5C89A

Crystal structure of the human brpf1 bromodomain in complex with 917
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human BRPF1 bromodomain in complex with 917
rcsb
molecule keywords Peregrin
molecule tags Dna binding protein
source organism Homo sapiens
total genus 38
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c89A00
5DLZA 5L97A 4HXMA 4YYMA 5F3AA 5D3HA 4NRCA 5FE0A 2NXBA 3MB3A 5H85A 4RVRA 5I1QA 5FH8A 2OO1A 5I29A 4QR4A 4BW2A 5E0RA 5TCMA 5CQ6A 5L98A 5AMFA 4XYAA 4WHWA 3NXBA 4BW4A 4Q0NA 4HBYA 5IGMA 5LVRA 3LQHA 5CQ3A 4HBWA 5C85A 4UIYA 3ZYUA 4QBMA 5I80A 3QZTA 5DFDA 5EPBA 5F1LA 4O7BA 4YABA 3U5KA 4CFKA 5BT3A 5KTUA 4O7CA 4NR7A 3UV2A 4X2IA 4YC9A 4N4FA 5D3LA 4NS5A 3G0LA 5F36A 5E9KA 3UW9A 5D26A 5HQ5A 3K2JA 4ALHA 4UITA 4PCIA 5ACYA 5G4RA 5HJCA 5LJ2A 4UYHA 3HMHA 5EU1A 3UVYA 2FSAA 5FDZA 5E74A 4IOOA 5LKTA 5HM0A 4HXKA 2MJVB 5CUDA 3UVXA 4YYGA 4CUTA 4TU4A 4QSXA 4LC2A 4C67A 4CL9A 5II1A 4UIUA 5CPEA 5G4SA 5FB1A 5D0CA 2RS9B 5A5PA 2RNXA 3U5PA 4TT2A 5E9VA 3O36A 4YADA 3P5OA 2RNYA 4NYVA 4XY9A 5DFBA 5A5OA 2DVRA 4A9KA 3GG3A 3I3JA 4YBTA 5DKCA 5FFYA 2I7KA 4NXJA 5EWWA 5FE9A 4HBVA 5DKDA 3S92A 5KO4A 4MEOA 2RFJA 5LJ1A 3LJWA 4E96A 3JVJA 5F25A 5CQ8A 4BW3A 5EA1A 5AD2A 5A83A 4YYKA 5I7YA 2RI7A 4YH3A 4Z1QA 5CQAA 5FH6A 5L99A 5C4QA 4LZSA 4O78A 4QEWA 5CRMA 2D82A 3IU5A 4NR8A 2OUOA 5EI4A 5EWDA 4YAXA 4OGJA 5EWHA 5DLXA 4QSSA 5IBNA 5LVQA 5CUBA 3QZSA 4YBMA 5H1TA 4ZQLA 3LQIA 4WIVA 5EICA 5JI8A 5IGNA 4XY8A 5FE8A 4IR4A 5FE1A 5DW1A 1N72A 4DONA 5CZGA 2I8NA 1E6IA 4N4IA 5J0DA 1JSPB 4WHUA 4YH4A 5D7XA 5DYAA 3JVKA 4O70A 4CURA 2DKWA 5D3NA 5TB6A 5L8TA 4TT4A 3U5MA 4O71A 5DFCA 5ETDA 5II2A 1F68A 4MEPA 4A9MA 5HQ6A 4NR5A 3U5OA 5D3SA 5D24A 4UYFA 4NRAA 4NRBA 4QB3A 4O7FA 2RNWA 2L84A 3SVGA 2LSPB 5CTLA 5CRZA 3JVMA 3AADA 5CUEA 4IR3A 2DATA 4N4GA 4HXNA 5ENGA 4LZRA 5EPSA 5HENA 5F61A 4QSTA 4IR5A 4PY6A 4ZC9A 4O77A 4YBSA 3SVHA 3LQJA 2DWWA 4BJXA 5FG6A 5D25A 5IIDA 5ENBA 4BHWA 3JVLA 4LDFA 5F1HA 4CUSA 4UYEA 5L96A 4PCEA 3G0JA 5ETBA 2R0YA 2GRCA 5ENIA 4OUFA 4PTBA 3P1FA 4PKLA 5C89A 4N3WA 4QC3A 3U5JA 5IGKA 2L85A 5CGPA 4A9OA 4QZSA 4BW1A 5CQ7A 5CUGA 4J0RA 5I40A 4LYWA 5CUAA 5COIA 5D3TA 4TS8A 5E9IA 5CP5A 3UVDA 4O76A 5IGLA 4UYFB 3O34A 4NR9A 5DX4A 5EGUA 3AQAA 1JM4B 1WUMA 3S91A 5FFVA 4A9IA 3IU6A 4HXLA 5E3DA 3MXFA 5CFWA 4TQNA 2F6JA 5KTWA 3Q2EA 5CQ5A 4ZW1A 4TYLA 5A85A 4NR6A 4J0SA 3P1DA 5I7XA 4UYGA 4QSVA 4KV1A 2E7NA 4HBXA 4YATA 5A5RA 5JWMA 5CQ4A 5E7DA 3TLPA 4HXRA 5F5ZA 5A7CA 4MENA 3LXJA 5I86A 3HMEA 4NQNA 4O75A 3P1CA 5LKUA 3P1EA 4UIXA 4HXSA 2DVSA 4UYDA 4CUUA 5BT5A 4YK0A 4LYIA 5A5SA 1X0JA 3UV4A 5CUCA 5IG6A 4LZ2A 4HXPA 5ENFA 1WUGA 4YY4A 5EISA 4O74A 4J3IA 4F3IA 4TZ8A 4IOQA 2R0SA 2YELA 4UIZA 5E73A 5HFQA 5AD3A 4Z6IA 5KTXA 5LJ0A 2YEMA 5EWCA 5F2PA 2DVVA 4Q0OA 5HEMA 5HRVA 4OGIA 4XUAA 2YW5A 4TZ2A 4IR6A 4QUTA 4QYLA 5FE3A 4MR5A 2R10A 4QR3A 5FE7A 4YYNA 4NUDA 5A81A 4QSRA 5LKZA 2H60A 4KCXA 4AKNA 4A9EA 4J1PA 2RO1A 4LYSA 5ENJA 4QSQA 4O7AA 3RCWA 2G4AA 5HFRA 5L8UA 4LR6A 4QNSA 5DYUA 2YQDA 4O72A 5ENCA 1EQFA 5ENEA 2YEKA 4MR6A 3MB4A 5EP7A 5DBMA 5A5QA 3UVWA 4QSUA 4YYDA 4TU6A 5D3PA 4UIVA 5A82A 5F63A 5EV9A 4TTEA 4YYIA 5HRXA 5EWVA 4QYDA 5C8GA 5LUUA 5DW2A 4C66A 5EVAA 5CS8A 5HQ7A 4CUQA 2R0VA 3U5LA 5A5NA 5E9MA 5E3GA 4TT6A 5D3RA 4A9FA 5E9LA 2KTBB 5CU8A 5KU3A 5EM3A 5CY9A 5FE5A 3HMFA 3D7CA 3SVFA 4IORA 5FE4A 4FLPA 5FE2A 3O37A 5H1UA 5I83A 3ONIA 4XUBA 3U5NA 5DKHA 4NR4A 5FG5A 4QEUA 5C7NA 4QC1A 3O35A 4MEQA 5EPRA 2E7OA 4NUCA 5EK9A 5FH7A 5EQ1A 1ZS5A 5KHMA 4YYJA 2D9EA 4HXOA 4YY6A 3MUKA 4PS5A 5FBXA 4NYWA 4O7EA 5HELA 5FB0A 2YYNA 4LRGA 4CLBA 5I88A 3DWYA 3Q2FA 5F60A 5FFWA 5ENHA 5BT4A 5FG4A 4Y03A 5K29A 5E9YA 4Z93A 4KV4A 4QSPA 3FKMX 4GPJA 4UIWA 5FE6A 4ALGA 4Z6HA 2N9GA 5LKXA 4Z1SA 2E3KA 5H1VA 4QSWA 4QY4A 3MQMA 3QZVA 4A9HA 5D3JA 4YYHA 4QR5A 4CFLA 2F6NA 5C87A 5DY7A 4A9JA 2OSSA 2YDWA 5HCLA 2WP1A 3MULA 4NYXA 5HRWA 5CQTA 2WP2A 4QUUA 5AMEA 4A9NA 4CUPA 4A9LA 5F62A 2DVQA 4NQMA 5HLSA 4NUEA 3DAIA 4MR3A 4MR4A 2L5EA 3UV5A 5DYCA 3O33A 4QEVA 5I89A 5DYXA 4N4HA
chains in the Genus database with same CATH superfamily
5DLZA 5L97A 4HXMA 4YYMA 5F3AA 5D3HA 4NRCA 5FE0A 2NXBA 3MB3A 5H85A 4RVRA 5I1QA 5FH8A 2OO1A 5I29A 4QR4A 4BW2A 5E0RA 5TCMA 5CQ6A 5L98A 5AMFA 4XYAA 4WHWA 3NXBA 4BW4A 4Q0NA 4HBYA 5IGMA 5LVRA 3LQHA 5CQ3A 4HBWA 5C85A 4UIYA 3ZYUA 4QBMA 5I80A 3QZTA 5DFDA 5EPBA 5F1LA 4O7BA 4YABA 3U5KA 4CFKA 5BT3A 5KTUA 4O7CA 4NR7A 3UV2A 4X2IA 3D1DA 4YC9A 4N4FA 5D3LA 4NS5A 3G0LA 5F36A 5E9KA 3UW9A 5D26A 5HQ5A 3K2JA 4ALHA 4UITA 4PCIA 5ACYA 5G4RA 5HJCA 5LJ2A 4UYHA 3HMHA 5EU1A 3UVYA 2FSAA 5FDZA 5E74A 4IOOA 5LKTA 5HM0A 4HXKA 2MJVB 5CUDA 3UVXA 4YYGA 4CUTA 1PUOA 4TU4A 4QSXA 4LC2A 4C67A 4CL9A 5II1A 4UIUA 5CPEA 5G4SA 5FB1A 5D0CA 2RS9B 5A5PA 2RNXA 3U5PA 4TT2A 5E9VA 3O36A 4YADA 3P5OA 2RNYA 4NYVA 4XY9A 5DFBA 5A5OA 2DVRA 4A9KA 3GG3A 3I3JA 4YBTA 5DKCA 5FFYA 2I7KA 4NXJA 5EWWA 5FE9A 4HBVA 5DKDA 3S92A 5KO4A 4MEOA 2RFJA 5LJ1A 3LJWA 4E96A 3JVJA 5F25A 5CQ8A 4BW3A 5EA1A 5AD2A 5A83A 4YYKA 5I7YA 2RI7A 4YH3A 4Z1QA 5CQAA 5FH6A 5L99A 5C4QA 4LZSA 4O78A 4QEWA 5CRMA 2D82A 3IU5A 4NR8A 2OUOA 5EI4A 5EWDA 4YAXA 4OGJA 5EWHA 5DLXA 4QSSA 5IBNA 5LVQA 5CUBA 3QZSA 4YBMA 5H1TA 4ZQLA 3LQIA 4WIVA 5EICA 5JI8A 5IGNA 4XY8A 5FE8A 4IR4A 5FE1A 5DW1A 1N72A 4DONA 5CZGA 2I8NA 1E6IA 4N4IA 5J0DA 1JSPB 4WHUA 4YH4A 5D7XA 5DYAA 3JVKA 4O70A 4CURA 2DKWA 5D3NA 5TB6A 5L8TA 4TT4A 3U5MA 4O71A 5DFCA 5ETDA 5II2A 1F68A 4MEPA 4A9MA 5HQ6A 4NR5A 3U5OA 5D3SA 5D24A 4UYFA 4NRAA 4NRBA 4QB3A 4O7FA 2RNWA 2L84A 3SVGA 2LSPB 5CTLA 5CRZA 3JVMA 3AADA 5CUEA 4IR3A 2DATA 4N4GA 4HXNA 5ENGA 3ERRA 4LZRA 5EPSA 5HENA 5F61A 4QSTA 4IR5A 4PY6A 4ZC9A 4O77A 4YBSA 3SVHA 3LQJA 2DWWA 4BJXA 5FG6A 5D25A 5IIDA 5ENBA 4BHWA 3JVLA 4LDFA 5F1HA 4CUSA 4UYEA 5L96A 4PCEA 3G0JA 5ETBA 2R0YA 2GRCA 5ENIA 4OUFA 4PTBA 3P1FA 4PKLA 5C89A 4N3WA 4QC3A 3U5JA 5IGKA 2L85A 5CGPA 4A9OA 4QZSA 4BW1A 5CQ7A 5CUGA 4J0RA 5I40A 4LYWA 5CUAA 5COIA 5D3TA 4TS8A 5E9IA 5CP5A 3UVDA 4O76A 5IGLA 4AKGA 4UYFB 3O34A 4NR9A 5DX4A 5EGUA 3AQAA 4AKHA 1JM4B 1WUMA 3S91A 5FFVA 4A9IA 3IU6A 4HXLA 5E3DA 3MXFA 5CFWA 4TQNA 2F6JA 5KTWA 3Q2EA 5CQ5A 4ZW1A 4TYLA 5A85A 4NR6A 4J0SA 3P1DA 5I7XA 4UYGA 4QSVA 4KV1A 2E7NA 4HBXA 4YATA 5A5RA 5JWMA 5CQ4A 5E7DA 3TLPA 4HXRA 5F5ZA 5A7CA 4MENA 3LXJA 5I86A 3HMEA 4NQNA 4O75A 3P1CA 5LKUA 3P1EA 4UIXA 4HXSA 2DVSA 4UYDA 4CUUA 5BT5A 4YK0A 4LYIA 5A5SA 1X0JA 3UV4A 5CUCA 5IG6A 4LZ2A 4HXPA 5ENFA 1WUGA 4YY4A 5EISA 4O74A 4J3IA 4F3IA 4TZ8A 4IOQA 2R0SA 2YELA 4UIZA 5E73A 3D1BA 5HFQA 5AD3A 4Z6IA 5KTXA 5LJ0A 2YEMA 5EWCA 5F2PA 2DVVA 4Q0OA 5HEMA 5HRVA 4OGIA 4XUAA 2YW5A 4TZ2A 4IR6A 4QUTA 4QYLA 5FE3A 4MR5A 2R10A 4QR3A 5FE7A 4YYNA 4NUDA 5A81A 4QSRA 5LKZA 2H60A 4KCXA 4AKNA 4A9EA 4J1PA 2RO1A 4LYSA 5ENJA 4QSQA 1ZKRA 4O7AA 3RCWA 2G4AA 5HFRA 5L8UA 4LR6A 4QNSA 5DYUA 2YQDA 4O72A 5ENCA 1EQFA 5ENEA 2YEKA 4MR6A 3MB4A 5EP7A 5DBMA 5A5QA 3UVWA 4QSUA 4YYDA 4TU6A 5D3PA 3VKHA 4UIVA 5A82A 5F63A 5EV9A 4TTEA 4YYIA 5HRXA 5EWVA 4QYDA 5C8GA 4AKIA 5LUUA 5DW2A 4C66A 5EVAA 2EJNA 5CS8A 5HQ7A 4CUQA 2R0VA 3U5LA 5A5NA 5E9MA 5E3GA 4TT6A 5D3RA 4A9FA 5E9LA 2KTBB 5CU8A 5KU3A 5EM3A 5CY9A 5FE5A 3HMFA 3D7CA 3SVFA 4IORA 5FE4A 4FLPA 5FE2A 3O37A 5H1UA 5I83A 3ONIA 4XUBA 3U5NA 5DKHA 4NR4A 5FG5A 4QEUA 5C7NA 4QC1A 3O35A 4MEQA 5EPRA 2E7OA 4NUCA 5EK9A 5FH7A 5EQ1A 1ZS5A 5KHMA 4YYJA 2D9EA 4HXOA 4YY6A 3MUKA 4PS5A 5FBXA 3VKGA 4NYWA 4O7EA 5HELA 5FB0A 2YYNA 4LRGA 4CLBA 5I88A 3DWYA 3Q2FA 5F60A 5FFWA 5ENHA 5BT4A 5FG4A 4Y03A 5K29A 5E9YA 4Z93A 4KV4A 4QSPA 3FKMX 4GPJA 4UIWA 5FE6A 4ALGA 4Z6HA 2N9GA 5LKXA 4Z1SA 2E3KA 5H1VA 4QSWA 4QY4A 4AI6A 3MQMA 3QZVA 4A9HA 5D3JA 4YYHA 4QR5A 4CFLA 2F6NA 5C87A 5DY7A 4A9JA 2OSSA 2YDWA 5HCLA 2WP1A 3MULA 4NYXA 5HRWA 5CQTA 2WP2A 4QUUA 5AMEA 4A9NA 4CUPA 4A9LA 5F62A 2DVQA 4NQMA 5HLSA 4NUEA 3DAIA 4MR3A 4MR4A 2L5EA 3UV5A 5DYCA 3O33A 4QEVA 5I89A 5DYXA 4N4HA
chains in the Genus database with same CATH topology
5DLZA 5L97A 4HXMA 4YYMA 5F3AA 5D3HA 4NRCA 5FE0A 2NXBA 3MB3A 5H85A 4RVRA 5I1QA 5FH8A 2OO1A 5I29A 4QR4A 4BW2A 5E0RA 5TCMA 5CQ6A 5L98A 5AMFA 4XYAA 4WHWA 3NXBA 4BW4A 4Q0NA 4HBYA 5IGMA 5LVRA 3LQHA 5CQ3A 4HBWA 5C85A 4UIYA 3ZYUA 4QBMA 5I80A 3QZTA 5DFDA 5EPBA 5F1LA 4O7BA 4YABA 3U5KA 4CFKA 5BT3A 5KTUA 4O7CA 4NR7A 3UV2A 4X2IA 4YC9A 4N4FA 5D3LA 4NS5A 3G0LA 5F36A 5E9KA 3UW9A 5D26A 5HQ5A 3K2JA 4ALHA 4UITA 4PCIA 5ACYA 5G4RA 5HJCA 5LJ2A 4UYHA 3HMHA 5EU1A 3UVYA 2FSAA 5FDZA 5E74A 4IOOA 5LKTA 5HM0A 4HXKA 2MJVB 5CUDA 3UVXA 4YYGA 4CUTA 4TU4A 4QSXA 4LC2A 4C67A 4CL9A 5II1A 4UIUA 5CPEA 5G4SA 5FB1A 5D0CA 2RS9B 5A5PA 2RNXA 3U5PA 4TT2A 5E9VA 3O36A 4YADA 3P5OA 2RNYA 4NYVA 4XY9A 5DFBA 5A5OA 2DVRA 4A9KA 3GG3A 3I3JA 4YBTA 5DKCA 5FFYA 2I7KA 4NXJA 5EWWA 5FE9A 4HBVA 5DKDA 3S92A 5KO4A 4MEOA 2RFJA 5LJ1A 3LJWA 4E96A 3JVJA 5F25A 5CQ8A 4BW3A 5EA1A 5AD2A 5A83A 4YYKA 5I7YA 2RI7A 4YH3A 4Z1QA 5CQAA 5FH6A 5L99A 5C4QA 4LZSA 4O78A 4QEWA 5CRMA 2D82A 3IU5A 4NR8A 2OUOA 5EI4A 5EWDA 4YAXA 4OGJA 5EWHA 5DLXA 4QSSA 5IBNA 5LVQA 5CUBA 3QZSA 4YBMA 5H1TA 4ZQLA 3LQIA 4WIVA 5EICA 5JI8A 5IGNA 4XY8A 5FE8A 4IR4A 5FE1A 5DW1A 1N72A 4DONA 5CZGA 2I8NA 1E6IA 4N4IA 5J0DA 1JSPB 4WHUA 4YH4A 5D7XA 5DYAA 3JVKA 4O70A 4CURA 2DKWA 5D3NA 5TB6A 5L8TA 4TT4A 3U5MA 4O71A 5DFCA 5ETDA 5II2A 1F68A 4MEPA 4A9MA 5HQ6A 4NR5A 3U5OA 5D3SA 5D24A 4UYFA 4NRAA 4NRBA 4QB3A 4O7FA 2RNWA 2L84A 3SVGA 2LSPB 5CTLA 5CRZA 3JVMA 3AADA 5CUEA 4IR3A 2DATA 4N4GA 4HXNA 5ENGA 4LZRA 5EPSA 5HENA 5F61A 4QSTA 4IR5A 4PY6A 4ZC9A 4O77A 4YBSA 3SVHA 3LQJA 2DWWA 4BJXA 5FG6A 5D25A 5IIDA 5ENBA 4BHWA 3JVLA 4LDFA 5F1HA 4CUSA 4UYEA 5L96A 4PCEA 3G0JA 5ETBA 2R0YA 2GRCA 5ENIA 4OUFA 4PTBA 3P1FA 4PKLA 5C89A 4N3WA 4QC3A 3U5JA 5IGKA 2L85A 5CGPA 4A9OA 4QZSA 4BW1A 5CQ7A 5CUGA 4J0RA 5I40A 4LYWA 5CUAA 5COIA 5D3TA 4TS8A 5E9IA 5CP5A 3UVDA 4O76A 5IGLA 4UYFB 3O34A 4NR9A 5DX4A 5EGUA 3AQAA 1JM4B 1WUMA 3S91A 5FFVA 4A9IA 3IU6A 4HXLA 5E3DA 3MXFA 5CFWA 4TQNA 2F6JA 5KTWA 3Q2EA 5CQ5A 4ZW1A 4TYLA 5A85A 4NR6A 4J0SA 3P1DA 5I7XA 4UYGA 4QSVA 4KV1A 2E7NA 4HBXA 4YATA 5A5RA 5JWMA 5CQ4A 5E7DA 3TLPA 4HXRA 5F5ZA 5A7CA 4MENA 3LXJA 5I86A 3HMEA 4NQNA 4O75A 3P1CA 5LKUA 3P1EA 4UIXA 4HXSA 2DVSA 4UYDA 4CUUA 5BT5A 4YK0A 4LYIA 5A5SA 1X0JA 3UV4A 5CUCA 5IG6A 4LZ2A 4HXPA 5ENFA 1WUGA 4YY4A 5EISA 4O74A 4J3IA 4F3IA 4TZ8A 4IOQA 2R0SA 2YELA 4UIZA 5E73A 5HFQA 5AD3A 4Z6IA 5KTXA 5LJ0A 2YEMA 5EWCA 5F2PA 2DVVA 4Q0OA 5HEMA 5HRVA 4OGIA 4XUAA 2YW5A 4TZ2A 4IR6A 4QUTA 4QYLA 5FE3A 4MR5A 2R10A 4QR3A 5FE7A 4YYNA 4NUDA 5A81A 4QSRA 5LKZA 2H60A 4KCXA 4AKNA 4A9EA 4J1PA 2RO1A 4LYSA 5ENJA 4QSQA 4O7AA 3RCWA 2G4AA 5HFRA 5L8UA 4LR6A 4QNSA 5DYUA 2YQDA 4O72A 5ENCA 1EQFA 5ENEA 2YEKA 4MR6A 3MB4A 5EP7A 5DBMA 5A5QA 3UVWA 4QSUA 4YYDA 4TU6A 5D3PA 4UIVA 5A82A 5F63A 5EV9A 4TTEA 4YYIA 5HRXA 5EWVA 4QYDA 5C8GA 5LUUA 5DW2A 4C66A 5EVAA 5CS8A 5HQ7A 4CUQA 2R0VA 3U5LA 5A5NA 5E9MA 5E3GA 4TT6A 5D3RA 4A9FA 5E9LA 2KTBB 5CU8A 5KU3A 5EM3A 5CY9A 5FE5A 3HMFA 3D7CA 3SVFA 4IORA 5FE4A 4FLPA 5FE2A 3O37A 5H1UA 5I83A 3ONIA 4XUBA 3U5NA 5DKHA 4NR4A 5FG5A 4QEUA 5C7NA 4QC1A 3O35A 4MEQA 5EPRA 2E7OA 4NUCA 5EK9A 5FH7A 5EQ1A 1ZS5A 5KHMA 4YYJA 2D9EA 4HXOA 4YY6A 3MUKA 4PS5A 5FBXA 4NYWA 4O7EA 5HELA 5FB0A 2YYNA 4LRGA 4CLBA 5I88A 3DWYA 3Q2FA 5F60A 5FFWA 5ENHA 5BT4A 5FG4A 4Y03A 5K29A 5E9YA 4Z93A 4KV4A 4QSPA 3FKMX 4GPJA 4UIWA 5FE6A 4ALGA 4Z6HA 2N9GA 5LKXA 4Z1SA 2E3KA 5H1VA 4QSWA 4QY4A 3MQMA 3QZVA 4A9HA 5D3JA 4YYHA 4QR5A 4CFLA 2F6NA 5C87A 5DY7A 4A9JA 2OSSA 2YDWA 5HCLA 2WP1A 3MULA 4NYXA 5HRWA 5CQTA 2WP2A 4QUUA 5AMEA 4A9NA 4CUPA 4A9LA 5F62A 2DVQA 4NQMA 5HLSA 4NUEA 3DAIA 4MR3A 4MR4A 2L5EA 3UV5A 5DYCA 3O33A 4QEVA 5I89A 5DYXA 4N4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLZ A;  5L97 A;  4HXM A;  4YYM A;  5F3A A;  5D3H A;  4NRC A;  5FE0 A;  2NXB A;  3MB3 A;  5H85 A;  4RVR A;  5I1Q A;  5FH8 A;  2OO1 A;  5I29 A;  4QR4 A;  4BW2 A;  5E0R A;  5TCM A;  5CQ6 A;  5L98 A;  5AMF A;  4XYA A;  4WHW A;  3NXB A;  4BW4 A;  4Q0N A;  4HBY A;  5IGM A;  5LVR A;  3LQH A;  5CQ3 A;  4HBW A;  5C85 A;  4UIY A;  3ZYU A;  4QBM A;  5I80 A;  3QZT A;  5DFD A;  5EPB A;  5F1L A;  4O7B A;  4YAB A;  3U5K A;  4CFK A;  5BT3 A;  5KTU A;  4O7C A;  4NR7 A;  3UV2 A;  4X2I A;  4YC9 A;  4N4F A;  5D3L A;  4NS5 A;  3G0L A;  5F36 A;  5E9K A;  3UW9 A;  5D26 A;  5HQ5 A;  3K2J A;  4ALH A;  4UIT A;  4PCI A;  5ACY A;  5G4R A;  5HJC A;  5LJ2 A;  4UYH A;  3HMH A;  5EU1 A;  3UVY A;  2FSA A;  5FDZ A;  5E74 A;  4IOO A;  5LKT A;  5HM0 A;  4HXK A;  2MJV B;  5CUD A;  3UVX A;  4YYG A;  4CUT A;  4TU4 A;  4QSX A;  4LC2 A;  4C67 A;  4CL9 A;  5II1 A;  4UIU A;  5CPE A;  5G4S A;  5FB1 A;  5D0C A;  2RS9 B;  5A5P A;  2RNX A;  3U5P A;  4TT2 A;  5E9V A;  3O36 A;  4YAD A;  3P5O A;  2RNY A;  4NYV A;  4XY9 A;  5DFB A;  5A5O A;  2DVR A;  4A9K A;  3GG3 A;  3I3J A;  4YBT A;  5DKC A;  5FFY A;  2I7K A;  4NXJ A;  5EWW A;  5FE9 A;  4HBV A;  5DKD A;  3S92 A;  5KO4 A;  4MEO A;  2RFJ A;  5LJ1 A;  3LJW A;  4E96 A;  3JVJ A;  5F25 A;  5CQ8 A;  4BW3 A;  5EA1 A;  5AD2 A;  5A83 A;  4YYK A;  5I7Y A;  2RI7 A;  4YH3 A;  4Z1Q A;  5CQA A;  5FH6 A;  5L99 A;  5C4Q A;  4LZS A;  4O78 A;  4QEW A;  5CRM A;  2D82 A;  3IU5 A;  4NR8 A;  2OUO A;  5EI4 A;  5EWD A;  4YAX A;  4OGJ A;  5EWH A;  5DLX A;  4QSS A;  5IBN A;  5LVQ A;  5CUB A;  3QZS A;  4YBM A;  5H1T A;  4ZQL A;  3LQI A;  4WIV A;  5EIC A;  5JI8 A;  5IGN A;  4XY8 A;  5FE8 A;  4IR4 A;  5FE1 A;  5DW1 A;  1N72 A;  4DON A;  5CZG A;  2I8N A;  1E6I A;  4N4I A;  5J0D A;  1JSP B;  4WHU A;  4YH4 A;  5D7X A;  5DYA A;  3JVK A;  4O70 A;  4CUR A;  2DKW A;  5D3N A;  5TB6 A;  5L8T A;  4TT4 A;  3U5M A;  4O71 A;  5DFC A;  5ETD A;  5II2 A;  1F68 A;  4MEP A;  4A9M A;  5HQ6 A;  4NR5 A;  3U5O A;  5D3S A;  5D24 A;  4UYF A;  4NRA A;  4NRB A;  4QB3 A;  4O7F A;  2RNW A;  2L84 A;  3SVG A;  2LSP B;  5CTL A;  5CRZ A;  3JVM A;  3AAD A;  5CUE A;  4IR3 A;  2DAT A;  4N4G A;  4HXN A;  5ENG A;  4LZR A;  5EPS A;  5HEN A;  5F61 A;  4QST A;  4IR5 A;  4PY6 A;  4ZC9 A;  4O77 A;  4YBS A;  3SVH A;  3LQJ A;  2DWW A;  4BJX A;  5FG6 A;  5D25 A;  5IID A;  5ENB A;  4BHW A;  3JVL A;  4LDF A;  5F1H A;  4CUS A;  4UYE A;  5L96 A;  4PCE A;  3G0J A;  5ETB A;  2R0Y A;  2GRC A;  5ENI A;  4OUF A;  4PTB A;  3P1F A;  4PKL A;  5C89 A;  4N3W A;  4QC3 A;  3U5J A;  5IGK A;  2L85 A;  5CGP A;  4A9O A;  4QZS A;  4BW1 A;  5CQ7 A;  5CUG A;  4J0R A;  5I40 A;  4LYW A;  5CUA A;  5COI A;  5D3T A;  4TS8 A;  5E9I A;  5CP5 A;  3UVD A;  4O76 A;  5IGL A;  4UYF B;  3O34 A;  4NR9 A;  5DX4 A;  5EGU A;  3AQA A;  1JM4 B;  1WUM A;  3S91 A;  5FFV A;  4A9I A;  3IU6 A;  4HXL A;  5E3D A;  3MXF A;  5CFW A;  4TQN A;  2F6J A;  5KTW A;  3Q2E A;  5CQ5 A;  4ZW1 A;  4TYL A;  5A85 A;  4NR6 A;  4J0S A;  3P1D A;  5I7X A;  4UYG A;  4QSV A;  4KV1 A;  2E7N A;  4HBX A;  4YAT A;  5A5R A;  5JWM A;  5CQ4 A;  5E7D A;  3TLP A;  4HXR A;  5F5Z A;  5A7C A;  4MEN A;  3LXJ A;  5I86 A;  3HME A;  4NQN A;  4O75 A;  3P1C A;  5LKU A;  3P1E A;  4UIX A;  4HXS A;  2DVS A;  4UYD A;  4CUU A;  5BT5 A;  4YK0 A;  4LYI A;  5A5S A;  1X0J A;  3UV4 A;  5CUC A;  5IG6 A;  4LZ2 A;  4HXP A;  5ENF A;  1WUG A;  4YY4 A;  5EIS A;  4O74 A;  4J3I A;  4F3I A;  4TZ8 A;  4IOQ A;  2R0S A;  2YEL A;  4UIZ A;  5E73 A;  5HFQ A;  5AD3 A;  4Z6I A;  5KTX A;  5LJ0 A;  2YEM A;  5EWC A;  5F2P A;  2DVV A;  4Q0O A;  5HEM A;  5HRV A;  4OGI A;  4XUA A;  2YW5 A;  4TZ2 A;  4IR6 A;  4QUT A;  4QYL A;  5FE3 A;  4MR5 A;  2R10 A;  4QR3 A;  5FE7 A;  4YYN A;  4NUD A;  5A81 A;  4QSR A;  5LKZ A;  2H60 A;  4KCX A;  4AKN A;  4A9E A;  4J1P A;  2RO1 A;  4LYS A;  5ENJ A;  4QSQ A;  4O7A A;  3RCW A;  2G4A A;  5HFR A;  5L8U A;  4LR6 A;  4QNS A;  5DYU A;  2YQD A;  4O72 A;  5ENC A;  1EQF A;  5ENE A;  2YEK A;  4MR6 A;  3MB4 A;  5EP7 A;  5DBM A;  5A5Q A;  3UVW A;  4QSU A;  4YYD A;  4TU6 A;  5D3P A;  4UIV A;  5A82 A;  5F63 A;  5EV9 A;  4TTE A;  4YYI A;  5HRX A;  5EWV A;  4QYD A;  5C8G A;  5LUU A;  5DW2 A;  4C66 A;  5EVA A;  5CS8 A;  5HQ7 A;  4CUQ A;  2R0V A;  3U5L A;  5A5N A;  5E9M A;  5E3G A;  4TT6 A;  5D3R A;  4A9F A;  5E9L A;  2KTB B;  5CU8 A;  5KU3 A;  5EM3 A;  5CY9 A;  5FE5 A;  3HMF A;  3D7C A;  3SVF A;  4IOR A;  5FE4 A;  4FLP A;  5FE2 A;  3O37 A;  5H1U A;  5I83 A;  3ONI A;  4XUB A;  3U5N A;  5DKH A;  4NR4 A;  5FG5 A;  4QEU A;  5C7N A;  4QC1 A;  3O35 A;  4MEQ A;  5EPR A;  2E7O A;  4NUC A;  5EK9 A;  5FH7 A;  5EQ1 A;  1ZS5 A;  5KHM A;  4YYJ A;  2D9E A;  4HXO A;  4YY6 A;  3MUK A;  4PS5 A;  5FBX A;  4NYW A;  4O7E A;  5HEL A;  5FB0 A;  2YYN A;  4LRG A;  4CLB A;  5I88 A;  3DWY A;  3Q2F A;  5F60 A;  5FFW A;  5ENH A;  5BT4 A;  5FG4 A;  4Y03 A;  5K29 A;  5E9Y A;  4Z93 A;  4KV4 A;  4QSP A;  3FKM X;  4GPJ A;  4UIW A;  5FE6 A;  4ALG A;  4Z6H A;  2N9G A;  5LKX A;  4Z1S A;  2E3K A;  5H1V A;  4QSW A;  4QY4 A;  3MQM A;  3QZV A;  4A9H A;  5D3J A;  4YYH A;  4QR5 A;  4CFL A;  2F6N A;  5C87 A;  5DY7 A;  4A9J A;  2OSS A;  2YDW A;  5HCL A;  2WP1 A;  3MUL A;  4NYX A;  5HRW A;  5CQT A;  2WP2 A;  4QUU A;  5AME A;  4A9N A;  4CUP A;  4A9L A;  5F62 A;  2DVQ A;  4NQM A;  5HLS A;  4NUE A;  3DAI A;  4MR3 A;  4MR4 A;  2L5E A;  3UV5 A;  5DYC A;  3O33 A;  4QEV A;  5I89 A;  5DYX A;  4N4H A; 
#chains in the Genus database with same CATH topology
 5DLZ A;  5L97 A;  4HXM A;  4YYM A;  5F3A A;  5D3H A;  4NRC A;  5FE0 A;  2NXB A;  3MB3 A;  5H85 A;  4RVR A;  5I1Q A;  5FH8 A;  2OO1 A;  5I29 A;  4QR4 A;  4BW2 A;  5E0R A;  5TCM A;  5CQ6 A;  5L98 A;  5AMF A;  4XYA A;  4WHW A;  3NXB A;  4BW4 A;  4Q0N A;  4HBY A;  5IGM A;  5LVR A;  3LQH A;  5CQ3 A;  4HBW A;  5C85 A;  4UIY A;  3ZYU A;  4QBM A;  5I80 A;  3QZT A;  5DFD A;  5EPB A;  5F1L A;  4O7B A;  4YAB A;  3U5K A;  4CFK A;  5BT3 A;  5KTU A;  4O7C A;  4NR7 A;  3UV2 A;  4X2I A;  3D1D A;  4YC9 A;  4N4F A;  5D3L A;  4NS5 A;  3G0L A;  5F36 A;  5E9K A;  3UW9 A;  5D26 A;  5HQ5 A;  3K2J A;  4ALH A;  4UIT A;  4PCI A;  5ACY A;  5G4R A;  5HJC A;  5LJ2 A;  4UYH A;  3HMH A;  5EU1 A;  3UVY A;  2FSA A;  5FDZ A;  5E74 A;  4IOO A;  5LKT A;  5HM0 A;  4HXK A;  2MJV B;  5CUD A;  3UVX A;  4YYG A;  4CUT A;  1PUO A;  4TU4 A;  4QSX A;  4LC2 A;  4C67 A;  4CL9 A;  5II1 A;  4UIU A;  5CPE A;  5G4S A;  5FB1 A;  5D0C A;  2RS9 B;  5A5P A;  2RNX A;  3U5P A;  4TT2 A;  5E9V A;  3O36 A;  4YAD A;  3P5O A;  2RNY A;  4NYV A;  4XY9 A;  5DFB A;  5A5O A;  2DVR A;  4A9K A;  3GG3 A;  3I3J A;  4YBT A;  5DKC A;  5FFY A;  2I7K A;  4NXJ A;  5EWW A;  5FE9 A;  4HBV A;  5DKD A;  3S92 A;  5KO4 A;  4MEO A;  2RFJ A;  5LJ1 A;  3LJW A;  4E96 A;  3JVJ A;  5F25 A;  5CQ8 A;  4BW3 A;  5EA1 A;  5AD2 A;  5A83 A;  4YYK A;  5I7Y A;  2RI7 A;  4YH3 A;  4Z1Q A;  5CQA A;  5FH6 A;  5L99 A;  5C4Q A;  4LZS A;  4O78 A;  4QEW A;  5CRM A;  2D82 A;  3IU5 A;  4NR8 A;  2OUO A;  5EI4 A;  5EWD A;  4YAX A;  4OGJ A;  5EWH A;  5DLX A;  4QSS A;  5IBN A;  5LVQ A;  5CUB A;  3QZS A;  4YBM A;  5H1T A;  4ZQL A;  3LQI A;  4WIV A;  5EIC A;  5JI8 A;  5IGN A;  4XY8 A;  5FE8 A;  4IR4 A;  5FE1 A;  5DW1 A;  1N72 A;  4DON A;  5CZG A;  2I8N A;  1E6I A;  4N4I A;  5J0D A;  1JSP B;  4WHU A;  4YH4 A;  5D7X A;  5DYA A;  3JVK A;  4O70 A;  4CUR A;  2DKW A;  5D3N A;  5TB6 A;  5L8T A;  4TT4 A;  3U5M A;  4O71 A;  5DFC A;  5ETD A;  5II2 A;  1F68 A;  4MEP A;  4A9M A;  5HQ6 A;  4NR5 A;  3U5O A;  5D3S A;  5D24 A;  4UYF A;  4NRA A;  4NRB A;  4QB3 A;  4O7F A;  2RNW A;  2L84 A;  3SVG A;  2LSP B;  5CTL A;  5CRZ A;  3JVM A;  3AAD A;  5CUE A;  4IR3 A;  2DAT A;  4N4G A;  4HXN A;  5ENG A;  3ERR A;  4LZR A;  5EPS A;  5HEN A;  5F61 A;  4QST A;  4IR5 A;  4PY6 A;  4ZC9 A;  4O77 A;  4YBS A;  3SVH A;  3LQJ A;  2DWW A;  4BJX A;  5FG6 A;  5D25 A;  5IID A;  5ENB A;  4BHW A;  3JVL A;  4LDF A;  5F1H A;  4CUS A;  4UYE A;  5L96 A;  4PCE A;  3G0J A;  5ETB A;  2R0Y A;  2GRC A;  5ENI A;  4OUF A;  4PTB A;  3P1F A;  4PKL A;  5C89 A;  4N3W A;  4QC3 A;  3U5J A;  5IGK A;  2L85 A;  5CGP A;  4A9O A;  4QZS A;  4BW1 A;  5CQ7 A;  5CUG A;  4J0R A;  5I40 A;  4LYW A;  5CUA A;  5COI A;  5D3T A;  4TS8 A;  5E9I A;  5CP5 A;  3UVD A;  4O76 A;  5IGL A;  4AKG A;  4UYF B;  3O34 A;  4NR9 A;  5DX4 A;  5EGU A;  3AQA A;  4AKH A;  1JM4 B;  1WUM A;  3S91 A;  5FFV A;  4A9I A;  3IU6 A;  4HXL A;  5E3D A;  3MXF A;  5CFW A;  4TQN A;  2F6J A;  5KTW A;  3Q2E A;  5CQ5 A;  4ZW1 A;  4TYL A;  5A85 A;  4NR6 A;  4J0S A;  3P1D A;  5I7X A;  4UYG A;  4QSV A;  4KV1 A;  2E7N A;  4HBX A;  4YAT A;  5A5R A;  5JWM A;  5CQ4 A;  5E7D A;  3TLP A;  4HXR A;  5F5Z A;  5A7C A;  4MEN A;  3LXJ A;  5I86 A;  3HME A;  4NQN A;  4O75 A;  3P1C A;  5LKU A;  3P1E A;  4UIX A;  4HXS A;  2DVS A;  4UYD A;  4CUU A;  5BT5 A;  4YK0 A;  4LYI A;  5A5S A;  1X0J A;  3UV4 A;  5CUC A;  5IG6 A;  4LZ2 A;  4HXP A;  5ENF A;  1WUG A;  4YY4 A;  5EIS A;  4O74 A;  4J3I A;  4F3I A;  4TZ8 A;  4IOQ A;  2R0S A;  2YEL A;  4UIZ A;  5E73 A;  3D1B A;  5HFQ A;  5AD3 A;  4Z6I A;  5KTX A;  5LJ0 A;  2YEM A;  5EWC A;  5F2P A;  2DVV A;  4Q0O A;  5HEM A;  5HRV A;  4OGI A;  4XUA A;  2YW5 A;  4TZ2 A;  4IR6 A;  4QUT A;  4QYL A;  5FE3 A;  4MR5 A;  2R10 A;  4QR3 A;  5FE7 A;  4YYN A;  4NUD A;  5A81 A;  4QSR A;  5LKZ A;  2H60 A;  4KCX A;  4AKN A;  4A9E A;  4J1P A;  2RO1 A;  4LYS A;  5ENJ A;  4QSQ A;  1ZKR A;  4O7A A;  3RCW A;  2G4A A;  5HFR A;  5L8U A;  4LR6 A;  4QNS A;  5DYU A;  2YQD A;  4O72 A;  5ENC A;  1EQF A;  5ENE A;  2YEK A;  4MR6 A;  3MB4 A;  5EP7 A;  5DBM A;  5A5Q A;  3UVW A;  4QSU A;  4YYD A;  4TU6 A;  5D3P A;  3VKH A;  4UIV A;  5A82 A;  5F63 A;  5EV9 A;  4TTE A;  4YYI A;  5HRX A;  5EWV A;  4QYD A;  5C8G A;  4AKI A;  5LUU A;  5DW2 A;  4C66 A;  5EVA A;  2EJN A;  5CS8 A;  5HQ7 A;  4CUQ A;  2R0V A;  3U5L A;  5A5N A;  5E9M A;  5E3G A;  4TT6 A;  5D3R A;  4A9F A;  5E9L A;  2KTB B;  5CU8 A;  5KU3 A;  5EM3 A;  5CY9 A;  5FE5 A;  3HMF A;  3D7C A;  3SVF A;  4IOR A;  5FE4 A;  4FLP A;  5FE2 A;  3O37 A;  5H1U A;  5I83 A;  3ONI A;  4XUB A;  3U5N A;  5DKH A;  4NR4 A;  5FG5 A;  4QEU A;  5C7N A;  4QC1 A;  3O35 A;  4MEQ A;  5EPR A;  2E7O A;  4NUC A;  5EK9 A;  5FH7 A;  5EQ1 A;  1ZS5 A;  5KHM A;  4YYJ A;  2D9E A;  4HXO A;  4YY6 A;  3MUK A;  4PS5 A;  5FBX A;  3VKG A;  4NYW A;  4O7E A;  5HEL A;  5FB0 A;  2YYN A;  4LRG A;  4CLB A;  5I88 A;  3DWY A;  3Q2F A;  5F60 A;  5FFW A;  5ENH A;  5BT4 A;  5FG4 A;  4Y03 A;  5K29 A;  5E9Y A;  4Z93 A;  4KV4 A;  4QSP A;  3FKM X;  4GPJ A;  4UIW A;  5FE6 A;  4ALG A;  4Z6H A;  2N9G A;  5LKX A;  4Z1S A;  2E3K A;  5H1V A;  4QSW A;  4QY4 A;  4AI6 A;  3MQM A;  3QZV A;  4A9H A;  5D3J A;  4YYH A;  4QR5 A;  4CFL A;  2F6N A;  5C87 A;  5DY7 A;  4A9J A;  2OSS A;  2YDW A;  5HCL A;  2WP1 A;  3MUL A;  4NYX A;  5HRW A;  5CQT A;  2WP2 A;  4QUU A;  5AME A;  4A9N A;  4CUP A;  4A9L A;  5F62 A;  2DVQ A;  4NQM A;  5HLS A;  4NUE A;  3DAI A;  4MR3 A;  4MR4 A;  2L5E A;  3UV5 A;  5DYC A;  3O33 A;  4QEV A;  5I89 A;  5DYX A;  4N4H A; 
#chains in the Genus database with same CATH homology
 5DLZ A;  5L97 A;  4HXM A;  4YYM A;  5F3A A;  5D3H A;  4NRC A;  5FE0 A;  2NXB A;  3MB3 A;  5H85 A;  4RVR A;  5I1Q A;  5FH8 A;  2OO1 A;  5I29 A;  4QR4 A;  4BW2 A;  5E0R A;  5TCM A;  5CQ6 A;  5L98 A;  5AMF A;  4XYA A;  4WHW A;  3NXB A;  4BW4 A;  4Q0N A;  4HBY A;  5IGM A;  5LVR A;  3LQH A;  5CQ3 A;  4HBW A;  5C85 A;  4UIY A;  3ZYU A;  4QBM A;  5I80 A;  3QZT A;  5DFD A;  5EPB A;  5F1L A;  4O7B A;  4YAB A;  3U5K A;  4CFK A;  5BT3 A;  5KTU A;  4O7C A;  4NR7 A;  3UV2 A;  4X2I A;  4YC9 A;  4N4F A;  5D3L A;  4NS5 A;  3G0L A;  5F36 A;  5E9K A;  3UW9 A;  5D26 A;  5HQ5 A;  3K2J A;  4ALH A;  4UIT A;  4PCI A;  5ACY A;  5G4R A;  5HJC A;  5LJ2 A;  4UYH A;  3HMH A;  5EU1 A;  3UVY A;  2FSA A;  5FDZ A;  5E74 A;  4IOO A;  5LKT A;  5HM0 A;  4HXK A;  2MJV B;  5CUD A;  3UVX A;  4YYG A;  4CUT A;  4TU4 A;  4QSX A;  4LC2 A;  4C67 A;  4CL9 A;  5II1 A;  4UIU A;  5CPE A;  5G4S A;  5FB1 A;  5D0C A;  2RS9 B;  5A5P A;  2RNX A;  3U5P A;  4TT2 A;  5E9V A;  3O36 A;  4YAD A;  3P5O A;  2RNY A;  4NYV A;  4XY9 A;  5DFB A;  5A5O A;  2DVR A;  4A9K A;  3GG3 A;  3I3J A;  4YBT A;  5DKC A;  5FFY A;  2I7K A;  4NXJ A;  5EWW A;  5FE9 A;  4HBV A;  5DKD A;  3S92 A;  5KO4 A;  4MEO A;  2RFJ A;  5LJ1 A;  3LJW A;  4E96 A;  3JVJ A;  5F25 A;  5CQ8 A;  4BW3 A;  5EA1 A;  5AD2 A;  5A83 A;  4YYK A;  5I7Y A;  2RI7 A;  4YH3 A;  4Z1Q A;  5CQA A;  5FH6 A;  5L99 A;  5C4Q A;  4LZS A;  4O78 A;  4QEW A;  5CRM A;  2D82 A;  3IU5 A;  4NR8 A;  2OUO A;  5EI4 A;  5EWD A;  4YAX A;  4OGJ A;  5EWH A;  5DLX A;  4QSS A;  5IBN A;  5LVQ A;  5CUB A;  3QZS A;  4YBM A;  5H1T A;  4ZQL A;  3LQI A;  4WIV A;  5EIC A;  5JI8 A;  5IGN A;  4XY8 A;  5FE8 A;  4IR4 A;  5FE1 A;  5DW1 A;  1N72 A;  4DON A;  5CZG A;  2I8N A;  1E6I A;  4N4I A;  5J0D A;  1JSP B;  4WHU A;  4YH4 A;  5D7X A;  5DYA A;  3JVK A;  4O70 A;  4CUR A;  2DKW A;  5D3N A;  5TB6 A;  5L8T A;  4TT4 A;  3U5M A;  4O71 A;  5DFC A;  5ETD A;  5II2 A;  1F68 A;  4MEP A;  4A9M A;  5HQ6 A;  4NR5 A;  3U5O A;  5D3S A;  5D24 A;  4UYF A;  4NRA A;  4NRB A;  4QB3 A;  4O7F A;  2RNW A;  2L84 A;  3SVG A;  2LSP B;  5CTL A;  5CRZ A;  3JVM A;  3AAD A;  5CUE A;  4IR3 A;  2DAT A;  4N4G A;  4HXN A;  5ENG A;  4LZR A;  5EPS A;  5HEN A;  5F61 A;  4QST A;  4IR5 A;  4PY6 A;  4ZC9 A;  4O77 A;  4YBS A;  3SVH A;  3LQJ A;  2DWW A;  4BJX A;  5FG6 A;  5D25 A;  5IID A;  5ENB A;  4BHW A;  3JVL A;  4LDF A;  5F1H A;  4CUS A;  4UYE A;  5L96 A;  4PCE A;  3G0J A;  5ETB A;  2R0Y A;  2GRC A;  5ENI A;  4OUF A;  4PTB A;  3P1F A;  4PKL A;  5C89 A;  4N3W A;  4QC3 A;  3U5J A;  5IGK A;  2L85 A;  5CGP A;  4A9O A;  4QZS A;  4BW1 A;  5CQ7 A;  5CUG A;  4J0R A;  5I40 A;  4LYW A;  5CUA A;  5COI A;  5D3T A;  4TS8 A;  5E9I A;  5CP5 A;  3UVD A;  4O76 A;  5IGL A;  4UYF B;  3O34 A;  4NR9 A;  5DX4 A;  5EGU A;  3AQA A;  1JM4 B;  1WUM A;  3S91 A;  5FFV A;  4A9I A;  3IU6 A;  4HXL A;  5E3D A;  3MXF A;  5CFW A;  4TQN A;  2F6J A;  5KTW A;  3Q2E A;  5CQ5 A;  4ZW1 A;  4TYL A;  5A85 A;  4NR6 A;  4J0S A;  3P1D A;  5I7X A;  4UYG A;  4QSV A;  4KV1 A;  2E7N A;  4HBX A;  4YAT A;  5A5R A;  5JWM A;  5CQ4 A;  5E7D A;  3TLP A;  4HXR A;  5F5Z A;  5A7C A;  4MEN A;  3LXJ A;  5I86 A;  3HME A;  4NQN A;  4O75 A;  3P1C A;  5LKU A;  3P1E A;  4UIX A;  4HXS A;  2DVS A;  4UYD A;  4CUU A;  5BT5 A;  4YK0 A;  4LYI A;  5A5S A;  1X0J A;  3UV4 A;  5CUC A;  5IG6 A;  4LZ2 A;  4HXP A;  5ENF A;  1WUG A;  4YY4 A;  5EIS A;  4O74 A;  4J3I A;  4F3I A;  4TZ8 A;  4IOQ A;  2R0S A;  2YEL A;  4UIZ A;  5E73 A;  5HFQ A;  5AD3 A;  4Z6I A;  5KTX A;  5LJ0 A;  2YEM A;  5EWC A;  5F2P A;  2DVV A;  4Q0O A;  5HEM A;  5HRV A;  4OGI A;  4XUA A;  2YW5 A;  4TZ2 A;  4IR6 A;  4QUT A;  4QYL A;  5FE3 A;  4MR5 A;  2R10 A;  4QR3 A;  5FE7 A;  4YYN A;  4NUD A;  5A81 A;  4QSR A;  5LKZ A;  2H60 A;  4KCX A;  4AKN A;  4A9E A;  4J1P A;  2RO1 A;  4LYS A;  5ENJ A;  4QSQ A;  4O7A A;  3RCW A;  2G4A A;  5HFR A;  5L8U A;  4LR6 A;  4QNS A;  5DYU A;  2YQD A;  4O72 A;  5ENC A;  1EQF A;  5ENE A;  2YEK A;  4MR6 A;  3MB4 A;  5EP7 A;  5DBM A;  5A5Q A;  3UVW A;  4QSU A;  4YYD A;  4TU6 A;  5D3P A;  4UIV A;  5A82 A;  5F63 A;  5EV9 A;  4TTE A;  4YYI A;  5HRX A;  5EWV A;  4QYD A;  5C8G A;  5LUU A;  5DW2 A;  4C66 A;  5EVA A;  5CS8 A;  5HQ7 A;  4CUQ A;  2R0V A;  3U5L A;  5A5N A;  5E9M A;  5E3G A;  4TT6 A;  5D3R A;  4A9F A;  5E9L A;  2KTB B;  5CU8 A;  5KU3 A;  5EM3 A;  5CY9 A;  5FE5 A;  3HMF A;  3D7C A;  3SVF A;  4IOR A;  5FE4 A;  4FLP A;  5FE2 A;  3O37 A;  5H1U A;  5I83 A;  3ONI A;  4XUB A;  3U5N A;  5DKH A;  4NR4 A;  5FG5 A;  4QEU A;  5C7N A;  4QC1 A;  3O35 A;  4MEQ A;  5EPR A;  2E7O A;  4NUC A;  5EK9 A;  5FH7 A;  5EQ1 A;  1ZS5 A;  5KHM A;  4YYJ A;  2D9E A;  4HXO A;  4YY6 A;  3MUK A;  4PS5 A;  5FBX A;  4NYW A;  4O7E A;  5HEL A;  5FB0 A;  2YYN A;  4LRG A;  4CLB A;  5I88 A;  3DWY A;  3Q2F A;  5F60 A;  5FFW A;  5ENH A;  5BT4 A;  5FG4 A;  4Y03 A;  5K29 A;  5E9Y A;  4Z93 A;  4KV4 A;  4QSP A;  3FKM X;  4GPJ A;  4UIW A;  5FE6 A;  4ALG A;  4Z6H A;  2N9G A;  5LKX A;  4Z1S A;  2E3K A;  5H1V A;  4QSW A;  4QY4 A;  3MQM A;  3QZV A;  4A9H A;  5D3J A;  4YYH A;  4QR5 A;  4CFL A;  2F6N A;  5C87 A;  5DY7 A;  4A9J A;  2OSS A;  2YDW A;  5HCL A;  2WP1 A;  3MUL A;  4NYX A;  5HRW A;  5CQT A;  2WP2 A;  4QUU A;  5AME A;  4A9N A;  4CUP A;  4A9L A;  5F62 A;  2DVQ A;  4NQM A;  5HLS A;  4NUE A;  3DAI A;  4MR3 A;  4MR4 A;  2L5E A;  3UV5 A;  5DYC A;  3O33 A;  4QEV A;  5I89 A;  5DYX A;  4N4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...