5D0CA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
129
structure length
129
Chain Sequence
LVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 4
molecule tags Signaling protein/inhibitor
source organism Homo sapiens
total genus 41
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5d0cA01
5CQ8A 5EVAA 5AMEA 4Z6HA 4CUQA 5FFWA 5DYXA 4QSVA 2E7OA 2D9EA 4QEWA 2DATA 4HXMA 4Y03A 5CGPA 3AQAA 5A5NA 5G4RA 3LQIA 4KV4A 4IR3A 4CURA 4YYIA 5KU3A 5C4QA 3LQJA 4YC9A 5CQ5A 2L84A 4YYKA 5EI4A 5L99A 3P1CA 4YYGA 5E3DA 5J0DA 5DKCA 3QZVA 4LYWA 5CUDA 5EGUA 5I89A 3TLPA 5KTUA 5E9LA 5KO4A 4N4HA 5CUGA 5II1A 2WP2A 5A5QA 5F60A 3UVDA 5IBNA 5E9KA 4NR8A 4A9HA 5I7XA 5IIDA 5L8UA 4UYHA 3MQMA 4HXSA 5HLSA 5CU8A 4DONA 5KHMA 5ENGA 4ALGA 5CPEA 5EA1A 2R10A 4PCEA 4F3IA 5ETDA 5CQAA 3O36A 4HBXA 2RNYA 5HQ5A 5DX4A 4YADA 5EWDA 5D7XA 4HXRA 2RO1A 3S91A 5A5PA 2YQDA 5E0RA 4X2IA 2G4AA 3O35A 3P5OA 5G4SA 4UIUA 4O74A 2I8NA 5ACYA 5DW2A 4QB3A 5HM0A 5I88A 5A81A 3G0JA 5I40A 4IR4A 2DKWA 3LXJA 5EV9A 5FE4A 3U5KA 4O77A 4A9NA 3Q2EA 4YK0A 5IG6A 5A83A 5EM3A 3QZSA 2I7KA 4J0RA 5EU1A 5FE3A 3UV4A 5CQ4A 5LVRA 5DYAA 4KCXA 4BJXA 4HXPA 5D25A 3SVFA 4MR4A 4A9LA 5A5RA 4NYWA 3UVXA 4AKNA 4CUSA 5F1LA 3MUKA 5F62A 4LYIA 2RFJA 4YH3A 5EISA 5D3JA 4IORA 5KTXA 4TYLA 4J3IA 5FG5A 5HFQA 4WHUA 4WIVA 5HRWA 2DVRA 4YYMA 3G0LA 1F68A 4BW2A 5E73A 5A7CA 4HXOA 2N9GA 4UIYA 4CFLA 1ZS5A 4N3WA 3UW9A 2YEKA 4ZW1A 5HQ7A 5AMFA 3JVLA 4Q0OA 4E96A 5LKTA 4O75A 3SVGA 4ZC9A 4QY4A 2YEMA 3JVMA 5EPBA 4NUDA 5CY9A 2DWWA 3P1DA 3P1EA 4N4IA 4Q0NA 4TZ2A 5EWCA 3UVYA 5DLXA 4A9KA 4YBMA 4Z1QA 4A9FA 5BT3A 5D3HA 4NRCA 5HJCA 5DW1A 5FH6A 5I1QA 4J0SA 5LUUA 2OUOA 4CUUA 5TB6A 5I80A 3U5MA 1EQFA 5CRMA 4O7AA 4YAXA 4TT2A 5HEMA 4CL9A 5FB0A 3HMHA 4O7CA 5EPRA 5TCMA 4CLBA 3U5NA 4NQNA 4NUCA 4UYEA 5E3GA 5L8TA 4TZ8A 5EICA 5CUBA 2RI7A 4KV1A 4MR3A 4NYXA 5HRVA 2NXBA 5FFYA 4YATA 5F3AA 4LZSA 5E7DA 4TT6A 4PY6A 5F5ZA 5FB1A 4NS5A 5C7NA 5D24A 4J1PA 4UIVA 5DYUA 5K29A 4OGJA 5FDZA 3U5LA 5CRZA 2YW5A 4CUPA 4IOOA 3O33A 5FH7A 5BT4A 3AADA 5HELA 5JI8A 3D7CA 4YH4A 5ENEA 3MB4A 5FE5A 5ENJA 4O71A 4IR5A 2YYNA 4QSRA 5H1UA 4TTEA 5FE7A 4UIWA 4BW1A 4MEQA 4QUUA 5AD3A 5IGNA 5LJ2A 5FG4A 5CFWA 4BW3A 4TQNA 5A5SA 2F6JA 5ENFA 4QNSA 5D26A 3ZYUA 3MXFA 4NR7A 2R0SA 4UIZA 4QR3A 5CUCA 3QZTA 3DAIA 4HXKA 5CQ6A 2RNXA 1JSPB 3MULA 4QBMA 3K2JA 5DFDA 5DKDA 2L5EA 4IR6A 4LC2A 4YY4A 5I7YA 4N4FA 5HRXA 4TT4A 4QSUA 3DWYA 4UYFB 5HENA 5DYCA 4O70A 4PKLA 5CP5A 2GRCA 4UITA 5ENHA 5F2PA 4QSSA 5HFRA 4NR5A 4QUTA 5FE0A 5I83A 4A9MA 1X0JA 5C8GA 4C67A 3LQHA 4QYLA 3O34A 5F61A 5L96A 4Z6IA 2D82A 5FE8A 3S92A 5E9VA 2LSPB 4QEVA 4YYHA 2RNWA 5ENBA 3U5OA 2H60A 3JVJA 4NRBA 4O7EA 5DKHA 4O76A 3JVKA 3UV2A 2DVQA 5FH8A 5E9YA 3LJWA 3FKMX 5A82A 4O72A 4QC3A 4LDFA 5H85A 5CQ3A 4CFKA 4QSXA 5CQTA 5EWVA 5H1VA 5I86A 2R0VA 4MEPA 5FG6A 1JM4B 4XY9A 5ETBA 5KTWA 4QZSA 5E74A 1WUGA 5HQ6A 3HMFA 5CUEA 3HMEA 4HBVA 2F6NA 5LKZA 1E6IA 4LRGA 4BHWA 4QSWA 5F36A 4TU4A 3Q2FA 4NXJA 1N72A 5LKXA 4LZRA 4MENA 3UVWA 5H1TA 5EQ1A 4MR6A 2MJVB 5D3LA 4Z93A 5CQ7A 4UYGA 5C87A 4QR4A 3U5JA 4O7FA 2DVVA 2YELA 5DFCA 5DBMA 3RCWA 2FSAA 2R0YA 4A9OA 5CS8A 2KTBB 5DLZA 4UIXA 5EP7A 4NR6A 5LJ1A 4UYDA 5CZGA 4QSTA 5AD2A 5D0CA 4HBWA 4UYFA 5LKUA 5C85A 5I29A 4ALHA 3GG3A 4LR6A 4A9IA 3ONIA 4CUTA 4IOQA 4YYDA 4N4GA 4QC1A 4LYSA 5D3PA 5L98A 4NR9A 4GPJA 5C89A 4YY6A 5EWHA 4ZQLA 3UV5A 4HXNA 5EWWA 5FE6A 3SVHA 5LVQA 5IGLA 5LJ0A 1WUMA 5D3SA 4XY8A 4NUEA 4MR5A 5IGKA 4YYJA 4Z1SA 2OSSA 4XUAA 3IU6A 2YDWA 5D3TA 4WHWA 5CUAA 4LZ2A 4YBSA 5EK9A 4NRAA 4TS8A 5BT5A 4HBYA 5F25A 4QSQA 4TU6A 5FE2A 2L85A 4QEUA 5D3NA 2DVSA 4NYVA 4A9EA 4XYAA 4O78A 4YYNA 5COIA 4PTBA 2RS9B 5DFBA 3MB3A 4O7BA 4XUBA 4A9JA 2E7NA 4HXLA 5HCLA 4OUFA 4MEOA 4RVRA 3U5PA 4NQMA 5JWMA 5A5OA 4PCIA 4YABA 2OO1A 5CTLA 5EPSA 5F1HA 4NR4A 4QR5A 2WP1A 4QYDA 3NXBA 5FBXA 3P1FA 4C66A 5D3RA 5DY7A 5II2A 4QSPA 3O37A 5E9IA 4BW4A 4OGIA 5IGMA 5L97A 5ENCA 5FFVA 3I3JA 4YBTA 5F63A 3IU5A 5FE1A 5FE9A 4PS5A 5E9MA 5A85A 2E3KA 5ENIA 4FLPA
chains in the Genus database with same CATH superfamily
5CQ8A 5EVAA 5AMEA 4Z6HA 4CUQA 5FFWA 5DYXA 4QSVA 2D9EA 2E7OA 4QEWA 2DATA 4HXMA 4Y03A 5CGPA 3AQAA 5A5NA 5G4RA 3LQIA 4KV4A 4IR3A 4CURA 4YYIA 5KU3A 5C4QA 3LQJA 4YC9A 5CQ5A 2L84A 4YYKA 5EI4A 5L99A 3P1CA 4YYGA 5E3DA 5J0DA 5DKCA 3QZVA 4LYWA 5CUDA 5EGUA 5I89A 3TLPA 5KTUA 5E9LA 5KO4A 4N4HA 5CUGA 5II1A 2WP2A 5A5QA 5F60A 3UVDA 5IBNA 5E9KA 4NR8A 4A9HA 5I7XA 5IIDA 5L8UA 4UYHA 3MQMA 4HXSA 5HLSA 5CU8A 4DONA 5KHMA 5ENGA 4ALGA 5CPEA 5EA1A 2R10A 4PCEA 4F3IA 5ETDA 5CQAA 3O36A 4HBXA 2RNYA 5HQ5A 5DX4A 4YADA 5EWDA 5D7XA 4HXRA 2RO1A 3S91A 5A5PA 2YQDA 5E0RA 4X2IA 2G4AA 3O35A 3P5OA 5G4SA 4UIUA 4O74A 2I8NA 5ACYA 5DW2A 4QB3A 5HM0A 5I88A 5A81A 3G0JA 3VKHA 5I40A 4IR4A 2DKWA 3LXJA 5EV9A 5FE4A 3U5KA 4O77A 4A9NA 3Q2EA 4YK0A 5IG6A 5A83A 5EM3A 3QZSA 2I7KA 4J0RA 5EU1A 5FE3A 3UV4A 5CQ4A 5LVRA 5DYAA 4KCXA 4BJXA 4HXPA 5D25A 3SVFA 4MR4A 4A9LA 5A5RA 4NYWA 3UVXA 4AKNA 4CUSA 5F1LA 3MUKA 5F62A 4LYIA 2RFJA 4YH3A 5EISA 5D3JA 4IORA 5KTXA 4TYLA 4J3IA 5FG5A 5HFQA 4WHUA 4WIVA 5HRWA 2DVRA 4YYMA 3G0LA 1F68A 4BW2A 5E73A 5A7CA 4HXOA 2N9GA 4UIYA 4CFLA 1ZS5A 4N3WA 3UW9A 2YEKA 4ZW1A 5HQ7A 4AI6A 5AMFA 3JVLA 4Q0OA 4E96A 5LKTA 4O75A 3SVGA 4ZC9A 4QY4A 3VKGA 2YEMA 3JVMA 5EPBA 4NUDA 5CY9A 2DWWA 3P1DA 3P1EA 4N4IA 4Q0NA 4TZ2A 5EWCA 3UVYA 5DLXA 4A9KA 4YBMA 4Z1QA 4A9FA 5BT3A 5D3HA 4NRCA 5HJCA 5DW1A 5FH6A 5I1QA 4J0SA 5LUUA 2OUOA 4CUUA 5TB6A 5I80A 3U5MA 1EQFA 5CRMA 4O7AA 4YAXA 4TT2A 5HEMA 4CL9A 5FB0A 3HMHA 4O7CA 5EPRA 5TCMA 4CLBA 3U5NA 4NQNA 4NUCA 4UYEA 5E3GA 5L8TA 4TZ8A 5EICA 5CUBA 2RI7A 4KV1A 4MR3A 4NYXA 5HRVA 2NXBA 5FFYA 4YATA 5F3AA 4LZSA 5E7DA 4TT6A 4PY6A 5F5ZA 5FB1A 4NS5A 5C7NA 5D24A 4J1PA 4UIVA 5DYUA 5K29A 4OGJA 5FDZA 3U5LA 5CRZA 2YW5A 4CUPA 4IOOA 3O33A 5FH7A 5BT4A 3AADA 5HELA 5JI8A 3D7CA 4YH4A 5ENEA 3MB4A 5FE5A 5ENJA 4O71A 4IR5A 2YYNA 4QSRA 5H1UA 4TTEA 5FE7A 4UIWA 4BW1A 4MEQA 4QUUA 5AD3A 5IGNA 5LJ2A 5FG4A 5CFWA 4BW3A 4TQNA 5A5SA 2F6JA 5ENFA 4QNSA 5D26A 3ZYUA 3MXFA 4NR7A 2R0SA 4UIZA 4QR3A 5CUCA 3QZTA 3DAIA 4HXKA 5CQ6A 2RNXA 1JSPB 4AKHA 3MULA 4QBMA 3K2JA 5DFDA 5DKDA 2L5EA 4IR6A 4LC2A 4YY4A 5I7YA 4N4FA 5HRXA 4TT4A 4QSUA 3DWYA 4UYFB 5HENA 5DYCA 4O70A 4PKLA 5CP5A 2GRCA 4UITA 5ENHA 5F2PA 4QSSA 5HFRA 4NR5A 4QUTA 5FE0A 5I83A 4A9MA 4AKIA 1X0JA 5C8GA 4C67A 3LQHA 4QYLA 3O34A 5F61A 5L96A 4Z6IA 2D82A 5FE8A 3S92A 5E9VA 2LSPB 4QEVA 4YYHA 2RNWA 5ENBA 3U5OA 2H60A 3JVJA 4NRBA 4O7EA 5DKHA 4O76A 3JVKA 3UV2A 2DVQA 5FH8A 5E9YA 3LJWA 3FKMX 5A82A 4O72A 4QC3A 4LDFA 5H85A 5CQ3A 4CFKA 4QSXA 5CQTA 5EWVA 5H1VA 5I86A 2R0VA 4MEPA 5FG6A 1JM4B 4XY9A 5ETBA 5KTWA 4QZSA 5E74A 1PUOA 4AKGA 1WUGA 5HQ6A 3HMFA 3D1BA 5CUEA 3HMEA 4HBVA 2F6NA 5LKZA 1E6IA 4LRGA 4BHWA 3ERRA 4QSWA 5F36A 4TU4A 3Q2FA 4NXJA 1N72A 5LKXA 4LZRA 4MENA 3UVWA 5H1TA 5EQ1A 4MR6A 2MJVB 5D3LA 4Z93A 5CQ7A 4UYGA 5C87A 4QR4A 3U5JA 4O7FA 2DVVA 2YELA 5DFCA 5DBMA 3RCWA 2FSAA 2R0YA 4A9OA 5CS8A 2KTBB 5DLZA 4UIXA 5EP7A 4NR6A 5LJ1A 4UYDA 5CZGA 4QSTA 5AD2A 5D0CA 4HBWA 4UYFA 5LKUA 5C85A 5I29A 4ALHA 3GG3A 4LR6A 4A9IA 3ONIA 4CUTA 4IOQA 4YYDA 4N4GA 4QC1A 4LYSA 5D3PA 5L98A 4NR9A 4GPJA 5C89A 4YY6A 5EWHA 4ZQLA 3UV5A 4HXNA 5EWWA 5FE6A 3SVHA 5LVQA 5IGLA 5LJ0A 1WUMA 5D3SA 4XY8A 4NUEA 4MR5A 5IGKA 4YYJA 4Z1SA 2OSSA 4XUAA 3IU6A 2YDWA 5D3TA 4WHWA 5CUAA 4LZ2A 3D1DA 4YBSA 5EK9A 4NRAA 4TS8A 5BT5A 4HBYA 5F25A 4QSQA 4TU6A 5FE2A 2L85A 4QEUA 5D3NA 2DVSA 4NYVA 4A9EA 4XYAA 4O78A 4YYNA 5COIA 4PTBA 2RS9B 5DFBA 3MB3A 4O7BA 4XUBA 4A9JA 2E7NA 4HXLA 1ZKRA 5HCLA 4OUFA 2EJNA 4MEOA 4RVRA 3U5PA 4NQMA 5JWMA 5A5OA 4PCIA 4YABA 2OO1A 5CTLA 5EPSA 5F1HA 4NR4A 4QR5A 2WP1A 4QYDA 3NXBA 5FBXA 3P1FA 4C66A 5D3RA 5DY7A 5II2A 4QSPA 3O37A 5E9IA 4BW4A 4OGIA 5IGMA 5L97A 5ENCA 5FFVA 3I3JA 4YBTA 5F63A 3IU5A 5FE1A 5FE9A 4PS5A 5E9MA 5A85A 2E3KA 5ENIA 4FLPA
chains in the Genus database with same CATH topology
5CQ8A 5EVAA 5AMEA 4Z6HA 4CUQA 5FFWA 5DYXA 4QSVA 2E7OA 2D9EA 4QEWA 2DATA 4HXMA 4Y03A 5CGPA 3AQAA 5A5NA 5G4RA 3LQIA 4KV4A 4IR3A 4CURA 4YYIA 5KU3A 5C4QA 3LQJA 4YC9A 5CQ5A 2L84A 4YYKA 5EI4A 5L99A 3P1CA 4YYGA 5E3DA 5J0DA 5DKCA 3QZVA 4LYWA 5CUDA 5EGUA 5I89A 3TLPA 5KTUA 5E9LA 5KO4A 4N4HA 5CUGA 5II1A 2WP2A 5A5QA 5F60A 3UVDA 5IBNA 5E9KA 4NR8A 4A9HA 5I7XA 5IIDA 5L8UA 4UYHA 3MQMA 4HXSA 5HLSA 5CU8A 4DONA 5KHMA 5ENGA 4ALGA 5CPEA 5EA1A 2R10A 4PCEA 4F3IA 5ETDA 5CQAA 3O36A 4HBXA 2RNYA 5HQ5A 5DX4A 4YADA 5EWDA 5D7XA 4HXRA 2RO1A 3S91A 5A5PA 2YQDA 5E0RA 4X2IA 2G4AA 3O35A 3P5OA 5G4SA 4UIUA 4O74A 2I8NA 5ACYA 5DW2A 4QB3A 5HM0A 5I88A 5A81A 3G0JA 5I40A 4IR4A 2DKWA 3LXJA 5EV9A 5FE4A 3U5KA 4O77A 4A9NA 3Q2EA 4YK0A 5IG6A 5A83A 5EM3A 3QZSA 2I7KA 4J0RA 5EU1A 5FE3A 3UV4A 5CQ4A 5LVRA 5DYAA 4KCXA 4BJXA 4HXPA 5D25A 3SVFA 4MR4A 4A9LA 5A5RA 4NYWA 3UVXA 4AKNA 4CUSA 5F1LA 3MUKA 5F62A 4LYIA 2RFJA 4YH3A 5EISA 5D3JA 4IORA 5KTXA 4TYLA 4J3IA 5FG5A 5HFQA 4WHUA 4WIVA 5HRWA 2DVRA 4YYMA 3G0LA 1F68A 4BW2A 5E73A 5A7CA 4HXOA 2N9GA 4UIYA 4CFLA 1ZS5A 4N3WA 3UW9A 2YEKA 4ZW1A 5HQ7A 5AMFA 3JVLA 4Q0OA 4E96A 5LKTA 4O75A 3SVGA 4ZC9A 4QY4A 2YEMA 3JVMA 5EPBA 4NUDA 5CY9A 2DWWA 3P1DA 3P1EA 4N4IA 4Q0NA 4TZ2A 5EWCA 3UVYA 5DLXA 4A9KA 4YBMA 4Z1QA 4A9FA 5BT3A 5D3HA 4NRCA 5HJCA 5DW1A 5FH6A 5I1QA 4J0SA 5LUUA 2OUOA 4CUUA 5TB6A 5I80A 3U5MA 1EQFA 5CRMA 4O7AA 4YAXA 4TT2A 5HEMA 4CL9A 5FB0A 3HMHA 4O7CA 5EPRA 5TCMA 4CLBA 3U5NA 4NQNA 4NUCA 4UYEA 5E3GA 5L8TA 4TZ8A 5EICA 5CUBA 2RI7A 4KV1A 4MR3A 4NYXA 5HRVA 2NXBA 5FFYA 4YATA 5F3AA 4LZSA 5E7DA 4TT6A 4PY6A 5F5ZA 5FB1A 4NS5A 5C7NA 5D24A 4J1PA 4UIVA 5DYUA 5K29A 4OGJA 5FDZA 3U5LA 5CRZA 2YW5A 4CUPA 4IOOA 3O33A 5FH7A 5BT4A 3AADA 5HELA 5JI8A 3D7CA 4YH4A 5ENEA 3MB4A 5FE5A 5ENJA 4O71A 4IR5A 2YYNA 4QSRA 5H1UA 4TTEA 5FE7A 4UIWA 4BW1A 4MEQA 4QUUA 5AD3A 5IGNA 5LJ2A 5FG4A 5CFWA 4BW3A 4TQNA 5A5SA 2F6JA 5ENFA 4QNSA 5D26A 3ZYUA 3MXFA 4NR7A 2R0SA 4UIZA 4QR3A 5CUCA 3QZTA 3DAIA 4HXKA 5CQ6A 2RNXA 1JSPB 3MULA 4QBMA 3K2JA 5DFDA 5DKDA 2L5EA 4IR6A 4LC2A 4YY4A 5I7YA 4N4FA 5HRXA 4TT4A 4QSUA 3DWYA 4UYFB 5HENA 5DYCA 4O70A 4PKLA 5CP5A 2GRCA 4UITA 5ENHA 5F2PA 4QSSA 5HFRA 4NR5A 4QUTA 5FE0A 5I83A 4A9MA 1X0JA 5C8GA 4C67A 3LQHA 4QYLA 3O34A 5F61A 5L96A 4Z6IA 2D82A 5FE8A 3S92A 5E9VA 2LSPB 4QEVA 4YYHA 2RNWA 5ENBA 3U5OA 2H60A 3JVJA 4NRBA 4O7EA 5DKHA 4O76A 3JVKA 3UV2A 2DVQA 5FH8A 5E9YA 3LJWA 3FKMX 5A82A 4O72A 4QC3A 4LDFA 5H85A 5CQ3A 4CFKA 4QSXA 5CQTA 5EWVA 5H1VA 5I86A 2R0VA 4MEPA 5FG6A 1JM4B 4XY9A 5ETBA 5KTWA 4QZSA 5E74A 1WUGA 5HQ6A 3HMFA 5CUEA 3HMEA 4HBVA 2F6NA 5LKZA 1E6IA 4LRGA 4BHWA 4QSWA 5F36A 4TU4A 3Q2FA 4NXJA 1N72A 5LKXA 4LZRA 4MENA 3UVWA 5H1TA 5EQ1A 4MR6A 2MJVB 5D3LA 4Z93A 5CQ7A 4UYGA 5C87A 4QR4A 3U5JA 4O7FA 2DVVA 2YELA 5DFCA 5DBMA 3RCWA 2FSAA 2R0YA 4A9OA 5CS8A 2KTBB 5DLZA 4UIXA 5EP7A 4NR6A 5LJ1A 4UYDA 5CZGA 4QSTA 5AD2A 5D0CA 4HBWA 4UYFA 5LKUA 5C85A 5I29A 4ALHA 3GG3A 4LR6A 4A9IA 3ONIA 4CUTA 4IOQA 4YYDA 4N4GA 4QC1A 4LYSA 5D3PA 5L98A 4NR9A 4GPJA 5C89A 4YY6A 5EWHA 4ZQLA 3UV5A 4HXNA 5EWWA 5FE6A 3SVHA 5LVQA 5IGLA 5LJ0A 1WUMA 5D3SA 4XY8A 4NUEA 4MR5A 5IGKA 4YYJA 4Z1SA 2OSSA 4XUAA 3IU6A 2YDWA 5D3TA 4WHWA 5CUAA 4LZ2A 4YBSA 5EK9A 4NRAA 4TS8A 5BT5A 4HBYA 5F25A 4QSQA 4TU6A 5FE2A 2L85A 4QEUA 5D3NA 2DVSA 4NYVA 4A9EA 4XYAA 4O78A 4YYNA 5COIA 4PTBA 2RS9B 5DFBA 3MB3A 4O7BA 4XUBA 4A9JA 2E7NA 4HXLA 5HCLA 4OUFA 4MEOA 4RVRA 3U5PA 4NQMA 5JWMA 5A5OA 4PCIA 4YABA 2OO1A 5CTLA 5EPSA 5F1HA 4NR4A 4QR5A 2WP1A 4QYDA 3NXBA 5FBXA 3P1FA 4C66A 5D3RA 5DY7A 5II2A 4QSPA 3O37A 5E9IA 4BW4A 4OGIA 5IGMA 5L97A 5ENCA 5FFVA 3I3JA 4YBTA 5F63A 3IU5A 5FE1A 5FE9A 4PS5A 5E9MA 5A85A 2E3KA 5ENIA 4FLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQ8 A;  5EVA A;  5AME A;  4Z6H A;  4CUQ A;  5FFW A;  5DYX A;  4QSV A;  2E7O A;  2D9E A;  4QEW A;  2DAT A;  4HXM A;  4Y03 A;  5CGP A;  3AQA A;  5A5N A;  5G4R A;  3LQI A;  4KV4 A;  4IR3 A;  4CUR A;  4YYI A;  5KU3 A;  5C4Q A;  3LQJ A;  4YC9 A;  5CQ5 A;  2L84 A;  4YYK A;  5EI4 A;  5L99 A;  3P1C A;  4YYG A;  5E3D A;  5J0D A;  5DKC A;  3QZV A;  4LYW A;  5CUD A;  5EGU A;  5I89 A;  3TLP A;  5KTU A;  5E9L A;  5KO4 A;  4N4H A;  5CUG A;  5II1 A;  2WP2 A;  5A5Q A;  5F60 A;  3UVD A;  5IBN A;  5E9K A;  4NR8 A;  4A9H A;  5I7X A;  5IID A;  5L8U A;  4UYH A;  3MQM A;  4HXS A;  5HLS A;  5CU8 A;  4DON A;  5KHM A;  5ENG A;  4ALG A;  5CPE A;  5EA1 A;  2R10 A;  4PCE A;  4F3I A;  5ETD A;  5CQA A;  3O36 A;  4HBX A;  2RNY A;  5HQ5 A;  5DX4 A;  4YAD A;  5EWD A;  5D7X A;  4HXR A;  2RO1 A;  3S91 A;  5A5P A;  2YQD A;  5E0R A;  4X2I A;  2G4A A;  3O35 A;  3P5O A;  5G4S A;  4UIU A;  4O74 A;  2I8N A;  5ACY A;  5DW2 A;  4QB3 A;  5HM0 A;  5I88 A;  5A81 A;  3G0J A;  5I40 A;  4IR4 A;  2DKW A;  3LXJ A;  5EV9 A;  5FE4 A;  3U5K A;  4O77 A;  4A9N A;  3Q2E A;  4YK0 A;  5IG6 A;  5A83 A;  5EM3 A;  3QZS A;  2I7K A;  4J0R A;  5EU1 A;  5FE3 A;  3UV4 A;  5CQ4 A;  5LVR A;  5DYA A;  4KCX A;  4BJX A;  4HXP A;  5D25 A;  3SVF A;  4MR4 A;  4A9L A;  5A5R A;  4NYW A;  3UVX A;  4AKN A;  4CUS A;  5F1L A;  3MUK A;  5F62 A;  4LYI A;  2RFJ A;  4YH3 A;  5EIS A;  5D3J A;  4IOR A;  5KTX A;  4TYL A;  4J3I A;  5FG5 A;  5HFQ A;  4WHU A;  4WIV A;  5HRW A;  2DVR A;  4YYM A;  3G0L A;  1F68 A;  4BW2 A;  5E73 A;  5A7C A;  4HXO A;  2N9G A;  4UIY A;  4CFL A;  1ZS5 A;  4N3W A;  3UW9 A;  2YEK A;  4ZW1 A;  5HQ7 A;  5AMF A;  3JVL A;  4Q0O A;  4E96 A;  5LKT A;  4O75 A;  3SVG A;  4ZC9 A;  4QY4 A;  2YEM A;  3JVM A;  5EPB A;  4NUD A;  5CY9 A;  2DWW A;  3P1D A;  3P1E A;  4N4I A;  4Q0N A;  4TZ2 A;  5EWC A;  3UVY A;  5DLX A;  4A9K A;  4YBM A;  4Z1Q A;  4A9F A;  5BT3 A;  5D3H A;  4NRC A;  5HJC A;  5DW1 A;  5FH6 A;  5I1Q A;  4J0S A;  5LUU A;  2OUO A;  4CUU A;  5TB6 A;  5I80 A;  3U5M A;  1EQF A;  5CRM A;  4O7A A;  4YAX A;  4TT2 A;  5HEM A;  4CL9 A;  5FB0 A;  3HMH A;  4O7C A;  5EPR A;  5TCM A;  4CLB A;  3U5N A;  4NQN A;  4NUC A;  4UYE A;  5E3G A;  5L8T A;  4TZ8 A;  5EIC A;  5CUB A;  2RI7 A;  4KV1 A;  4MR3 A;  4NYX A;  5HRV A;  2NXB A;  5FFY A;  4YAT A;  5F3A A;  4LZS A;  5E7D A;  4TT6 A;  4PY6 A;  5F5Z A;  5FB1 A;  4NS5 A;  5C7N A;  5D24 A;  4J1P A;  4UIV A;  5DYU A;  5K29 A;  4OGJ A;  5FDZ A;  3U5L A;  5CRZ A;  2YW5 A;  4CUP A;  4IOO A;  3O33 A;  5FH7 A;  5BT4 A;  3AAD A;  5HEL A;  5JI8 A;  3D7C A;  4YH4 A;  5ENE A;  3MB4 A;  5FE5 A;  5ENJ A;  4O71 A;  4IR5 A;  2YYN A;  4QSR A;  5H1U A;  4TTE A;  5FE7 A;  4UIW A;  4BW1 A;  4MEQ A;  4QUU A;  5AD3 A;  5IGN A;  5LJ2 A;  5FG4 A;  5CFW A;  4BW3 A;  4TQN A;  5A5S A;  2F6J A;  5ENF A;  4QNS A;  5D26 A;  3ZYU A;  3MXF A;  4NR7 A;  2R0S A;  4UIZ A;  4QR3 A;  5CUC A;  3QZT A;  3DAI A;  4HXK A;  5CQ6 A;  2RNX A;  1JSP B;  3MUL A;  4QBM A;  3K2J A;  5DFD A;  5DKD A;  2L5E A;  4IR6 A;  4LC2 A;  4YY4 A;  5I7Y A;  4N4F A;  5HRX A;  4TT4 A;  4QSU A;  3DWY A;  4UYF B;  5HEN A;  5DYC A;  4O70 A;  4PKL A;  5CP5 A;  2GRC A;  4UIT A;  5ENH A;  5F2P A;  4QSS A;  5HFR A;  4NR5 A;  4QUT A;  5FE0 A;  5I83 A;  4A9M A;  1X0J A;  5C8G A;  4C67 A;  3LQH A;  4QYL A;  3O34 A;  5F61 A;  5L96 A;  4Z6I A;  2D82 A;  5FE8 A;  3S92 A;  5E9V A;  2LSP B;  4QEV A;  4YYH A;  2RNW A;  5ENB A;  3U5O A;  2H60 A;  3JVJ A;  4NRB A;  4O7E A;  5DKH A;  4O76 A;  3JVK A;  3UV2 A;  2DVQ A;  5FH8 A;  5E9Y A;  3LJW A;  3FKM X;  5A82 A;  4O72 A;  4QC3 A;  4LDF A;  5H85 A;  5CQ3 A;  4CFK A;  4QSX A;  5CQT A;  5EWV A;  5H1V A;  5I86 A;  2R0V A;  4MEP A;  5FG6 A;  1JM4 B;  4XY9 A;  5ETB A;  5KTW A;  4QZS A;  5E74 A;  1WUG A;  5HQ6 A;  3HMF A;  5CUE A;  3HME A;  4HBV A;  2F6N A;  5LKZ A;  1E6I A;  4LRG A;  4BHW A;  4QSW A;  5F36 A;  4TU4 A;  3Q2F A;  4NXJ A;  1N72 A;  5LKX A;  4LZR A;  4MEN A;  3UVW A;  5H1T A;  5EQ1 A;  4MR6 A;  2MJV B;  5D3L A;  4Z93 A;  5CQ7 A;  4UYG A;  5C87 A;  4QR4 A;  3U5J A;  4O7F A;  2DVV A;  2YEL A;  5DFC A;  5DBM A;  3RCW A;  2FSA A;  2R0Y A;  4A9O A;  5CS8 A;  2KTB B;  5DLZ A;  4UIX A;  5EP7 A;  4NR6 A;  5LJ1 A;  4UYD A;  5CZG A;  4QST A;  5AD2 A;  5D0C A;  4HBW A;  4UYF A;  5LKU A;  5C85 A;  5I29 A;  4ALH A;  3GG3 A;  4LR6 A;  4A9I A;  3ONI A;  4CUT A;  4IOQ A;  4YYD A;  4N4G A;  4QC1 A;  4LYS A;  5D3P A;  5L98 A;  4NR9 A;  4GPJ A;  5C89 A;  4YY6 A;  5EWH A;  4ZQL A;  3UV5 A;  4HXN A;  5EWW A;  5FE6 A;  3SVH A;  5LVQ A;  5IGL A;  5LJ0 A;  1WUM A;  5D3S A;  4XY8 A;  4NUE A;  4MR5 A;  5IGK A;  4YYJ A;  4Z1S A;  2OSS A;  4XUA A;  3IU6 A;  2YDW A;  5D3T A;  4WHW A;  5CUA A;  4LZ2 A;  4YBS A;  5EK9 A;  4NRA A;  4TS8 A;  5BT5 A;  4HBY A;  5F25 A;  4QSQ A;  4TU6 A;  5FE2 A;  2L85 A;  4QEU A;  5D3N A;  2DVS A;  4NYV A;  4A9E A;  4XYA A;  4O78 A;  4YYN A;  5COI A;  4PTB A;  2RS9 B;  5DFB A;  3MB3 A;  4O7B A;  4XUB A;  4A9J A;  2E7N A;  4HXL A;  5HCL A;  4OUF A;  4MEO A;  4RVR A;  3U5P A;  4NQM A;  5JWM A;  5A5O A;  4PCI A;  4YAB A;  2OO1 A;  5CTL A;  5EPS A;  5F1H A;  4NR4 A;  4QR5 A;  2WP1 A;  4QYD A;  3NXB A;  5FBX A;  3P1F A;  4C66 A;  5D3R A;  5DY7 A;  5II2 A;  4QSP A;  3O37 A;  5E9I A;  4BW4 A;  4OGI A;  5IGM A;  5L97 A;  5ENC A;  5FFV A;  3I3J A;  4YBT A;  5F63 A;  3IU5 A;  5FE1 A;  5FE9 A;  4PS5 A;  5E9M A;  5A85 A;  2E3K A;  5ENI A;  4FLP A; 
#chains in the Genus database with same CATH topology
 5CQ8 A;  5EVA A;  5AME A;  4Z6H A;  4CUQ A;  5FFW A;  5DYX A;  4QSV A;  2D9E A;  2E7O A;  4QEW A;  2DAT A;  4HXM A;  4Y03 A;  5CGP A;  3AQA A;  5A5N A;  5G4R A;  3LQI A;  4KV4 A;  4IR3 A;  4CUR A;  4YYI A;  5KU3 A;  5C4Q A;  3LQJ A;  4YC9 A;  5CQ5 A;  2L84 A;  4YYK A;  5EI4 A;  5L99 A;  3P1C A;  4YYG A;  5E3D A;  5J0D A;  5DKC A;  3QZV A;  4LYW A;  5CUD A;  5EGU A;  5I89 A;  3TLP A;  5KTU A;  5E9L A;  5KO4 A;  4N4H A;  5CUG A;  5II1 A;  2WP2 A;  5A5Q A;  5F60 A;  3UVD A;  5IBN A;  5E9K A;  4NR8 A;  4A9H A;  5I7X A;  5IID A;  5L8U A;  4UYH A;  3MQM A;  4HXS A;  5HLS A;  5CU8 A;  4DON A;  5KHM A;  5ENG A;  4ALG A;  5CPE A;  5EA1 A;  2R10 A;  4PCE A;  4F3I A;  5ETD A;  5CQA A;  3O36 A;  4HBX A;  2RNY A;  5HQ5 A;  5DX4 A;  4YAD A;  5EWD A;  5D7X A;  4HXR A;  2RO1 A;  3S91 A;  5A5P A;  2YQD A;  5E0R A;  4X2I A;  2G4A A;  3O35 A;  3P5O A;  5G4S A;  4UIU A;  4O74 A;  2I8N A;  5ACY A;  5DW2 A;  4QB3 A;  5HM0 A;  5I88 A;  5A81 A;  3G0J A;  3VKH A;  5I40 A;  4IR4 A;  2DKW A;  3LXJ A;  5EV9 A;  5FE4 A;  3U5K A;  4O77 A;  4A9N A;  3Q2E A;  4YK0 A;  5IG6 A;  5A83 A;  5EM3 A;  3QZS A;  2I7K A;  4J0R A;  5EU1 A;  5FE3 A;  3UV4 A;  5CQ4 A;  5LVR A;  5DYA A;  4KCX A;  4BJX A;  4HXP A;  5D25 A;  3SVF A;  4MR4 A;  4A9L A;  5A5R A;  4NYW A;  3UVX A;  4AKN A;  4CUS A;  5F1L A;  3MUK A;  5F62 A;  4LYI A;  2RFJ A;  4YH3 A;  5EIS A;  5D3J A;  4IOR A;  5KTX A;  4TYL A;  4J3I A;  5FG5 A;  5HFQ A;  4WHU A;  4WIV A;  5HRW A;  2DVR A;  4YYM A;  3G0L A;  1F68 A;  4BW2 A;  5E73 A;  5A7C A;  4HXO A;  2N9G A;  4UIY A;  4CFL A;  1ZS5 A;  4N3W A;  3UW9 A;  2YEK A;  4ZW1 A;  5HQ7 A;  4AI6 A;  5AMF A;  3JVL A;  4Q0O A;  4E96 A;  5LKT A;  4O75 A;  3SVG A;  4ZC9 A;  4QY4 A;  3VKG A;  2YEM A;  3JVM A;  5EPB A;  4NUD A;  5CY9 A;  2DWW A;  3P1D A;  3P1E A;  4N4I A;  4Q0N A;  4TZ2 A;  5EWC A;  3UVY A;  5DLX A;  4A9K A;  4YBM A;  4Z1Q A;  4A9F A;  5BT3 A;  5D3H A;  4NRC A;  5HJC A;  5DW1 A;  5FH6 A;  5I1Q A;  4J0S A;  5LUU A;  2OUO A;  4CUU A;  5TB6 A;  5I80 A;  3U5M A;  1EQF A;  5CRM A;  4O7A A;  4YAX A;  4TT2 A;  5HEM A;  4CL9 A;  5FB0 A;  3HMH A;  4O7C A;  5EPR A;  5TCM A;  4CLB A;  3U5N A;  4NQN A;  4NUC A;  4UYE A;  5E3G A;  5L8T A;  4TZ8 A;  5EIC A;  5CUB A;  2RI7 A;  4KV1 A;  4MR3 A;  4NYX A;  5HRV A;  2NXB A;  5FFY A;  4YAT A;  5F3A A;  4LZS A;  5E7D A;  4TT6 A;  4PY6 A;  5F5Z A;  5FB1 A;  4NS5 A;  5C7N A;  5D24 A;  4J1P A;  4UIV A;  5DYU A;  5K29 A;  4OGJ A;  5FDZ A;  3U5L A;  5CRZ A;  2YW5 A;  4CUP A;  4IOO A;  3O33 A;  5FH7 A;  5BT4 A;  3AAD A;  5HEL A;  5JI8 A;  3D7C A;  4YH4 A;  5ENE A;  3MB4 A;  5FE5 A;  5ENJ A;  4O71 A;  4IR5 A;  2YYN A;  4QSR A;  5H1U A;  4TTE A;  5FE7 A;  4UIW A;  4BW1 A;  4MEQ A;  4QUU A;  5AD3 A;  5IGN A;  5LJ2 A;  5FG4 A;  5CFW A;  4BW3 A;  4TQN A;  5A5S A;  2F6J A;  5ENF A;  4QNS A;  5D26 A;  3ZYU A;  3MXF A;  4NR7 A;  2R0S A;  4UIZ A;  4QR3 A;  5CUC A;  3QZT A;  3DAI A;  4HXK A;  5CQ6 A;  2RNX A;  1JSP B;  4AKH A;  3MUL A;  4QBM A;  3K2J A;  5DFD A;  5DKD A;  2L5E A;  4IR6 A;  4LC2 A;  4YY4 A;  5I7Y A;  4N4F A;  5HRX A;  4TT4 A;  4QSU A;  3DWY A;  4UYF B;  5HEN A;  5DYC A;  4O70 A;  4PKL A;  5CP5 A;  2GRC A;  4UIT A;  5ENH A;  5F2P A;  4QSS A;  5HFR A;  4NR5 A;  4QUT A;  5FE0 A;  5I83 A;  4A9M A;  4AKI A;  1X0J A;  5C8G A;  4C67 A;  3LQH A;  4QYL A;  3O34 A;  5F61 A;  5L96 A;  4Z6I A;  2D82 A;  5FE8 A;  3S92 A;  5E9V A;  2LSP B;  4QEV A;  4YYH A;  2RNW A;  5ENB A;  3U5O A;  2H60 A;  3JVJ A;  4NRB A;  4O7E A;  5DKH A;  4O76 A;  3JVK A;  3UV2 A;  2DVQ A;  5FH8 A;  5E9Y A;  3LJW A;  3FKM X;  5A82 A;  4O72 A;  4QC3 A;  4LDF A;  5H85 A;  5CQ3 A;  4CFK A;  4QSX A;  5CQT A;  5EWV A;  5H1V A;  5I86 A;  2R0V A;  4MEP A;  5FG6 A;  1JM4 B;  4XY9 A;  5ETB A;  5KTW A;  4QZS A;  5E74 A;  1PUO A;  4AKG A;  1WUG A;  5HQ6 A;  3HMF A;  3D1B A;  5CUE A;  3HME A;  4HBV A;  2F6N A;  5LKZ A;  1E6I A;  4LRG A;  4BHW A;  3ERR A;  4QSW A;  5F36 A;  4TU4 A;  3Q2F A;  4NXJ A;  1N72 A;  5LKX A;  4LZR A;  4MEN A;  3UVW A;  5H1T A;  5EQ1 A;  4MR6 A;  2MJV B;  5D3L A;  4Z93 A;  5CQ7 A;  4UYG A;  5C87 A;  4QR4 A;  3U5J A;  4O7F A;  2DVV A;  2YEL A;  5DFC A;  5DBM A;  3RCW A;  2FSA A;  2R0Y A;  4A9O A;  5CS8 A;  2KTB B;  5DLZ A;  4UIX A;  5EP7 A;  4NR6 A;  5LJ1 A;  4UYD A;  5CZG A;  4QST A;  5AD2 A;  5D0C A;  4HBW A;  4UYF A;  5LKU A;  5C85 A;  5I29 A;  4ALH A;  3GG3 A;  4LR6 A;  4A9I A;  3ONI A;  4CUT A;  4IOQ A;  4YYD A;  4N4G A;  4QC1 A;  4LYS A;  5D3P A;  5L98 A;  4NR9 A;  4GPJ A;  5C89 A;  4YY6 A;  5EWH A;  4ZQL A;  3UV5 A;  4HXN A;  5EWW A;  5FE6 A;  3SVH A;  5LVQ A;  5IGL A;  5LJ0 A;  1WUM A;  5D3S A;  4XY8 A;  4NUE A;  4MR5 A;  5IGK A;  4YYJ A;  4Z1S A;  2OSS A;  4XUA A;  3IU6 A;  2YDW A;  5D3T A;  4WHW A;  5CUA A;  4LZ2 A;  3D1D A;  4YBS A;  5EK9 A;  4NRA A;  4TS8 A;  5BT5 A;  4HBY A;  5F25 A;  4QSQ A;  4TU6 A;  5FE2 A;  2L85 A;  4QEU A;  5D3N A;  2DVS A;  4NYV A;  4A9E A;  4XYA A;  4O78 A;  4YYN A;  5COI A;  4PTB A;  2RS9 B;  5DFB A;  3MB3 A;  4O7B A;  4XUB A;  4A9J A;  2E7N A;  4HXL A;  1ZKR A;  5HCL A;  4OUF A;  2EJN A;  4MEO A;  4RVR A;  3U5P A;  4NQM A;  5JWM A;  5A5O A;  4PCI A;  4YAB A;  2OO1 A;  5CTL A;  5EPS A;  5F1H A;  4NR4 A;  4QR5 A;  2WP1 A;  4QYD A;  3NXB A;  5FBX A;  3P1F A;  4C66 A;  5D3R A;  5DY7 A;  5II2 A;  4QSP A;  3O37 A;  5E9I A;  4BW4 A;  4OGI A;  5IGM A;  5L97 A;  5ENC A;  5FFV A;  3I3J A;  4YBT A;  5F63 A;  3IU5 A;  5FE1 A;  5FE9 A;  4PS5 A;  5E9M A;  5A85 A;  2E3K A;  5ENI A;  4FLP A; 
#chains in the Genus database with same CATH homology
 5CQ8 A;  5EVA A;  5AME A;  4Z6H A;  4CUQ A;  5FFW A;  5DYX A;  4QSV A;  2E7O A;  2D9E A;  4QEW A;  2DAT A;  4HXM A;  4Y03 A;  5CGP A;  3AQA A;  5A5N A;  5G4R A;  3LQI A;  4KV4 A;  4IR3 A;  4CUR A;  4YYI A;  5KU3 A;  5C4Q A;  3LQJ A;  4YC9 A;  5CQ5 A;  2L84 A;  4YYK A;  5EI4 A;  5L99 A;  3P1C A;  4YYG A;  5E3D A;  5J0D A;  5DKC A;  3QZV A;  4LYW A;  5CUD A;  5EGU A;  5I89 A;  3TLP A;  5KTU A;  5E9L A;  5KO4 A;  4N4H A;  5CUG A;  5II1 A;  2WP2 A;  5A5Q A;  5F60 A;  3UVD A;  5IBN A;  5E9K A;  4NR8 A;  4A9H A;  5I7X A;  5IID A;  5L8U A;  4UYH A;  3MQM A;  4HXS A;  5HLS A;  5CU8 A;  4DON A;  5KHM A;  5ENG A;  4ALG A;  5CPE A;  5EA1 A;  2R10 A;  4PCE A;  4F3I A;  5ETD A;  5CQA A;  3O36 A;  4HBX A;  2RNY A;  5HQ5 A;  5DX4 A;  4YAD A;  5EWD A;  5D7X A;  4HXR A;  2RO1 A;  3S91 A;  5A5P A;  2YQD A;  5E0R A;  4X2I A;  2G4A A;  3O35 A;  3P5O A;  5G4S A;  4UIU A;  4O74 A;  2I8N A;  5ACY A;  5DW2 A;  4QB3 A;  5HM0 A;  5I88 A;  5A81 A;  3G0J A;  5I40 A;  4IR4 A;  2DKW A;  3LXJ A;  5EV9 A;  5FE4 A;  3U5K A;  4O77 A;  4A9N A;  3Q2E A;  4YK0 A;  5IG6 A;  5A83 A;  5EM3 A;  3QZS A;  2I7K A;  4J0R A;  5EU1 A;  5FE3 A;  3UV4 A;  5CQ4 A;  5LVR A;  5DYA A;  4KCX A;  4BJX A;  4HXP A;  5D25 A;  3SVF A;  4MR4 A;  4A9L A;  5A5R A;  4NYW A;  3UVX A;  4AKN A;  4CUS A;  5F1L A;  3MUK A;  5F62 A;  4LYI A;  2RFJ A;  4YH3 A;  5EIS A;  5D3J A;  4IOR A;  5KTX A;  4TYL A;  4J3I A;  5FG5 A;  5HFQ A;  4WHU A;  4WIV A;  5HRW A;  2DVR A;  4YYM A;  3G0L A;  1F68 A;  4BW2 A;  5E73 A;  5A7C A;  4HXO A;  2N9G A;  4UIY A;  4CFL A;  1ZS5 A;  4N3W A;  3UW9 A;  2YEK A;  4ZW1 A;  5HQ7 A;  5AMF A;  3JVL A;  4Q0O A;  4E96 A;  5LKT A;  4O75 A;  3SVG A;  4ZC9 A;  4QY4 A;  2YEM A;  3JVM A;  5EPB A;  4NUD A;  5CY9 A;  2DWW A;  3P1D A;  3P1E A;  4N4I A;  4Q0N A;  4TZ2 A;  5EWC A;  3UVY A;  5DLX A;  4A9K A;  4YBM A;  4Z1Q A;  4A9F A;  5BT3 A;  5D3H A;  4NRC A;  5HJC A;  5DW1 A;  5FH6 A;  5I1Q A;  4J0S A;  5LUU A;  2OUO A;  4CUU A;  5TB6 A;  5I80 A;  3U5M A;  1EQF A;  5CRM A;  4O7A A;  4YAX A;  4TT2 A;  5HEM A;  4CL9 A;  5FB0 A;  3HMH A;  4O7C A;  5EPR A;  5TCM A;  4CLB A;  3U5N A;  4NQN A;  4NUC A;  4UYE A;  5E3G A;  5L8T A;  4TZ8 A;  5EIC A;  5CUB A;  2RI7 A;  4KV1 A;  4MR3 A;  4NYX A;  5HRV A;  2NXB A;  5FFY A;  4YAT A;  5F3A A;  4LZS A;  5E7D A;  4TT6 A;  4PY6 A;  5F5Z A;  5FB1 A;  4NS5 A;  5C7N A;  5D24 A;  4J1P A;  4UIV A;  5DYU A;  5K29 A;  4OGJ A;  5FDZ A;  3U5L A;  5CRZ A;  2YW5 A;  4CUP A;  4IOO A;  3O33 A;  5FH7 A;  5BT4 A;  3AAD A;  5HEL A;  5JI8 A;  3D7C A;  4YH4 A;  5ENE A;  3MB4 A;  5FE5 A;  5ENJ A;  4O71 A;  4IR5 A;  2YYN A;  4QSR A;  5H1U A;  4TTE A;  5FE7 A;  4UIW A;  4BW1 A;  4MEQ A;  4QUU A;  5AD3 A;  5IGN A;  5LJ2 A;  5FG4 A;  5CFW A;  4BW3 A;  4TQN A;  5A5S A;  2F6J A;  5ENF A;  4QNS A;  5D26 A;  3ZYU A;  3MXF A;  4NR7 A;  2R0S A;  4UIZ A;  4QR3 A;  5CUC A;  3QZT A;  3DAI A;  4HXK A;  5CQ6 A;  2RNX A;  1JSP B;  3MUL A;  4QBM A;  3K2J A;  5DFD A;  5DKD A;  2L5E A;  4IR6 A;  4LC2 A;  4YY4 A;  5I7Y A;  4N4F A;  5HRX A;  4TT4 A;  4QSU A;  3DWY A;  4UYF B;  5HEN A;  5DYC A;  4O70 A;  4PKL A;  5CP5 A;  2GRC A;  4UIT A;  5ENH A;  5F2P A;  4QSS A;  5HFR A;  4NR5 A;  4QUT A;  5FE0 A;  5I83 A;  4A9M A;  1X0J A;  5C8G A;  4C67 A;  3LQH A;  4QYL A;  3O34 A;  5F61 A;  5L96 A;  4Z6I A;  2D82 A;  5FE8 A;  3S92 A;  5E9V A;  2LSP B;  4QEV A;  4YYH A;  2RNW A;  5ENB A;  3U5O A;  2H60 A;  3JVJ A;  4NRB A;  4O7E A;  5DKH A;  4O76 A;  3JVK A;  3UV2 A;  2DVQ A;  5FH8 A;  5E9Y A;  3LJW A;  3FKM X;  5A82 A;  4O72 A;  4QC3 A;  4LDF A;  5H85 A;  5CQ3 A;  4CFK A;  4QSX A;  5CQT A;  5EWV A;  5H1V A;  5I86 A;  2R0V A;  4MEP A;  5FG6 A;  1JM4 B;  4XY9 A;  5ETB A;  5KTW A;  4QZS A;  5E74 A;  1WUG A;  5HQ6 A;  3HMF A;  5CUE A;  3HME A;  4HBV A;  2F6N A;  5LKZ A;  1E6I A;  4LRG A;  4BHW A;  4QSW A;  5F36 A;  4TU4 A;  3Q2F A;  4NXJ A;  1N72 A;  5LKX A;  4LZR A;  4MEN A;  3UVW A;  5H1T A;  5EQ1 A;  4MR6 A;  2MJV B;  5D3L A;  4Z93 A;  5CQ7 A;  4UYG A;  5C87 A;  4QR4 A;  3U5J A;  4O7F A;  2DVV A;  2YEL A;  5DFC A;  5DBM A;  3RCW A;  2FSA A;  2R0Y A;  4A9O A;  5CS8 A;  2KTB B;  5DLZ A;  4UIX A;  5EP7 A;  4NR6 A;  5LJ1 A;  4UYD A;  5CZG A;  4QST A;  5AD2 A;  5D0C A;  4HBW A;  4UYF A;  5LKU A;  5C85 A;  5I29 A;  4ALH A;  3GG3 A;  4LR6 A;  4A9I A;  3ONI A;  4CUT A;  4IOQ A;  4YYD A;  4N4G A;  4QC1 A;  4LYS A;  5D3P A;  5L98 A;  4NR9 A;  4GPJ A;  5C89 A;  4YY6 A;  5EWH A;  4ZQL A;  3UV5 A;  4HXN A;  5EWW A;  5FE6 A;  3SVH A;  5LVQ A;  5IGL A;  5LJ0 A;  1WUM A;  5D3S A;  4XY8 A;  4NUE A;  4MR5 A;  5IGK A;  4YYJ A;  4Z1S A;  2OSS A;  4XUA A;  3IU6 A;  2YDW A;  5D3T A;  4WHW A;  5CUA A;  4LZ2 A;  4YBS A;  5EK9 A;  4NRA A;  4TS8 A;  5BT5 A;  4HBY A;  5F25 A;  4QSQ A;  4TU6 A;  5FE2 A;  2L85 A;  4QEU A;  5D3N A;  2DVS A;  4NYV A;  4A9E A;  4XYA A;  4O78 A;  4YYN A;  5COI A;  4PTB A;  2RS9 B;  5DFB A;  3MB3 A;  4O7B A;  4XUB A;  4A9J A;  2E7N A;  4HXL A;  5HCL A;  4OUF A;  4MEO A;  4RVR A;  3U5P A;  4NQM A;  5JWM A;  5A5O A;  4PCI A;  4YAB A;  2OO1 A;  5CTL A;  5EPS A;  5F1H A;  4NR4 A;  4QR5 A;  2WP1 A;  4QYD A;  3NXB A;  5FBX A;  3P1F A;  4C66 A;  5D3R A;  5DY7 A;  5II2 A;  4QSP A;  3O37 A;  5E9I A;  4BW4 A;  4OGI A;  5IGM A;  5L97 A;  5ENC A;  5FFV A;  3I3J A;  4YBT A;  5F63 A;  3IU5 A;  5FE1 A;  5FE9 A;  4PS5 A;  5E9M A;  5A85 A;  2E3K A;  5ENI A;  4FLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...