;  4A9M A;  4TZ8 A;  4C66 A;  1N72 A;  5FE1 A;  4LRG A;  2RNW A;  2N9G A;  4A9E A;  5JWM A;  4TQN A;  5FDZ A;  5HJC A;  4GPJ A;  3D1B A;  3AQA A;  5EWV A;  2E3K A;  4HBV A;  3HMF A;  4QSV A;  4OGJ A;  3UVX A;  4A9H A;  5DFB A;  4BW1 A;  4HBX A;  5C85 A;  5EWH A;  4Z1Q A;  5HFR A;  4YYK A;  4UYF B;  4Q0N A;  5E3G A;  5KTW A;  4WHU A;  4C67 A;  2FSA A;  5DYU A;  4O75 A;  4XUA A;  5IID A;  4UIU A;  5FE6 A;  3SVH A;  4MR4 A;  5I7Y A;  4IR6 A;  5F63 A;  5D3P A;  5D24 A;  5DFD A;  4A9F A;  5E7D A;  4MR3 A;  4HXR A;  5FE0 A;  4LDF A;  4QSW A;  4XY8 A;  3UV5 A;  2R0V A;  5F2P A;  5FE8 A;  4NUD A;  4UIT A;  3U5L A;  5CQ8 A;  2RFJ A;  5AME A;  4IR5 A;  5EA1 A;  2LSP B;  5H1U A;  4KV1 A;  5D3N A;  5EPR A;  4NRB A;  4QSQ A;  4TU4 A;  4YY6 A;  5LJ2 A;  5CUE A;  4HXM A;  4NS5 A;  3MQM A;  3IU6 A;  3JVK A;  5EWD A;  5CQT A;  4CL9 A;  4BW3 A;  4QBM A;  4TYL A;  5II1 A;  1E6I A;  5FG4 A;  4UYD A;  5DKH A;  3UV4 A;  4HXN A;  5F60 A;  4MEO A;  4YBM A;  4NXJ A;  2F6N A;  4IR4 A;  4XUB A;  4CUS A;  4UYE A;  4CUT A;  3O33 A;  4ZW1 A;  4N3W A;  4QSR A;  5I88 A;  3MB4 A;  5LKZ A;  5A85 A;  2H60 A;  4PS5 A;  3JVM A;  4NR4 A;  5CRZ A;  5E9V A;  4TT6 A;  5FE3 A;  5EM3 A;  4YY4 A;  5HQ5 A;  3UVY A;  5HEL A;  5A7C A;  5EV9 A;  3QZV A;  5CQ7 A;  2DKW A;  4PTB A;  5CPE A;  4QSP A;  5D7X A;  3MXF A;  5ENG A;  5BT5 A;  1JSP B;  5FB0 A;  5C4Q A;  5LJ0 A;  3LQI A;  2G4A A;  5EK9 A;  5ENI A;  4QZS A;  4LYW A;  4KCX A;  4A9N A;  5FE5 A;  3ERR A;  3P1F A;  4A9J A;  5EIS A;  2E7O A;  5II2 A;  1WUM A;  5H1T A;  5CP5 A;  2D9E A;  4QEU A;  4QR3 A;  4QUT A;  5C89 A;  5DKC A;  3VKG A;  2L84 A;  5EQ1 A;  5C87 A;  5EIC A;  4NR7 A;  3O37 A;  4QUU A;  5BT3 A;  4O74 A;  5HEN A;  2YDW A;  3GG3 A;  2YEK A;  4WIV A;  2DVQ A;  5EPB A;  4N4G A;  2RI7 A;  5FE2 A;  5E73 A;  4O7B A;  4TT2 A;  4TS8 A;  4O76 A;  4YBS A;  5AMF A;  5HEM A;  5AD2 A;  4LYI A;  4LR6 A;  4O7C A;  2DVV A;  3S91 A;  4XY9 A;  5CQA A;  3SVF A;  3U5J A;  4NQN A;  4N4I A;  2RO1 A;  4E96 A;  2DWW A;  4MR5 A;  5I7X A;  2OSS A;  2RNY A;  4TT4 A;  3HME A;  1EQF A;  5COI A;  4O7F A;  4OUF A;  3U5M A;  2YQD A;  5HRW A;  4QEW A;  4PCE A;  5FFW A;  5JI8 A;  5G4R A;  4ZQL A;  4XYA A;  4FLP A;  4YYM A;  4QEV A;  2KTB B;  5E9Y A;  4AI6 A;  5KHM A;  5L8U A;  3MUL A;  5HLS A;  5E0R A;  5DLX A;  5LVQ A;  5HQ6 A;  4YYN A;  5F1L A;  4QNS A;  2RS9 B;  5TB6 A;  2YW5 A;  5IGK A;  5TCM A;  5CS8 A;  3D1D A;  3U5K A;  4BW4 A;  4YAB A;  5HCL A;  3TLP A;  4QYD A;  5J0D A;  5KTX A;  4HBY A;  1ZKR A;  3P1C A;  4O70 A;  4QSS A;  5ACY A;  4CUQ A;  5H85 A;  1JM4 B;  5FE7 A;  5G4S A;  5D3R A;  5E3D A;  5DW2 A;  4YC9 A;  3RCW A;  3FKM X;  5A5O A;  5HRX A;  5LUU A;  5HRV A;  5D3L A;  4TZ2 A;  3G0J A;  2L5E A;  4X2I A;  4NR5 A;  5DYC A;  4YAT A;  5FB1 A;  3SVG A;  4BJX A;  5CQ5 A;  3Q2E A;  4N4H A;  2MJV B;  4YYH A;  3O36 A;  4YAX A;  5EU1 A;  4HXS A;  3UVW A;  5F25 A;  2YEM A;  4LC2 A;  3U5N A;  5IGL A;  5ENE A;  4YYI A;  4BHW A;  3ZYU A;  4QST A;  4HBW A;  4KV4 A;  5EWW A;  5DYX A;  2EJN A;  5F1H A;  4IR3 A;  4UIW A;  1PUO A;  5F61 A;  4YH3 A;  2R0S A;  4UYG A;  5I86 A;  5CZG A;  2NXB A;  4QSX A;  5A5N A;  5FG6 A;  4NUC A;  3U5P A; 
#chains in the Genus database with same CATH homology
 5EPS A;  5CU8 A;  5E9K A;  5FH7 A;  4Z6I A;  2YEL A;  3I3J A;  2F6J A;  5A5S A;  3G0L A;  4IOQ A;  4LZR A;  4HXO A;  4J0S A;  3UW9 A;  2GRC A;  4LZS A;  4QY4 A;  4NYW A;  5KU3 A;  4UIZ A;  5ENC A;  3MUK A;  4OGI A;  5D0C A;  5H1V A;  4HXK A;  2D82 A;  5HFQ A;  3MB3 A;  4UIV A;  5F62 A;  5L96 A;  4RVR A;  4NYX A;  4J1P A;  3HMH A;  5F36 A;  4ALG A;  5EGU A;  4YYJ A;  5D3T A;  4MEN A;  1F68 A;  4TU6 A;  5DKD A;  5FFY A;  5I89 A;  5DY7 A;  4F3I A;  5K29 A;  5D3J A;  2OUO A;  5E9M A;  5ETB A;  5I80 A;  5DX4 A;  4NR8 A;  4MEP A;  3P1D A;  5CUC A;  5C7N A;  5CQ4 A;  4CUP A;  2DAT A;  5ETD A;  4LYS A;  5LJ1 A;  3D7C A;  5F5Z A;  2RNX A;  3ONI A;  5EWC A;  3LJW A;  4YYD A;  3JVL A;  4TTE A;  5DBM A;  5E9L A;  4BW2 A;  5FE4 A;  3QZS A;  4O7E A;  4NRC A;  3LQJ A;  3JVJ A;  3IU5 A;  5LKU A;  4QR5 A;  5CQ6 A;  4QC1 A;  2DVR A;  3DAI A;  4UIY A;  4O78 A;  5ENH A;  4UYF A;  5FG5 A;  4IOO A;  4YK0 A;  3S92 A;  5DFC A;  3O35 A;  4Q0O A;  3O34 A;  4QR4 A;  5CFW A;  2DVS A;  4HXP A;  5ENF A;  1WUG A;  5A5Q A;  3UV2 A;  5DW1 A;  5IGN A;  5C8G A;  3P5O A;  5DYA A;  4LZ2 A;  4NRA A;  5D25 A;  5E74 A;  4CUR A;  2L85 A;  4NYV A;  5FFV A;  5A5R A;  5CUA A;  5FH6 A;  5I40 A;  5E9I A;  3K2J A;  5LKX A;  4YBT A;  3Q2F A;  4O72 A;  4N4F A;  4ALH A;  5L97 A;  2WP1 A;  5CTL A;  5LVR A;  2R0Y A;  5IG6 A;  4Z6H A;  3UVD A;  5A83 A;  5A82 A;  4HXL A;  4J0R A;  5CUD A;  2R10 A;  4O77 A;  5D3H A;  5A5P A;  5D26 A;  5HM0 A;  1ZS5 A;  4UYH A;  4CFK A;  4QB3 A;  2WP2 A;  4PCI A;  1X0J A;  5AD3 A;  4WHW A;  4YH4 A;  4MEQ A;  4Z93 A;  4NUE A;  3QZT A;  4QC3 A;  4PKL A;  3LQH A;  4A9K A;  2I7K A;  5I83 A;  4YYG A;  3LXJ A;  5I29 A;  2E7N A;  3NXB A;  5LKT A;  4UIX A;  5L99 A;  2YYN A;  5IGM A;  4AKN A;  5FE9 A;  5ENJ A;  5CGP A;  5EI4 A;  4CLB A;  4O71 A;  4YAD A;  4A9I A;  4IOR A;  5FBX A;  4PY6 A;  5I1Q A;  4NR6 A;  5EP7 A;  4A9O A;  5CY9 A;  5KTU A;  4ZC9 A;  2OO1 A;  5IBN A;  3DWY A;  4CUU A;  5CUG A;  5CQ3 A;  4CFL A;  3P1E A;  4NR9 A;  4Z1S A;  5KO4 A;  4NQM A;  2I8N A;  5F3A A;  5FH8 A;  5BT4 A;  4J3I A;  5L8T A;  3AAD A;  4A9L A;  5DLZ A;  5D3S A;  5L98 A;  5ENB A;  4QSU A;  4QYL A;  5HQ7 A;  4Y03 A;  5CRM A;  3U5O A;  4O7A A;  5A81 A;  4DON A;  5EVA A;  5CUB A;  4MR6 A;  4A9M A;  4TZ8 A;  4C66 A;  1N72 A;  5FE1 A;  4LRG A;  2RNW A;  2N9G A;  4A9E A;  5JWM A;  4TQN A;  5FDZ A;  5HJC A;  4GPJ A;  3AQA A;  5EWV A;  2E3K A;  4HBV A;  3HMF A;  4QSV A;  4OGJ A;  3UVX A;  4A9H A;  5DFB A;  4BW1 A;  4HBX A;  5C85 A;  5EWH A;  4Z1Q A;  5HFR A;  4YYK A;  4UYF B;  4Q0N A;  5E3G A;  5KTW A;  4WHU A;  4C67 A;  2FSA A;  5DYU A;  4O75 A;  4XUA A;  5IID A;  4UIU A;  5FE6 A;  3SVH A;  4MR4 A;  5I7Y A;  4IR6 A;  5F63 A;  5D3P A;  5D24 A;  5DFD A;  4A9F A;  5E7D A;  4MR3 A;  4HXR A;  5FE0 A;  4LDF A;  4QSW A;  4XY8 A;  3UV5 A;  2R0V A;  5F2P A;  5FE8 A;  4NUD A;  4UIT A;  3U5L A;  5CQ8 A;  2RFJ A;  5AME A;  4IR5 A;  5EA1 A;  2LSP B;  5H1U A;  4KV1 A;  5D3N A;  5EPR A;  4NRB A;  4QSQ A;  4TU4 A;  4YY6 A;  5LJ2 A;  5CUE A;  4HXM A;  4NS5 A;  3MQM A;  3IU6 A;  3JVK A;  5EWD A;  5CQT A;  4CL9 A;  4BW3 A;  4QBM A;  4TYL A;  5II1 A;  1E6I A;  5FG4 A;  4UYD A;  5DKH A;  3UV4 A;  4HXN A;  5F60 A;  4MEO A;  4YBM A;  4NXJ A;  2F6N A;  4IR4 A;  4XUB A;  4CUS A;  4UYE A;  4CUT A;  3O33 A;  4ZW1 A;  4N3W A;  4QSR A;  5I88 A;  3MB4 A;  5LKZ A;  5A85 A;  2H60 A;  4PS5 A;  3JVM A;  4NR4 A;  5CRZ A;  5E9V A;  4TT6 A;  5FE3 A;  5EM3 A;  4YY4 A;  5HQ5 A;  3UVY A;  5HEL A;  5A7C A;  5EV9 A;  3QZV A;  5CQ7 A;  2DKW A;  4PTB A;  5CPE A;  4QSP A;  5D7X A;  3MXF A;  5ENG A;  5BT5 A;  1JSP B;  5FB0 A;  5C4Q A;  5LJ0 A;  3LQI A;  2G4A A;  5EK9 A;  5ENI A;  4QZS A;  4LYW A;  4KCX A;  4A9N A;  5FE5 A;  3P1F A;  4A9J A;  5EIS A;  2E7O A;  5II2 A;  1WUM A;  5H1T A;  5CP5 A;  2D9E A;  4QEU A;  4QR3 A;  4QUT A;  5C89 A;  5DKC A;  2L84 A;  5EQ1 A;  5C87 A;  5EIC A;  4NR7 A;  3O37 A;  4QUU A;  5BT3 A;  4O74 A;  5HEN A;  2YDW A;  3GG3 A;  2YEK A;  4WIV A;  2DVQ A;  5EPB A;  4N4G A;  2RI7 A;  5FE2 A;  5E73 A;  4O7B A;  4TT2 A;  4TS8 A;  4O76 A;  4YBS A;  5AMF A;  5HEM A;  5AD2 A;  4LYI A;  4LR6 A;  4O7C A;  2DVV A;  3S91 A;  4XY9 A;  5CQA A;  3SVF A;  3U5J A;  4NQN A;  4N4I A;  2RO1 A;  4E96 A;  2DWW A;  4MR5 A;  5I7X A;  2OSS A;  2RNY A;  4TT4 A;  3HME A;  1EQF A;  5COI A;  4O7F A;  4OUF A;  3U5M A;  2YQD A;  5HRW A;  4QEW A;  4PCE A;  5FFW A;  5JI8 A;  5G4R A;  4ZQL A;  4XYA A;  4FLP A;  4YYM A;  4QEV A;  2KTB B;  5E9Y A;  5KHM A;  5L8U A;  3MUL A;  5HLS A;  5E0R A;  5DLX A;  5LVQ A;  5HQ6 A;  4YYN A;  5F1L A;  4QNS A;  2RS9 B;  5TB6 A;  2YW5 A;  5IGK A;  5TCM A;  5CS8 A;  3U5K A;  4BW4 A;  4YAB A;  5HCL A;  3TLP A;  4QYD A;  5J0D A;  5KTX A;  4HBY A;  3P1C A;  4O70 A;  4QSS A;  5ACY A;  4CUQ A;  5H85 A;  1JM4 B;  5FE7 A;  5G4S A;  5D3R A;  5E3D A;  5DW2 A;  4YC9 A;  3RCW A;  3FKM X;  5A5O A;  5HRX A;  5LUU A;  5HRV A;  5D3L A;  4TZ2 A;  3G0J A;  2L5E A;  4X2I A;  4NR5 A;  5DYC A;  4YAT A;  5FB1 A;  3SVG A;  4BJX A;  5CQ5 A;  3Q2E A;  4N4H A;  2MJV B;  4YYH A;  3O36 A;  4YAX A;  5EU1 A;  4HXS A;  3UVW A;  5F25 A;  2YEM A;  4LC2 A;  3U5N A;  5IGL A;  5ENE A;  4YYI A;  4BHW A;  3ZYU A;  4QST A;  4HBW A;  4KV4 A;  5EWW A;  5DYX A;  5F1H A;  4IR3 A;  4UIW A;  5F61 A;  4YH3 A;  2R0S A;  4UYG A;  5I86 A;  5CZG A;  2NXB A;  4QSX A;  5A5N A;  5FG6 A;  4NUC A;  3U5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...